Citrus Sinensis ID: 024255
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 270 | ||||||
| 224126219 | 465 | predicted protein [Populus trichocarpa] | 0.792 | 0.460 | 0.599 | 1e-69 | |
| 255558089 | 483 | Ribokinase, putative [Ricinus communis] | 0.688 | 0.385 | 0.723 | 3e-69 | |
| 225454708 | 461 | PREDICTED: uncharacterized sugar kinase | 0.533 | 0.312 | 0.888 | 5e-69 | |
| 147866320 | 414 | hypothetical protein VITISV_012090 [Viti | 0.533 | 0.347 | 0.888 | 9e-69 | |
| 297737278 | 366 | unnamed protein product [Vitis vinifera] | 0.533 | 0.393 | 0.888 | 1e-68 | |
| 449461231 | 471 | PREDICTED: uncharacterized sugar kinase | 0.588 | 0.337 | 0.790 | 2e-66 | |
| 449532553 | 260 | PREDICTED: uncharacterized protein LOC10 | 0.588 | 0.611 | 0.790 | 2e-66 | |
| 356543290 | 461 | PREDICTED: uncharacterized sugar kinase | 0.766 | 0.449 | 0.635 | 4e-65 | |
| 226532948 | 458 | uncharacterized protein LOC100273451 [Ze | 0.666 | 0.393 | 0.694 | 3e-64 | |
| 357474331 | 464 | Carbohydrate kinase-like protein [Medica | 0.740 | 0.431 | 0.650 | 2e-63 |
| >gi|224126219|ref|XP_002319785.1| predicted protein [Populus trichocarpa] gi|222858161|gb|EEE95708.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 268 bits (686), Expect = 1e-69, Method: Compositional matrix adjust.
Identities = 154/257 (59%), Positives = 174/257 (67%), Gaps = 43/257 (16%)
Query: 9 SSPTFPLHHPPSSLYHHHPHRTKLQA----LVFRKFSLGKERVRGGFMGKKGGGFLWVSP 64
SSP F L+ P SL+ H+ T L + + K + RG F
Sbjct: 26 SSPIFSLYRNPLSLHAHNTTPTNLSSPYGPIQTSKLDTVAKTSRGSF------------- 72
Query: 65 SSSSSSLSVCWASNGGGGDLGRDNYEEDDEAGDESEADDDGDEYDEEISGSA--SVLPER 122
SSLS N E + G + D+ +EEI G + SVLP+R
Sbjct: 73 --RISSLS---------------NIERELGTGSQ-------DDEEEEIEGVSPTSVLPDR 108
Query: 123 WDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGCSYKAAAGGSL 182
WDVLGLGQAMVDFSG VDD+FL+RLGLEKGTRK+VNHEERGRVLRAMDGCSYKAAAGGSL
Sbjct: 109 WDVLGLGQAMVDFSGTVDDEFLKRLGLEKGTRKVVNHEERGRVLRAMDGCSYKAAAGGSL 168
Query: 183 SNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAKLRRANVAFCSEPIKDGTTGT 242
SNSLVALARLG K +GGPALNVAM GSVGSDPLGGFYR+KL+RANV F SEP+KDGTTGT
Sbjct: 169 SNSLVALARLGCKSVGGPALNVAMAGSVGSDPLGGFYRSKLQRANVNFLSEPVKDGTTGT 228
Query: 243 VIVLTTPDAQRAMLAYQ 259
VIVLTTPDAQR MLA+Q
Sbjct: 229 VIVLTTPDAQRTMLAHQ 245
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255558089|ref|XP_002520073.1| Ribokinase, putative [Ricinus communis] gi|223540837|gb|EEF42397.1| Ribokinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225454708|ref|XP_002271653.1| PREDICTED: uncharacterized sugar kinase slr0537-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147866320|emb|CAN82032.1| hypothetical protein VITISV_012090 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737278|emb|CBI26479.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449461231|ref|XP_004148345.1| PREDICTED: uncharacterized sugar kinase slr0537-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449532553|ref|XP_004173245.1| PREDICTED: uncharacterized protein LOC101230396, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356543290|ref|XP_003540095.1| PREDICTED: uncharacterized sugar kinase slr0537-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|226532948|ref|NP_001141360.1| uncharacterized protein LOC100273451 [Zea mays] gi|194704168|gb|ACF86168.1| unknown [Zea mays] gi|195644036|gb|ACG41486.1| carbohydrate kinase-like protein [Zea mays] gi|414867871|tpg|DAA46428.1| TPA: carbohydrate kinase-like protein [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|357474331|ref|XP_003607450.1| Carbohydrate kinase-like protein [Medicago truncatula] gi|355508505|gb|AES89647.1| Carbohydrate kinase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 270 | ||||||
| TAIR|locus:2137782 | 471 | NARA5 "GENES NECESSARY FOR THE | 0.948 | 0.543 | 0.511 | 6.6e-58 | |
| TIGR_CMR|SPO_3582 | 328 | SPO_3582 "kinase, pfkB family" | 0.466 | 0.384 | 0.328 | 7.1e-14 | |
| ZFIN|ZDB-GENE-030131-948 | 345 | adkb "adenosine kinase b" [Dan | 0.470 | 0.368 | 0.283 | 0.00034 |
| TAIR|locus:2137782 NARA5 "GENES NECESSARY FOR THE ACHIEVEMENT OF RUBISCO ACCUMULATION 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 595 (214.5 bits), Expect = 6.6e-58, P = 6.6e-58
Identities = 133/260 (51%), Positives = 153/260 (58%)
Query: 1 MALSLL-PVSSPTFXXXXXXXXXXXXXXXRTKLQALVFRKFSLGKERVRXXXXXXXXXXX 59
MA SLL P+ + + L L G R R
Sbjct: 1 MAFSLLSPIPTSASLFFTLSAITASNNASSSSLSRLYSLYHPKGTLRTRTATSFFGASGN 60
Query: 60 LWVXXXXXXXXXXVCWASNGGGGDLGRDNXXXXXXXXXXXXXXXXXXXXXXXISGSASVL 119
L + VC G G +L D+ + S++
Sbjct: 61 LRIVSMAENRQL-VCRIGGGAGAEL--DDMDEGEIQRIGNEDEDDDEFIQVHANNSSAAS 117
Query: 120 PERWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGCSYKAAAG 179
PERWDVLGLGQAMVDFSG+VDD+FL++LGLEKGTRKL+NHEERG++L+AMDGCSYKAAAG
Sbjct: 118 PERWDVLGLGQAMVDFSGVVDDEFLKKLGLEKGTRKLINHEERGKLLQAMDGCSYKAAAG 177
Query: 180 GSLSNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAKLRRANVAFCSEPIKDGT 239
GSLSN+LVALARLG + I LNVAM GS+G DPLG FY KLRRANV F S PIKDGT
Sbjct: 178 GSLSNTLVALARLGSQSICDRPLNVAMAGSIGGDPLGSFYGTKLRRANVNFLSAPIKDGT 237
Query: 240 TGTVIVLTTPDAQRAMLAYQ 259
TGTVIVLTTPDAQR MLAYQ
Sbjct: 238 TGTVIVLTTPDAQRTMLAYQ 257
|
|
| TIGR_CMR|SPO_3582 SPO_3582 "kinase, pfkB family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-948 adkb "adenosine kinase b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.XIII.2592.1 | pfkB-type carbohydrate kinase family protein (EC-2.7.1.20) (370 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 270 | |||
| PLN02813 | 426 | PLN02813, PLN02813, pfkB-type carbohydrate kinase | 5e-95 | |
| cd01168 | 312 | cd01168, adenosine_kinase, Adenosine kinase (AK) c | 4e-38 | |
| COG0524 | 311 | COG0524, RbsK, Sugar kinases, ribokinase family [C | 3e-13 | |
| pfam00294 | 298 | pfam00294, PfkB, pfkB family carbohydrate kinase | 4e-09 | |
| cd01174 | 292 | cd01174, ribokinase, Ribokinase catalyses the phos | 3e-06 | |
| cd01166 | 294 | cd01166, KdgK, 2-keto-3-deoxygluconate kinase (Kdg | 4e-06 | |
| cd01167 | 295 | cd01167, bac_FRK, Fructokinases (FRKs) mainly from | 5e-06 | |
| cd01942 | 279 | cd01942, ribokinase_group_A, Ribokinase-like subgr | 3e-05 | |
| TIGR02152 | 293 | TIGR02152, D_ribokin_bact, ribokinase | 9e-05 | |
| PTZ00247 | 345 | PTZ00247, PTZ00247, adenosine kinase; Provisional | 2e-04 | |
| PLN02379 | 367 | PLN02379, PLN02379, pfkB-type carbohydrate kinase | 3e-04 | |
| PRK09434 | 304 | PRK09434, PRK09434, aminoimidazole riboside kinase | 0.001 | |
| PRK15074 | 434 | PRK15074, PRK15074, inosine/guanosine kinase; Prov | 0.003 | |
| PTZ00292 | 326 | PTZ00292, PTZ00292, ribokinase; Provisional | 0.003 |
| >gnl|CDD|215434 PLN02813, PLN02813, pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
Score = 285 bits (731), Expect = 5e-95
Identities = 120/157 (76%), Positives = 135/157 (85%)
Query: 103 DDGDEYDEEISGSASVLPERWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEER 162
D ++ + +PERWDVLGLGQAMVDFSGMVDD+FLERLGLEKGTRK++NHEER
Sbjct: 50 QDEEQPEGFGPIPEKAVPERWDVLGLGQAMVDFSGMVDDEFLERLGLEKGTRKVINHEER 109
Query: 163 GRVLRAMDGCSYKAAAGGSLSNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAK 222
G+VLRA+DGCSYKA+AGGSLSN+LVALARLG + GPALNVAM GSVGSDPLG FYR K
Sbjct: 110 GKVLRALDGCSYKASAGGSLSNTLVALARLGSQSAAGPALNVAMAGSVGSDPLGDFYRTK 169
Query: 223 LRRANVAFCSEPIKDGTTGTVIVLTTPDAQRAMLAYQ 259
LRRANV F S+P+KDGTTGTVIVLTTPDAQR ML+YQ
Sbjct: 170 LRRANVHFLSQPVKDGTTGTVIVLTTPDAQRTMLSYQ 206
|
Length = 426 |
| >gnl|CDD|238573 cd01168, adenosine_kinase, Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor | Back alignment and domain information |
|---|
| >gnl|CDD|223598 COG0524, RbsK, Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215842 pfam00294, PfkB, pfkB family carbohydrate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|238579 cd01174, ribokinase, Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP | Back alignment and domain information |
|---|
| >gnl|CDD|238571 cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) | Back alignment and domain information |
|---|
| >gnl|CDD|238572 cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|238917 cd01942, ribokinase_group_A, Ribokinase-like subgroup A | Back alignment and domain information |
|---|
| >gnl|CDD|233751 TIGR02152, D_ribokin_bact, ribokinase | Back alignment and domain information |
|---|
| >gnl|CDD|240328 PTZ00247, PTZ00247, adenosine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178005 PLN02379, PLN02379, pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|236514 PRK09434, PRK09434, aminoimidazole riboside kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185033 PRK15074, PRK15074, inosine/guanosine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185541 PTZ00292, PTZ00292, ribokinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 270 | |||
| PLN02813 | 426 | pfkB-type carbohydrate kinase family protein | 99.93 | |
| PRK15074 | 434 | inosine/guanosine kinase; Provisional | 99.89 | |
| PLN02379 | 367 | pfkB-type carbohydrate kinase family protein | 99.87 | |
| PTZ00247 | 345 | adenosine kinase; Provisional | 99.82 | |
| KOG2854 | 343 | consensus Possible pfkB family carbohydrate kinase | 99.79 | |
| cd01168 | 312 | adenosine_kinase Adenosine kinase (AK) catalyzes t | 99.76 | |
| PRK11142 | 306 | ribokinase; Provisional | 99.73 | |
| PLN02548 | 332 | adenosine kinase | 99.73 | |
| cd01944 | 289 | YegV_kinase_like YegV-like sugar kinase. Found onl | 99.71 | |
| PTZ00292 | 326 | ribokinase; Provisional | 99.71 | |
| cd01174 | 292 | ribokinase Ribokinase catalyses the phosphorylatio | 99.69 | |
| cd01939 | 290 | Ketohexokinase Ketohexokinase (fructokinase, KHK) | 99.67 | |
| cd01942 | 279 | ribokinase_group_A Ribokinase-like subgroup A. Fou | 99.67 | |
| KOG2855 | 330 | consensus Ribokinase [Carbohydrate transport and m | 99.66 | |
| PLN02323 | 330 | probable fructokinase | 99.66 | |
| COG0524 | 311 | RbsK Sugar kinases, ribokinase family [Carbohydrat | 99.65 | |
| cd01947 | 265 | Guanosine_kinase_like Guanosine kinase-like sugar | 99.65 | |
| PRK09850 | 313 | pseudouridine kinase; Provisional | 99.64 | |
| PLN02543 | 496 | pfkB-type carbohydrate kinase family protein | 99.63 | |
| PLN02967 | 581 | kinase | 99.62 | |
| cd01166 | 294 | KdgK 2-keto-3-deoxygluconate kinase (KdgK) phospho | 99.6 | |
| PF00294 | 301 | PfkB: pfkB family carbohydrate kinase; InterPro: I | 99.58 | |
| cd01167 | 295 | bac_FRK Fructokinases (FRKs) mainly from bacteria | 99.58 | |
| cd01945 | 284 | ribokinase_group_B Ribokinase-like subgroup B. Fou | 99.58 | |
| PLN02341 | 470 | pfkB-type carbohydrate kinase family protein | 99.55 | |
| PRK09954 | 362 | putative kinase; Provisional | 99.55 | |
| cd01941 | 288 | YeiC_kinase_like YeiC-like sugar kinase. Found in | 99.54 | |
| TIGR02152 | 293 | D_ribokin_bact ribokinase. This model describes ri | 99.54 | |
| PRK09813 | 260 | fructoselysine 6-kinase; Provisional | 99.53 | |
| PRK09434 | 304 | aminoimidazole riboside kinase; Provisional | 99.51 | |
| cd01940 | 264 | Fructoselysine_kinase_like Fructoselysine kinase-l | 99.5 | |
| TIGR03828 | 304 | pfkB 1-phosphofructokinase. This enzyme acts in co | 99.45 | |
| cd01172 | 304 | RfaE_like RfaE encodes a bifunctional ADP-heptose | 99.44 | |
| cd01943 | 328 | MAK32 MAK32 kinase. MAK32 is a protein found prima | 99.43 | |
| cd01164 | 289 | FruK_PfkB_like 1-phosphofructokinase (FruK), minor | 99.4 | |
| TIGR02198 | 315 | rfaE_dom_I rfaE bifunctional protein, domain I. Rf | 99.39 | |
| cd01937 | 254 | ribokinase_group_D Ribokinase-like subgroup D. Fou | 99.37 | |
| PRK10294 | 309 | 6-phosphofructokinase 2; Provisional | 99.35 | |
| PRK11316 | 473 | bifunctional heptose 7-phosphate kinase/heptose 1- | 99.34 | |
| PRK09513 | 312 | fruK 1-phosphofructokinase; Provisional | 99.32 | |
| PRK13508 | 309 | tagatose-6-phosphate kinase; Provisional | 99.32 | |
| TIGR01231 | 309 | lacC tagatose-6-phosphate kinase. This enzyme is p | 99.31 | |
| TIGR03168 | 303 | 1-PFK hexose kinase, 1-phosphofructokinase family. | 99.29 | |
| PLN02630 | 335 | pfkB-type carbohydrate kinase family protein | 99.11 | |
| cd01946 | 277 | ribokinase_group_C Ribokinase-like subgroup C. Fou | 98.97 | |
| KOG2947 | 308 | consensus Carbohydrate kinase [Carbohydrate transp | 98.83 | |
| COG2870 | 467 | RfaE ADP-heptose synthase, bifunctional sugar kina | 98.4 | |
| cd00287 | 196 | ribokinase_pfkB_like ribokinase/pfkB superfamily: | 98.06 | |
| COG1105 | 310 | FruK Fructose-1-phosphate kinase and related fruct | 98.02 | |
| KOG3009 | 614 | consensus Predicted carbohydrate kinase, contains | 96.64 | |
| PF09026 | 101 | CENP-B_dimeris: Centromere protein B dimerisation | 90.04 |
| >PLN02813 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
Probab=99.93 E-value=4.2e-25 Score=214.15 Aligned_cols=163 Identities=74% Similarity=1.135 Sum_probs=143.4
Q ss_pred CCCCCCcccccccCCCCCCCCCcEEEEcCcceeeEeecChhHHHhhccCCCceeeeccccccceeeeccCCccEEecCCh
Q 024255 102 DDDGDEYDEEISGSASVLPERWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGCSYKAAAGGS 181 (270)
Q Consensus 102 ~~~~~~~~~~~~~~~~~~~~~~~VlvIG~alVDii~~vd~~~pe~~~L~~G~~~lv~~ee~~~l~e~i~~~~~~~~~GGs 181 (270)
++|++|+|...+.+....+++++|++||++++|++..+++.|++++++++++++++++++..++++++.+..+...+||+
T Consensus 49 ~~~~~~~~~~~~~~~~~~~~~~~vl~iG~~~vDi~~~v~~~fl~~~~lp~~~~~~i~~~~~~~l~e~~~~~~~~~~~GG~ 128 (426)
T PLN02813 49 QQDEEQPEGFGPIPEKAVPERWDVLGLGQAMVDFSGMVDDEFLERLGLEKGTRKVINHEERGKVLRALDGCSYKASAGGS 128 (426)
T ss_pred cCCCCCccccCCCCcccCCCcceEEEeCCceeEEEEecCHHHHHHcCCCcCcccccCHHHHHHHHHHhhccCceEecCcH
Confidence 44455556777888889999999999999999999999998999999999999999999999999998888889999999
Q ss_pred HHHHHHHHHHhCCCCCCCCCcceEEEEEeCCCchHHHHHHHHHHcCCCCccccccCCCCceEEEEEcCCCCeEEEEecCc
Q 024255 182 LSNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAKLRRANVAFCSEPIKDGTTGTVIVLTTPDAQRAMLAYQVS 261 (270)
Q Consensus 182 AaNtAvaLARLG~~~~~~p~~~V~fVG~VGdD~~Ge~I~e~L~e~GVdt~~v~~~~g~TG~~~VLv~~dGeRTiv~~~GA 261 (270)
++|+|++|+|||.+....++.+|.|+|+||+|.+|+++++.|++.||++.++...+.+||+++++++++|+|+|++|+|+
T Consensus 129 ~~N~AvalarLG~~~~~~~~~~v~~ig~VG~D~~G~~i~~~L~~~GVd~~~~~~~~~~Tg~~~ilv~~~gertii~~~Ga 208 (426)
T PLN02813 129 LSNTLVALARLGSQSAAGPALNVAMAGSVGSDPLGDFYRTKLRRANVHFLSQPVKDGTTGTVIVLTTPDAQRTMLSYQGT 208 (426)
T ss_pred HHHHHHHHHHhccccccCCCCcEEEEEEeCCChHHHHHHHHHHHcCCcccceecCCCCceEEEEEEcCCCCceeeeccCc
Confidence 99999999999942222233347999999999999999999999999999887556799999999999999999999998
Q ss_pred ccc
Q 024255 262 FQR 264 (270)
Q Consensus 262 n~~ 264 (270)
+..
T Consensus 209 ~~~ 211 (426)
T PLN02813 209 SST 211 (426)
T ss_pred hhh
Confidence 744
|
|
| >PRK15074 inosine/guanosine kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02379 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >PTZ00247 adenosine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2854 consensus Possible pfkB family carbohydrate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd01168 adenosine_kinase Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor | Back alignment and domain information |
|---|
| >PRK11142 ribokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02548 adenosine kinase | Back alignment and domain information |
|---|
| >cd01944 YegV_kinase_like YegV-like sugar kinase | Back alignment and domain information |
|---|
| >PTZ00292 ribokinase; Provisional | Back alignment and domain information |
|---|
| >cd01174 ribokinase Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP | Back alignment and domain information |
|---|
| >cd01939 Ketohexokinase Ketohexokinase (fructokinase, KHK) catalyzes the phosphorylation of fructose to fructose-1-phosphate (F1P), the first step in the metabolism of dietary fructose | Back alignment and domain information |
|---|
| >cd01942 ribokinase_group_A Ribokinase-like subgroup A | Back alignment and domain information |
|---|
| >KOG2855 consensus Ribokinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02323 probable fructokinase | Back alignment and domain information |
|---|
| >COG0524 RbsK Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd01947 Guanosine_kinase_like Guanosine kinase-like sugar kinases | Back alignment and domain information |
|---|
| >PRK09850 pseudouridine kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02543 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >PLN02967 kinase | Back alignment and domain information |
|---|
| >cd01166 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) | Back alignment and domain information |
|---|
| >PF00294 PfkB: pfkB family carbohydrate kinase; InterPro: IPR011611 This entry includes a variety of carbohydrate and pyrimidine kinases | Back alignment and domain information |
|---|
| >cd01167 bac_FRK Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate | Back alignment and domain information |
|---|
| >cd01945 ribokinase_group_B Ribokinase-like subgroup B | Back alignment and domain information |
|---|
| >PLN02341 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >PRK09954 putative kinase; Provisional | Back alignment and domain information |
|---|
| >cd01941 YeiC_kinase_like YeiC-like sugar kinase | Back alignment and domain information |
|---|
| >TIGR02152 D_ribokin_bact ribokinase | Back alignment and domain information |
|---|
| >PRK09813 fructoselysine 6-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09434 aminoimidazole riboside kinase; Provisional | Back alignment and domain information |
|---|
| >cd01940 Fructoselysine_kinase_like Fructoselysine kinase-like | Back alignment and domain information |
|---|
| >TIGR03828 pfkB 1-phosphofructokinase | Back alignment and domain information |
|---|
| >cd01172 RfaE_like RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose | Back alignment and domain information |
|---|
| >cd01943 MAK32 MAK32 kinase | Back alignment and domain information |
|---|
| >cd01164 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases | Back alignment and domain information |
|---|
| >TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I | Back alignment and domain information |
|---|
| >cd01937 ribokinase_group_D Ribokinase-like subgroup D | Back alignment and domain information |
|---|
| >PRK10294 6-phosphofructokinase 2; Provisional | Back alignment and domain information |
|---|
| >PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09513 fruK 1-phosphofructokinase; Provisional | Back alignment and domain information |
|---|
| >PRK13508 tagatose-6-phosphate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01231 lacC tagatose-6-phosphate kinase | Back alignment and domain information |
|---|
| >TIGR03168 1-PFK hexose kinase, 1-phosphofructokinase family | Back alignment and domain information |
|---|
| >PLN02630 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >cd01946 ribokinase_group_C Ribokinase-like subgroup C | Back alignment and domain information |
|---|
| >KOG2947 consensus Carbohydrate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group | Back alignment and domain information |
|---|
| >COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3009 consensus Predicted carbohydrate kinase, contains PfkB domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 270 | ||||
| 3ubo_A | 354 | The Crystal Structure Of Adenosine Kinase From Sino | 5e-11 | ||
| 4e3a_A | 352 | Crystal Structure Of Probable Sugar Kinase Protein | 3e-07 | ||
| 1bx4_A | 345 | Structure Of Human Adenosine Kinase At 1.50 Angstro | 7e-05 |
| >pdb|3UBO|A Chain A, The Crystal Structure Of Adenosine Kinase From Sinorhizobium Meliloti Length = 354 | Back alignment and structure |
|
| >pdb|4E3A|A Chain A, Crystal Structure Of Probable Sugar Kinase Protein From Rhizobium Etli Cfn 42 Length = 352 | Back alignment and structure |
| >pdb|1BX4|A Chain A, Structure Of Human Adenosine Kinase At 1.50 Angstroms Length = 345 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 270 | |||
| 4e3a_A | 352 | Sugar kinase protein; structural genomics, protein | 5e-46 | |
| 3otx_A | 347 | Adenosine kinase, putative; AP5A, transferase-tran | 2e-38 | |
| 1bx4_A | 345 | Protein (adenosine kinase); human adenosine kinase | 3e-36 | |
| 3loo_A | 365 | Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad | 2e-33 | |
| 2abs_A | 383 | Adenosine kinase, AK; ribokinase fold, alpha/beta, | 7e-32 | |
| 2hlz_A | 312 | Ketohexokinase; non-protein kinase, creatine kinas | 1e-18 | |
| 2c4e_A | 302 | Sugar kinase MJ0406; transferase, nucleoside kinas | 1e-10 | |
| 3h49_A | 325 | Ribokinase; transferase,PFKB family,sugar kinase Y | 4e-10 | |
| 2qcv_A | 332 | Putative 5-dehydro-2-deoxygluconokinase; structura | 3e-09 | |
| 3hj6_A | 327 | Fructokinase, FRK; fructose, transferase, carbohyd | 8e-09 | |
| 3pl2_A | 319 | Sugar kinase, ribokinase family; PFKB PFAM motif, | 1e-08 | |
| 2pkf_A | 334 | Adenosine kinase; transferase, S genomics, TB stru | 2e-08 | |
| 2qhp_A | 296 | Fructokinase; NP_810670.1, PFKB family carbohydrat | 9e-08 | |
| 3ljs_A | 338 | Fructokinase; fructokianse, PSI2, NYSGXRC, structu | 1e-07 | |
| 3ewm_A | 313 | Uncharacterized sugar kinase PH1459; carbohydrate | 1e-07 | |
| 1v1a_A | 309 | 2-keto-3-deoxygluconate kinase; ATP, structural ge | 1e-07 | |
| 4du5_A | 336 | PFKB; structural genomics, PSI-biology, NEW YORK s | 1e-07 | |
| 1tyy_A | 339 | Putative sugar kinase; ribokinase fold, alpha/beta | 2e-07 | |
| 3iq0_A | 330 | Putative ribokinase II; transferase,kinase,SAD,rib | 2e-07 | |
| 2v78_A | 313 | Fructokinase; transferase, PFKB family carbohydrat | 2e-07 | |
| 2dcn_A | 311 | Hypothetical fructokinase; 2-keto-3-deoxygluconate | 3e-07 | |
| 2nwh_A | 317 | AGR_C_3442P, carbohydrate kinase; structural genom | 9e-07 | |
| 3ikh_A | 299 | Carbohydrate kinase; transferase,kinase,SAD,ribose | 2e-06 | |
| 3lhx_A | 319 | Ketodeoxygluconokinase; structural genomics, PSI-2 | 2e-06 | |
| 2rbc_A | 343 | Sugar kinase, AGR_C_4560P; ribokinase family, ATP- | 3e-06 | |
| 4e69_A | 328 | 2-dehydro-3-deoxygluconokinase; putative sugar kin | 6e-06 | |
| 3kd6_A | 313 | Carbohydrate kinase, PFKB family; nucleoside kinas | 8e-06 | |
| 1vm7_A | 311 | Ribokinase; TM0960, structural genomics, JCSG, pro | 1e-05 | |
| 2afb_A | 351 | 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- | 1e-05 | |
| 3go6_A | 310 | Ribokinase RBSK; phosphofructokinase, carbohydrate | 2e-05 | |
| 3kzh_A | 328 | Probable sugar kinase; NYSGXRC, PSI-II, protein st | 2e-05 | |
| 2fv7_A | 331 | Ribokinase; structural genomics, structural genomi | 2e-05 | |
| 1vk4_A | 298 | PFKB carbohydrate kinase TM0415; structural genomi | 2e-05 | |
| 3ktn_A | 346 | Carbohydrate kinase, PFKB family; PFKB family,ribo | 2e-05 | |
| 1rkd_A | 309 | Ribokinase; carbohydrate kinase, ribose, nucleotid | 3e-05 | |
| 3bf5_A | 306 | Ribokinase related protein; 10640157, putative rib | 1e-04 | |
| 3ry7_A | 304 | Ribokinase; transferase; 2.15A {Staphylococcus aur | 2e-04 | |
| 3b1n_A | 326 | Ribokinase, putative; rossmann fold, ATP binding, | 3e-04 |
| >4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Length = 352 | Back alignment and structure |
|---|
Score = 156 bits (397), Expect = 5e-46
Identities = 40/138 (28%), Positives = 62/138 (44%), Gaps = 11/138 (7%)
Query: 122 RWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGCSYKAAAGGS 181
R+DVL +G A+VD +D FL + K L++ E + M A+GGS
Sbjct: 25 RFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNLIDAERAELLYSRMG--PALEASGGS 82
Query: 182 LSNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAKLRRANVAFCSEPIKDG-TT 240
N+ +A LGGK A G+V +D LG + +R V + ++P T
Sbjct: 83 AGNTAAGVANLGGK--------AAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPT 134
Query: 241 GTVIVLTTPDAQRAMLAY 258
++ T D +R+M Y
Sbjct: 135 ARSMIFVTEDGERSMNTY 152
|
| >3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Length = 347 | Back alignment and structure |
|---|
| >1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Length = 345 | Back alignment and structure |
|---|
| >3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Length = 365 | Back alignment and structure |
|---|
| >2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Length = 383 | Back alignment and structure |
|---|
| >2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Length = 312 | Back alignment and structure |
|---|
| >2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Length = 302 | Back alignment and structure |
|---|
| >3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Length = 325 | Back alignment and structure |
|---|
| >2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Length = 332 | Back alignment and structure |
|---|
| >3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Length = 327 | Back alignment and structure |
|---|
| >3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} Length = 319 | Back alignment and structure |
|---|
| >2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Length = 334 | Back alignment and structure |
|---|
| >2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Length = 296 | Back alignment and structure |
|---|
| >3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} PDB: 3lki_A* Length = 338 | Back alignment and structure |
|---|
| >3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Length = 313 | Back alignment and structure |
|---|
| >1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Length = 309 | Back alignment and structure |
|---|
| >4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Length = 336 | Back alignment and structure |
|---|
| >1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Length = 339 | Back alignment and structure |
|---|
| >3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} PDB: 3k9e_A Length = 330 | Back alignment and structure |
|---|
| >2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Length = 313 | Back alignment and structure |
|---|
| >2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Length = 311 | Back alignment and structure |
|---|
| >2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Length = 317 | Back alignment and structure |
|---|
| >3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* Length = 299 | Back alignment and structure |
|---|
| >3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Length = 319 | Back alignment and structure |
|---|
| >2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Length = 343 | Back alignment and structure |
|---|
| >4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Length = 328 | Back alignment and structure |
|---|
| >3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Length = 313 | Back alignment and structure |
|---|
| >1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Length = 311 | Back alignment and structure |
|---|
| >2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Length = 351 | Back alignment and structure |
|---|
| >3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* Length = 310 | Back alignment and structure |
|---|
| >3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Length = 328 | Back alignment and structure |
|---|
| >2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Length = 331 | Back alignment and structure |
|---|
| >1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Length = 298 | Back alignment and structure |
|---|
| >3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Length = 346 | Back alignment and structure |
|---|
| >1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Length = 309 | Back alignment and structure |
|---|
| >3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Length = 306 | Back alignment and structure |
|---|
| >3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Length = 304 | Back alignment and structure |
|---|
| >3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Length = 326 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 270 | |||
| 3uq6_A | 372 | Adenosine kinase, putative; ribokinase, transferas | 99.9 | |
| 4e3a_A | 352 | Sugar kinase protein; structural genomics, protein | 99.88 | |
| 3vas_A | 370 | Putative adenosine kinase; ribokinase, enzyme, tra | 99.87 | |
| 3otx_A | 347 | Adenosine kinase, putative; AP5A, transferase-tran | 99.86 | |
| 3loo_A | 365 | Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad | 99.85 | |
| 1bx4_A | 345 | Protein (adenosine kinase); human adenosine kinase | 99.79 | |
| 2abs_A | 383 | Adenosine kinase, AK; ribokinase fold, alpha/beta, | 99.79 | |
| 3go6_A | 310 | Ribokinase RBSK; phosphofructokinase, carbohydrate | 99.76 | |
| 1rkd_A | 309 | Ribokinase; carbohydrate kinase, ribose, nucleotid | 99.75 | |
| 2fv7_A | 331 | Ribokinase; structural genomics, structural genomi | 99.75 | |
| 3ry7_A | 304 | Ribokinase; transferase; 2.15A {Staphylococcus aur | 99.74 | |
| 2c4e_A | 302 | Sugar kinase MJ0406; transferase, nucleoside kinas | 99.73 | |
| 2hlz_A | 312 | Ketohexokinase; non-protein kinase, creatine kinas | 99.73 | |
| 2rbc_A | 343 | Sugar kinase, AGR_C_4560P; ribokinase family, ATP- | 99.72 | |
| 3ikh_A | 299 | Carbohydrate kinase; transferase,kinase,SAD,ribose | 99.72 | |
| 3h49_A | 325 | Ribokinase; transferase,PFKB family,sugar kinase Y | 99.71 | |
| 3ljs_A | 338 | Fructokinase; fructokianse, PSI2, NYSGXRC, structu | 99.71 | |
| 3kzh_A | 328 | Probable sugar kinase; NYSGXRC, PSI-II, protein st | 99.7 | |
| 3bf5_A | 306 | Ribokinase related protein; 10640157, putative rib | 99.69 | |
| 2pkf_A | 334 | Adenosine kinase; transferase, S genomics, TB stru | 99.69 | |
| 3lhx_A | 319 | Ketodeoxygluconokinase; structural genomics, PSI-2 | 99.67 | |
| 1vm7_A | 311 | Ribokinase; TM0960, structural genomics, JCSG, pro | 99.67 | |
| 2nwh_A | 317 | AGR_C_3442P, carbohydrate kinase; structural genom | 99.67 | |
| 3ewm_A | 313 | Uncharacterized sugar kinase PH1459; carbohydrate | 99.67 | |
| 3pl2_A | 319 | Sugar kinase, ribokinase family; PFKB PFAM motif, | 99.67 | |
| 3b1n_A | 326 | Ribokinase, putative; rossmann fold, ATP binding, | 99.67 | |
| 4e69_A | 328 | 2-dehydro-3-deoxygluconokinase; putative sugar kin | 99.66 | |
| 3hj6_A | 327 | Fructokinase, FRK; fructose, transferase, carbohyd | 99.65 | |
| 2v78_A | 313 | Fructokinase; transferase, PFKB family carbohydrat | 99.65 | |
| 2dcn_A | 311 | Hypothetical fructokinase; 2-keto-3-deoxygluconate | 99.64 | |
| 1tyy_A | 339 | Putative sugar kinase; ribokinase fold, alpha/beta | 99.64 | |
| 1v1a_A | 309 | 2-keto-3-deoxygluconate kinase; ATP, structural ge | 99.64 | |
| 4du5_A | 336 | PFKB; structural genomics, PSI-biology, NEW YORK s | 99.64 | |
| 2qcv_A | 332 | Putative 5-dehydro-2-deoxygluconokinase; structura | 99.62 | |
| 3ktn_A | 346 | Carbohydrate kinase, PFKB family; PFKB family,ribo | 99.62 | |
| 3iq0_A | 330 | Putative ribokinase II; transferase,kinase,SAD,rib | 99.61 | |
| 4gm6_A | 351 | PFKB family carbohydrate kinase; enzyme function i | 99.59 | |
| 2ajr_A | 331 | Sugar kinase, PFKB family; TM0828, possible 1-phos | 99.57 | |
| 3cqd_A | 309 | 6-phosphofructokinase isozyme 2; phosphofructokina | 99.57 | |
| 3umo_A | 309 | 6-phosphofructokinase isozyme 2; glycolysis, trans | 99.56 | |
| 3ie7_A | 320 | LIN2199 protein; phosphofructokinases, transferase | 99.55 | |
| 2f02_A | 323 | Tagatose-6-phosphate kinase; LACC, structural geno | 99.52 | |
| 2qhp_A | 296 | Fructokinase; NP_810670.1, PFKB family carbohydrat | 99.51 | |
| 2jg1_A | 330 | Tagatose-6-phosphate kinase; phosphoryl transfer, | 99.49 | |
| 4e84_A | 352 | D-beta-D-heptose 7-phosphate kinase; LPS-heptose b | 99.46 | |
| 2jg5_A | 306 | Fructose 1-phosphate kinase; 1-phosphofructokinase | 99.42 | |
| 2afb_A | 351 | 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- | 99.41 | |
| 2abq_A | 306 | Fructose 1-phosphate kinase; dimer, structural gen | 99.41 | |
| 3kd6_A | 313 | Carbohydrate kinase, PFKB family; nucleoside kinas | 99.34 | |
| 1vk4_A | 298 | PFKB carbohydrate kinase TM0415; structural genomi | 99.14 |
| >3uq6_A Adenosine kinase, putative; ribokinase, transferase; HET: ADN AMP; 2.30A {Schistosoma mansoni} PDB: 3uq9_A* | Back alignment and structure |
|---|
Probab=99.90 E-value=2.6e-23 Score=193.51 Aligned_cols=138 Identities=20% Similarity=0.255 Sum_probs=119.1
Q ss_pred CCcEEEEcCcceeeEeecChhHHHhhccCCCceeeeccccccceeeeccCCccEEecCChHHHHHHHHHHhCCCCCCCCC
Q 024255 122 RWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGCSYKAAAGGSLSNSLVALARLGGKPIGGPA 201 (270)
Q Consensus 122 ~~~VlvIG~alVDii~~vd~~~pe~~~L~~G~~~lv~~ee~~~l~e~i~~~~~~~~~GGsAaNtAvaLARLG~~~~~~p~ 201 (270)
...|++||+++||+++++++.|+++++|++|.++++++++++.+.+..........+||+++|+|+++++||.+.
T Consensus 26 ~~~v~giGnalvDi~~~v~d~~l~~~~l~kg~m~l~~~~~~~~~~~~~~~~~~~~~~GGsa~N~a~~la~LG~~~----- 100 (372)
T 3uq6_A 26 EGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIAGGATLNTVKMIQWIIQKP----- 100 (372)
T ss_dssp TTCEEEEECCEEEEEEECCTHHHHHTTCCTTEEEECCGGGTTHHHHHHTSSSCEEEECCHHHHHHHHHHHHHCST-----
T ss_pred CCeEEEECCceeeEEEEeCHHHHHHcCCCCCceEEcCHHHHHHHHHHhccCCeEEeCCcHHHHHHHHHHHcCCCC-----
Confidence 346999999999999999999999999999999999866555444444455678899999999999999999762
Q ss_pred cceEEEEEeCCCchHHHHHHHHHHcCCCCccccccCC-CCceEEEEEcCCCCeEEEEecCccccc
Q 024255 202 LNVAMTGSVGSDPLGGFYRAKLRRANVAFCSEPIKDG-TTGTVIVLTTPDAQRAMLAYQVSFQRS 265 (270)
Q Consensus 202 ~~V~fVG~VGdD~~Ge~I~e~L~e~GVdt~~v~~~~g-~TG~~~VLv~~dGeRTiv~~~GAn~~~ 265 (270)
..|+|+|+||+|.+|+++++.|++.||++.++...+. +|+.|+++++ +|+|+|++|+|++...
T Consensus 101 ~~~~fiG~VG~D~~G~~l~~~L~~~GV~~~~~~~~~~~~T~~~~v~~~-dgert~~~~~ga~~~l 164 (372)
T 3uq6_A 101 FVCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAVLVS-EKLRSMVTYLGAACDL 164 (372)
T ss_dssp TSEEEEEEECSSHHHHHHHHHHHHTTCEECCEECCTTCCEEEEEEEEC-SSCEEEEEEEEGGGGC
T ss_pred CcEEEEeeecCCHHHHHHHHHHHHcCCCceeeeecCCCCceEEEEEcC-CCceEEEEeccchhhc
Confidence 2379999999999999999999999999999877664 8999999886 8999999999987653
|
| >4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* | Back alignment and structure |
|---|
| >3vas_A Putative adenosine kinase; ribokinase, enzyme, transferase; HET: ADN; 2.26A {Schistosoma mansoni} PDB: 4dc3_A* 3vaq_A* 3uq6_A* 3uq9_A* | Back alignment and structure |
|---|
| >3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* | Back alignment and structure |
|---|
| >3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* | Back alignment and structure |
|---|
| >2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* | Back alignment and structure |
|---|
| >3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* | Back alignment and structure |
|---|
| >1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* | Back alignment and structure |
|---|
| >2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A | Back alignment and structure |
|---|
| >2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A | Back alignment and structure |
|---|
| >2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* | Back alignment and structure |
|---|
| >3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* | Back alignment and structure |
|---|
| >3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} SCOP: c.72.1.0 PDB: 3lki_A* | Back alignment and structure |
|---|
| >3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} | Back alignment and structure |
|---|
| >3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* | Back alignment and structure |
|---|
| >3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} | Back alignment and structure |
|---|
| >1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* | Back alignment and structure |
|---|
| >3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} SCOP: c.72.1.0 | Back alignment and structure |
|---|
| >3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* | Back alignment and structure |
|---|
| >4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* | Back alignment and structure |
|---|
| >3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} | Back alignment and structure |
|---|
| >2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* | Back alignment and structure |
|---|
| >2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* | Back alignment and structure |
|---|
| >1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* | Back alignment and structure |
|---|
| >1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A | Back alignment and structure |
|---|
| >4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} SCOP: c.72.1.0 PDB: 3k9e_A | Back alignment and structure |
|---|
| >4gm6_A PFKB family carbohydrate kinase; enzyme function initiative, transferase; 2.00A {Listeria grayi dsm 20601} | Back alignment and structure |
|---|
| >2ajr_A Sugar kinase, PFKB family; TM0828, possible 1-phosphofructokinase (EC 2.7.1.56), struct genomics, joint center for structural genomics, JCSG; HET: MSE; 2.46A {Thermotoga maritima} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >3cqd_A 6-phosphofructokinase isozyme 2; phosphofructokinases, PFK-2, glycolysis, transferase; HET: ATP; 1.98A {Escherichia coli} PDB: 3n1c_A* | Back alignment and structure |
|---|
| >3umo_A 6-phosphofructokinase isozyme 2; glycolysis, transferase, PFK, enzyme; HET: ATP; 1.70A {Escherichia coli} PDB: 3n1c_A* 3cqd_A* 3ump_A* 3uqd_A* 3uqe_A* | Back alignment and structure |
|---|
| >3ie7_A LIN2199 protein; phosphofructokinases, transferase, glycero ION, PSI-II, NYSGXRC, kinase, structural genomics, structure initiative; HET: ATP; 1.60A {Listeria innocua} PDB: 3hic_A* 3jul_A* 3q1y_A | Back alignment and structure |
|---|
| >2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* | Back alignment and structure |
|---|
| >2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* | Back alignment and structure |
|---|
| >4e84_A D-beta-D-heptose 7-phosphate kinase; LPS-heptose biosynthesis, beta-clAsp dimerization region, PF carbohydrate kinase, phosphorylation; HET: MSE ANP M7B GMZ; 2.60A {Burkholderia cenocepacia} PDB: 4e8w_A* 4e8y_A* 4e8z_A* | Back alignment and structure |
|---|
| >2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 270 | ||||
| d1bx4a_ | 342 | c.72.1.1 (A:) Adenosine kinase {Human (Homo sapien | 5e-20 | |
| d2absa1 | 350 | c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma g | 5e-18 | |
| d2ajra1 | 319 | c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {T | 5e-09 | |
| d2afba1 | 333 | c.72.1.1 (A:-2-330) 2-keto-3-deoxygluconate kinase | 2e-08 | |
| d1v19a_ | 302 | c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Ther | 4e-06 | |
| d2dcna1 | 308 | c.72.1.1 (A:2-309) Hypothetical fructokinase ST247 | 4e-06 | |
| d1vk4a_ | 288 | c.72.1.1 (A:) Hypothetical protein TM0415 {Thermot | 9e-06 | |
| d1tyya_ | 304 | c.72.1.1 (A:) Aminoimidazole riboside kinase {Salm | 2e-05 | |
| d2abqa1 | 306 | c.72.1.1 (A:1-306) Fructose 1-phosphate kinase Fru | 1e-04 | |
| d2f02a1 | 313 | c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase Lac | 1e-04 | |
| d2fv7a1 | 308 | c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapien | 4e-04 | |
| d1vm7a_ | 299 | c.72.1.1 (A:) Ribokinase {Thermotoga maritima [Tax | 0.002 |
| >d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribokinase-like superfamily: Ribokinase-like family: Ribokinase-like domain: Adenosine kinase species: Human (Homo sapiens) [TaxId: 9606]
Score = 86.0 bits (211), Expect = 5e-20
Identities = 30/131 (22%), Positives = 52/131 (39%), Gaps = 4/131 (3%)
Query: 125 VLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGCSYKAAAGGSLSN 184
+ G+G ++D S +VD DFL++ L+ + L + + + + AGGS N
Sbjct: 6 LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQN 65
Query: 185 SLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAKLRRANVAFCSEPIKDGTTGTVI 244
S+ + +P G +G D G + K A+V + TGT
Sbjct: 66 SIKVAQWMIQQPHK----AATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCA 121
Query: 245 VLTTPDAQRAM 255
T D + +
Sbjct: 122 ACITGDNRSLI 132
|
| >d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} Length = 350 | Back information, alignment and structure |
|---|
| >d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Length = 319 | Back information, alignment and structure |
|---|
| >d2afba1 c.72.1.1 (A:-2-330) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067 [TaxId: 2336]} Length = 333 | Back information, alignment and structure |
|---|
| >d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Length = 302 | Back information, alignment and structure |
|---|
| >d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} Length = 308 | Back information, alignment and structure |
|---|
| >d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Length = 288 | Back information, alignment and structure |
|---|
| >d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} Length = 304 | Back information, alignment and structure |
|---|
| >d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Length = 306 | Back information, alignment and structure |
|---|
| >d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Length = 313 | Back information, alignment and structure |
|---|
| >d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Length = 299 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 270 | |||
| d2absa1 | 350 | Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} | 99.85 | |
| d1bx4a_ | 342 | Adenosine kinase {Human (Homo sapiens) [TaxId: 960 | 99.82 | |
| d2fv7a1 | 308 | Ribokinase {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d1vm7a_ | 299 | Ribokinase {Thermotoga maritima [TaxId: 2336]} | 99.68 | |
| d1rkda_ | 306 | Ribokinase {Escherichia coli [TaxId: 562]} | 99.63 | |
| d2afba1 | 333 | 2-keto-3-deoxygluconate kinase {Thermotoga maritim | 99.62 | |
| d1tyya_ | 304 | Aminoimidazole riboside kinase {Salmonella typhimu | 99.6 | |
| d1v19a_ | 302 | 2-keto-3-deoxygluconate kinase {Thermus thermophil | 99.59 | |
| d2dcna1 | 308 | Hypothetical fructokinase ST2478 {Sulfolobus tokod | 99.55 | |
| d2f02a1 | 313 | Tagatose-6-phosphate kinase LacC {Enterococcus fae | 99.26 | |
| d2ajra1 | 319 | Putative sugar kinase TM0828 {Thermotoga maritima | 99.25 | |
| d2abqa1 | 306 | Fructose 1-phosphate kinase FruB {Bacillus halodur | 99.18 | |
| d1vk4a_ | 288 | Hypothetical protein TM0415 {Thermotoga maritima [ | 99.11 |
| >d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribokinase-like superfamily: Ribokinase-like family: Ribokinase-like domain: Adenosine kinase species: Toxoplasma gondii [TaxId: 5811]
Probab=99.85 E-value=3e-21 Score=171.20 Aligned_cols=138 Identities=22% Similarity=0.326 Sum_probs=116.1
Q ss_pred CCcEEEEcCcceeeEeecChhHHHhhccCCCceeeeccccccceeeeccCCccEEecCChHHHHHHHHHHhCCCCCCCCC
Q 024255 122 RWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGCSYKAAAGGSLSNSLVALARLGGKPIGGPA 201 (270)
Q Consensus 122 ~~~VlvIG~alVDii~~vd~~~pe~~~L~~G~~~lv~~ee~~~l~e~i~~~~~~~~~GGsAaNtAvaLARLG~~~~~~p~ 201 (270)
+++|+|||+++||++.++++.|++++++++|.+.+++.++.. ++..+........+||+++|+|++|++||...
T Consensus 3 p~kil~iG~~~vD~~~~v~~~~l~~~~~~~g~~~~~~~~~~~-~~~~~~~~~~~~~~GG~~~N~a~~la~L~~~g----- 76 (350)
T d2absa1 3 PMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMR-IYSTLDQFNPTSLPGGSALNSVRVVQKLLRKP----- 76 (350)
T ss_dssp CCCEEEECCCEEEEEEECCHHHHHHTTCCTTCEEECCGGGGG-GGGTGGGGCCEEEEESHHHHHHHHHHHHHCST-----
T ss_pred CcEEEEECCceEEEEEEeCHHHHHHcCCCCCcceecCHHHHH-HHHhhhccCceEecCcHHHHHHHHHHHhccCC-----
Confidence 579999999999999999988999999999999998866444 44455445567789999999999999995431
Q ss_pred cceEEEEEeCCCchHHHHHHHHHHcCCCCccccccCCCCceEEEEEcCCCCeEEEEecCcccccc
Q 024255 202 LNVAMTGSVGSDPLGGFYRAKLRRANVAFCSEPIKDGTTGTVIVLTTPDAQRAMLAYQVSFQRSI 266 (270)
Q Consensus 202 ~~V~fVG~VGdD~~Ge~I~e~L~e~GVdt~~v~~~~g~TG~~~VLv~~dGeRTiv~~~GAn~~~~ 266 (270)
.+|.|+|+||+|.+|+++++.|++.||++.++...+..|+.|+++++ +++|+++++.+++....
T Consensus 77 ~~~~~ig~vG~D~~G~~i~~~l~~~gv~~~~~~~~~~~t~~~~v~~~-~~~~~~~~~~~~~~~~~ 140 (350)
T d2absa1 77 GSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLIN-EKERTLCTHLGACGSFR 140 (350)
T ss_dssp TSEEEEEEECSSHHHHHHHHHHHHHTCEEEEEECTTCCCEEEEEEEE-TTEEEEEEECGGGGGCC
T ss_pred ccEEEEecCCCChhhHhHHHHHHhcCCcccccccccccceEEEEEee-ccCcceEeeeccccccc
Confidence 12799999999999999999999999999988665568999999998 67899999988765443
|
| >d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|