Citrus Sinensis ID: 024630

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----

MSFQGPSFGYNVNVMNVKAVKCMPSSCINNLRKHCSLSPLNPYQCNVGLVGSSARRNNIRFMPSANVNLNCEPLPFGRIFQLSSLRPCQVKQSDDTEGNLSGESIMLDEEILKRELQIAIEEEDYVQAAKLRDSLKMLDEDSKTSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWGGQFVTNVFEKLDGQWFICIHHASPVDL

ccccccccccccEEEEEcEEEcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccEEEcccccccccHHHHHHHHHHHHHcccccEEEEEEEEEEEEEccEEEEEEEEEEEcccccccEEEEEEEEEEEccEEEEEEEEcccccc

ccccccccccccEEEEHHHHccccccccccccccccccccccccEEEEEEcccccccEEEEccccEEEccccccccHHHHHHcccccccEEEccccccccccccHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHHHHcccccEEEEEEEEEEEEEccEEEEEEEEEEcccccccccEEEEEEEEEccccEEEEEEccccccc

msfqgpsfgynvnvmnvkavkcmpsscinnlrkhcslsplnpyqcnvglvgssarrnnirfmpsanvnlnceplpfgrifqlsslrpcqvkqsddtegnlsgesimlDEEILKRELQIAIEEEDYVQAAKLRDSLkmldedsktSVLAANARfydsfkngdlATMQGLwargdnvccvhpgasgisgydpvmESWEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRtkgtswggqfVTNVFEkldgqwficihhaspvdl

MSFQGPSFGYNVNVMNVKAVKCMPSSCINNLRKHCSLSPLNPYQCNVGLVGSSARRNNIRFMPSANVNLNCEPLPFGRIFQLSSLRPCQVKqsddtegnlsgesimldeEILKRELQIAIEEEDYVQAAKLRDSLKMLDEDSKTSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRtkgtswggQFVTNVFEKLDGQWFICIHHASPVDL

*******FGYNVNVMNVKAVKCMPSSCINNLRKHCSLSPLNPYQCNVGLVGSSARRNNIRFMPSANVNLNCEPLPFGRIFQLSSLRPC*****************MLDEEILKRELQIAIEEEDYVQAAKLR***********TSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWGGQFVTNVFEKLDGQWFICIHH******

******SFGYNVNVMNVKAVKCMPSSCINNLRKHCSLSPLNPYQCNVGLVGSSARRNNIRFMPSANVNLNCEP*********************************************AIE**DYVQ*A************SKTSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWGGQFVTNVFEKLDGQWFICIHHASPV**

MSFQGPSFGYNVNVMNVKAVKCMPSSCINNLRKHCSLSPLNPYQCNVGLVGSSARRNNIRFMPSANVNLNCEPLPFGRIFQLSSLRP**********GNLSGESIMLDEEILKRELQIAIEEEDYVQAAKLRDSLKMLDEDSKTSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWGGQFVTNVFEKLDGQWFICIHHASPVDL

*****PSFGYNVNVMNVKAVKCMPSSCINNLRKHCSLSPLNPYQCNVGLVGSSARRNNIRFMPSANVNLNCEPLPFGRIFQLSSLRPCQVKQS**********SIMLDEEILKRELQIAIEEEDYVQAAKLRDSLKMLDEDSKTSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWGGQFVTNVFEKLDGQWFICIHHASPV**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		265	2.2.26 [Sep-21-2011]
Q93YV9		231	F-box protein SKIP8 OS=Ar	no	no	0.426	0.489	0.290	2e-11

>sp\|Q93YV9\|SKIP8_ARATH F-box protein SKIP8 OS=Arabidopsis thaliana GN=SKIP8 PE=1 SV=1	Back alignment and function desciption

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 61/117 (52%), Gaps = 4/117 (3%)

Query: 145 SVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEF 204
           ++++ N  F+   ++  L  M  LW   D V C+H      SGY+ V++SW++   N+E 
Sbjct: 107 AIISVNTEFFTIIRDRALQAMARLWLNSDYVKCIHASGELFSGYNEVIQSWQLC-FNWEQ 165

Query: 205 PLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWGGQFVTNVFEKLDGQWFICIHHAS 261
               ++  VR  +  ++ +VT   ++   G   G   +TNVFE  +G+W +  HH+S
Sbjct: 166 GFDFQVHTVRTRILTDMAWVTMKAYLNVDG---GPFLITNVFEFHNGRWHMVHHHSS 219

Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		265
255587201		190	conserved hypothetical protein [Ricinus	0.716	1.0	0.759	4e-85
225440550		278	PREDICTED: uncharacterized protein LOC10	0.984	0.938	0.563	2e-80
224090839		180	predicted protein [Populus trichocarpa]	0.679	1.0	0.779	3e-80
449439948		260	PREDICTED: uncharacterized protein LOC10	0.811	0.826	0.595	1e-73
449529204		260	PREDICTED: LOW QUALITY PROTEIN: uncharac	0.811	0.826	0.591	8e-73
18398438		244	nuclear transport factor 2 (NTF2)-like p	0.686	0.745	0.679	2e-71
224140331		153	predicted protein [Populus trichocarpa]	0.573	0.993	0.809	2e-71
297829456		244	DNA binding protein [Arabidopsis lyrata	0.686	0.745	0.679	6e-71
356496112		300	PREDICTED: uncharacterized protein LOC10	0.943	0.833	0.505	1e-70
356504325		252	PREDICTED: uncharacterized protein LOC10	0.943	0.992	0.513	5e-70

>gi\|255587201\|ref\|XP_002534177.1\| conserved hypothetical protein [Ricinus communis] gi\|223525737\|gb\|EEF28201.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

 Score =  320 bits (820), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 145/191 (75%), Positives = 171/191 (89%), Gaps = 1/191 (0%)

Query: 75  PFGRIFQLSSLRPCQVKQSDDTEGNLSGESIMLDEEILKRELQIAIEEEDYVQAAKLRDS 134
           PF +  +L S+R CQVK S+D+E  LSGESI+LDE+ L R+LQIAIEEE+Y QAAK+RDS
Sbjct: 1   PFAKASRLLSIRACQVK-SEDSEEMLSGESIILDEQALTRDLQIAIEEENYAQAAKIRDS 59

Query: 135 LKMLDEDSKTSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMES 194
           L++L EDSK SVLAANARFY++F+NGDLA+MQ LWA+GDNVCCVHPGASG+ GYD VMES
Sbjct: 60  LRLLQEDSKASVLAANARFYNAFRNGDLASMQALWAKGDNVCCVHPGASGVIGYDDVMES 119

Query: 195 WEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWGGQFVTNVFEKLDGQWF 254
           WE+VWMNY+FPL IELKN RVH +G+VGYVTC+EFVRTKG+SWG QFVTNVFE++DGQWF
Sbjct: 120 WELVWMNYDFPLEIELKNARVHFKGDVGYVTCVEFVRTKGSSWGAQFVTNVFERIDGQWF 179

Query: 255 ICIHHASPVDL 265
           ICIHHASPVDL
Sbjct: 180 ICIHHASPVDL 190

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225440550\|ref\|XP_002276167.1\| PREDICTED: uncharacterized protein LOC100244272 [Vitis vinifera] gi\|297740278\|emb\|CBI30460.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224090839\|ref\|XP_002309102.1\| predicted protein [Populus trichocarpa] gi\|222855078\|gb\|EEE92625.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449439948\|ref\|XP_004137747.1\| PREDICTED: uncharacterized protein LOC101219393 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449529204\|ref\|XP_004171591.1\| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101219393 [Cucumis sativus]	Back alignment and taxonomy information

>gi|18398438|ref|NP_566347.1| nuclear transport factor 2 (NTF2)-like protein [Arabidopsis thaliana] gi|6478918|gb|AAF14023.1|AC011436_7 unknown protein [Arabidopsis thaliana] gi|17380786|gb|AAL36223.1| unknown protein [Arabidopsis thaliana] gi|20259607|gb|AAM14160.1| unknown protein [Arabidopsis thaliana] gi|21592811|gb|AAM64760.1| unknown [Arabidopsis thaliana] gi|332641221|gb|AEE74742.1| nuclear transport factor 2 (NTF2)-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|224140331\|ref\|XP_002323536.1\| predicted protein [Populus trichocarpa] gi\|222868166\|gb\|EEF05297.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297829456\|ref\|XP_002882610.1\| DNA binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297328450\|gb\|EFH58869.1\| DNA binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356496112\|ref\|XP_003516914.1\| PREDICTED: uncharacterized protein LOC100811218 [Glycine max]	Back alignment and taxonomy information

>gi\|356504325\|ref\|XP_003520947.1\| PREDICTED: uncharacterized protein LOC100815544 [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		265
TAIR\|locus:505006436		231	AT4G10925 "AT4G10925" [Arabido	0.426	0.489	0.290	7.3e-13

TAIR\|locus:505006436 AT4G10925 "AT4G10925" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 170 (64.9 bits), Expect = 7.3e-13, P = 7.3e-13
 Identities = 34/117 (29%), Positives = 62/117 (52%)

Query:   145 SVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEF 204
             ++++ N  F+   ++  L  M  LW   D V C+H      SGY+ V++SW++ + N+E 
Sbjct:   107 AIISVNTEFFTIIRDRALQAMARLWLNSDYVKCIHASGELFSGYNEVIQSWQLCF-NWEQ 165

Query:   205 PLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWGGQFVTNVFEKLDGQWFICIHHAS 261
                 ++  VR  +  ++ +VT   ++   G   G   +TNVFE  +G+W +  HH+S
Sbjct:   166 GFDFQVHTVRTRILTDMAWVTMKAYLNVDG---GPFLITNVFEFHNGRWHMVHHHSS 219


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.135   0.423    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      265       265   0.00093  114 3  11 22  0.46    33
                                                     32  0.50    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  621 (66 KB)
  Total size of DFA:  228 KB (2124 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  24.98u 0.09s 25.07t   Elapsed:  00:00:01
  Total cpu time:  24.98u 0.09s 25.07t   Elapsed:  00:00:01
  Start:  Fri May 10 16:34:29 2013   End:  Fri May 10 16:34:30 2013

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0006635 "fatty acid beta-oxidation" evidence=RCA

GO:0016558 "protein import into peroxisome matrix" evidence=RCA

GO:0048573 "photoperiodism, flowering" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.VI.1696.1	hypothetical protein (180 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		265
pfam13474		121	pfam13474, SnoaL_3, SnoaL-like domain	3e-21
pfam02151		36	pfam02151, UVR, UvrB/uvrC motif	1e-06
COG4319		137	COG4319, COG4319, Ketosteroid isomerase homolog [F	9e-06

>gnl\|CDD\|222158 pfam13474, SnoaL_3, SnoaL-like domain	Back alignment and domain information

 Score = 85.9 bits (213), Expect = 3e-21
 Identities = 31/121 (25%), Positives = 49/121 (40%), Gaps = 7/121 (5%)

Query: 146 VLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASG-ISGYDPVMESWEVVWMNYEF 204
           + A    ++++   GDL     L+A  D+V  +  GA     G + V         +   
Sbjct: 1   IEALLDAWHEAAAEGDLDAYFALFA--DDVSFIGTGADELWRGREAVRAYLRP-DFDKGE 57

Query: 205 PLAIELKNVRVHVRGNVGYVTCIEFVRTKGT---SWGGQFVTNVFEKLDGQWFICIHHAS 261
           P + EL + RV V G+V +V  +  ++         G    T V  K DG W I  +H S
Sbjct: 58  PWSFELLDRRVTVSGDVAWVDELLDIQMPADGTELSGPCRGTGVLRKTDGGWKIAHYHLS 117

Query: 262 P 262
            
Sbjct: 118 F 118

This family contains a large number of proteins that share the SnoaL fold. Length = 121

>gnl\|CDD\|145355 pfam02151, UVR, UvrB/uvrC motif	Back alignment and domain information

>gnl\|CDD\|226769 COG4319, COG4319, Ketosteroid isomerase homolog [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		265
COG4319		137	Ketosteroid isomerase homolog [Function unknown]	99.83
PF13474		121	SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE	99.8
TIGR02246		128	conserved hypothetical protein. This family consis	99.77
PF08332		128	CaMKII_AD: Calcium/calmodulin dependent protein ki	99.76
PF14534		107	DUF4440: Domain of unknown function (DUF4440); PDB	99.57
PF11533		125	DUF3225: Protein of unknown function (DUF3225); In	99.39
COG4875		156	Uncharacterized protein conserved in bacteria with	99.07
PF13577		127	SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF	99.04
PF12680		102	SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8	98.98
cd00531		124	NTF2_like Nuclear transport factor 2 (NTF2-like) s	98.63
cd00781		122	ketosteroid_isomerase ketosteroid isomerase: Many	98.54
PF12893		116	Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL	98.5
COG3880		176	Modulator of heat shock repressor CtsR, McsA [Sign	98.42
TIGR02096		129	conserved hypothetical protein, steroid delta-isom	98.29
PF02151		36	UVR: UvrB/uvrC motif; InterPro: IPR001943 During t	98.24
TIGR02960		324	SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa	98.21
PRK08241		339	RNA polymerase factor sigma-70; Validated	98.05
PRK09636		293	RNA polymerase sigma factor SigJ; Provisional	97.85
PF07366		126	SnoaL: SnoaL-like polyketide cyclase; InterPro: IP	97.83
cd00667		160	ring_hydroxylating_dioxygenases_beta Ring hydroxyl	97.78
PF02136		118	NTF2: Nuclear transport factor 2 (NTF2) domain; In	97.73
PF07858		125	LEH: Limonene-1,2-epoxide hydrolase catalytic doma	97.66
PLN02382		413	probable sucrose-phosphatase	97.5
PF12870		111	Lumazine_bd: Lumazine-binding domain; InterPro: IP	97.49
TIGR02957		281	SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa	97.45
PRK10069		183	3-phenylpropionate dioxygenase subunit beta; Provi	97.41
COG4538		112	Uncharacterized conserved protein [Function unknow	97.38
PF12707		128	DUF3804: Protein of unknown function (DUF3804); In	97.17
cd00780		119	NTF2 Nuclear transport factor 2 (NTF2) domain play	96.71
PRK09635		290	sigI RNA polymerase sigma factor SigI; Provisional	96.68
COG4922		129	Uncharacterized protein conserved in bacteria [Fun	96.3
PF05223		118	MecA_N: NTF2-like N-terminal transpeptidase domain	96.27
COG4460		130	Uncharacterized protein conserved in bacteria [Fun	96.11
COG3631		133	Ketosteroid isomerase-related protein [General fun	95.9
COG4308		130	LimA Limonene-1,2-epoxide hydrolase [Secondary met	95.65
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	95.52
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	95.08
COG4337		206	Uncharacterized protein conserved in bacteria [Fun	94.85
PRK01617		154	hypothetical protein; Provisional	94.77
PRK07883		557	hypothetical protein; Validated	94.6
PRK00558		598	uvrC excinuclease ABC subunit C; Validated	94.42
PRK05298		652	excinuclease ABC subunit B; Provisional	94.18
PRK12306		519	uvrC excinuclease ABC subunit C; Reviewed	93.81
PRK14666		694	uvrC excinuclease ABC subunit C; Provisional	93.8
PRK14672		691	uvrC excinuclease ABC subunit C; Provisional	93.46
PRK14667		567	uvrC excinuclease ABC subunit C; Provisional	93.4
TIGR03231		155	anthran_1_2_B anthranilate 1,2-dioxygenase, small	93.37
PRK14671		621	uvrC excinuclease ABC subunit C; Provisional	93.26
PRK14670		574	uvrC excinuclease ABC subunit C; Provisional	93.19
PRK14668		577	uvrC excinuclease ABC subunit C; Provisional	93.13
PRK14669		624	uvrC excinuclease ABC subunit C; Provisional	93.11
TIGR00194		574	uvrC excinuclease ABC, C subunit. This family cons	93.06
PRK00183		157	hypothetical protein; Provisional	92.77
PRK04233		129	hypothetical protein; Provisional	92.71
COG0322		581	UvrC Nuclease subunit of the excinuclease complex	91.09
PRK01752		156	hypothetical protein; Provisional	90.08
PF13355		117	DUF4101: Protein of unknown function (DUF4101)	89.44
PRK02250		166	hypothetical protein; Provisional	88.86
PRK01842		149	hypothetical protein; Provisional	88.16
COG3012		151	Uncharacterized protein conserved in bacteria [Fun	86.33
PF02982		160	Scytalone_dh: Scytalone dehydratase; InterPro: IPR	85.32
COG4994		120	Uncharacterized protein conserved in bacteria [Fun	82.78
KOG0412		773	consensus Golgi transport complex COD1 protein [In	80.56

>COG4319 Ketosteroid isomerase homolog [Function unknown]	Back alignment and domain information

Probab=99.83  E-value=1.4e-19  Score=151.20  Aligned_cols=119  Identities=22%  Similarity=0.334  Sum_probs=105.1

Q ss_pred             chhhHHHHHHHHHHHHHcCCHHHHHhhhcCCCceEEecCCCCCccCHHHHHHHHHHHHhccCcceEEEEEeEEEEEeCCE
Q 024630          142 SKTSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEFPLAIELKNVRVHVRGNV  221 (265)
Q Consensus       142 sk~aI~aa~~afy~Af~aGDldAL~alwAdDd~V~~vhPgg~~l~Gr~aI~aswe~vfa~~~~pl~iel~dv~V~v~GDv  221 (265)
                      ...+|.+++..|.+|++++|+++++++|++|  ++.+.|.+.++.|+++|+..|+.+|+.+.+++.+++.+++|.+.||+
T Consensus         8 ~~~~I~a~i~dw~~Av~a~D~~av~~~YtdD--av~f~~~~~~~~Gk~~i~k~~~~~~~~~~~~~~f~~~el~v~~~GD~   85 (137)
T COG4319           8 QVDAIRAAIADWAAAVRAKDADAVADFYTDD--AVVFPPPGLQRKGKAAIRKAFEGIFAMGIGPLKFTLEELQVHESGDV   85 (137)
T ss_pred             hHHHHHHHHHHHHHHHhcccHHHHHHhcCCc--eEEecCCCCcccCHHHHHHHHHHHHHhccCCCcceeeeeeeeccCCE
Confidence            3478999999999999999999999999998  66667778899999999999999999888889999999999999999


Q ss_pred             EEEEEEEEEec---CCcc-eeeEEEEEEEEEe-CCeEEEEEEeeCCC
Q 024630          222 GYVTCIEFVRT---KGTS-WGGQFVTNVFEKL-DGQWFICIHHASPV  263 (265)
Q Consensus       222 A~Vt~~e~v~~---~G~~-~g~~raTnVfrR~-dG~WrIVhhHaSp~  263 (265)
                      |++++...+..   +|++ .-+.|+|.||||+ ||+|||+|+| +|.
T Consensus        86 a~~~~~~~~~~~~~dg~~~~~~~Rat~v~rK~~dg~Wk~~~dh-~~~  131 (137)
T COG4319          86 AFVTALLLLTGTKKDGPPADLAGRATYVFRKEADGGWKLAHDH-IPN  131 (137)
T ss_pred             EEEEEeeeeeccCCCCcchhheeeeEEEEEEcCCCCEEEEEec-ccc
Confidence            99999988886   2333 2467999999998 5699999999 665

>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B	Back alignment and domain information

>TIGR02246 conserved hypothetical protein	Back alignment and domain information

>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A	Back alignment and domain information

>PF11533 DUF3225: Protein of unknown function (DUF3225); InterPro: IPR024507 This family of proteins has no known function	Back alignment and domain information

>COG4875 Uncharacterized protein conserved in bacteria with a cystatin-like fold [Function unknown]	Back alignment and domain information

>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B	Back alignment and domain information

>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A	Back alignment and domain information

>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily	Back alignment and domain information

>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon	Back alignment and domain information

>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C	Back alignment and domain information

>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction mechanisms]	Back alignment and domain information

>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related	Back alignment and domain information

>PF02151 UVR: UvrB/uvrC motif; InterPro: IPR001943 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products []	Back alignment and domain information

>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family	Back alignment and domain information

>PRK08241 RNA polymerase factor sigma-70; Validated	Back alignment and domain information

>PRK09636 RNA polymerase sigma factor SigJ; Provisional	Back alignment and domain information

>PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis	Back alignment and domain information

>cd00667 ring_hydroxylating_dioxygenases_beta Ring hydroxylating dioxygenase beta subunit	Back alignment and domain information

>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein	Back alignment and domain information

>PF07858 LEH: Limonene-1,2-epoxide hydrolase catalytic domain; InterPro: IPR013100 Epoxide hydrolases catalyse the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism	Back alignment and domain information

>PLN02382 probable sucrose-phosphatase	Back alignment and domain information

>PF12870 Lumazine_bd: Lumazine-binding domain; InterPro: IPR024267 This entry represents a lumazine-binding domain found in a family of putative lipoproteins from bacteria	Back alignment and domain information

>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family	Back alignment and domain information

>PRK10069 3-phenylpropionate dioxygenase subunit beta; Provisional	Back alignment and domain information

>COG4538 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12707 DUF3804: Protein of unknown function (DUF3804); InterPro: IPR024525 Structural alignments indicate that this family of functionally uncharacterised proteins carry an NTF2-fold with a hydrophobic cavity	Back alignment and domain information

>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus	Back alignment and domain information

>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional	Back alignment and domain information

>COG4922 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF05223 MecA_N: NTF2-like N-terminal transpeptidase domain; InterPro: IPR007887 The multiple antibiotic resistance of methicillin-resistant strains of Staphylococcus aureus (MRSA) has become a major clinical problem worldwide	Back alignment and domain information

>COG4460 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG3631 Ketosteroid isomerase-related protein [General function prediction only]	Back alignment and domain information

>COG4308 LimA Limonene-1,2-epoxide hydrolase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>COG4337 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK01617 hypothetical protein; Provisional	Back alignment and domain information

>PRK07883 hypothetical protein; Validated	Back alignment and domain information

>PRK00558 uvrC excinuclease ABC subunit C; Validated	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>PRK12306 uvrC excinuclease ABC subunit C; Reviewed	Back alignment and domain information

>PRK14666 uvrC excinuclease ABC subunit C; Provisional	Back alignment and domain information

>PRK14672 uvrC excinuclease ABC subunit C; Provisional	Back alignment and domain information

>PRK14667 uvrC excinuclease ABC subunit C; Provisional	Back alignment and domain information

>TIGR03231 anthran_1_2_B anthranilate 1,2-dioxygenase, small subunit	Back alignment and domain information

>PRK14671 uvrC excinuclease ABC subunit C; Provisional	Back alignment and domain information

>PRK14670 uvrC excinuclease ABC subunit C; Provisional	Back alignment and domain information

>PRK14668 uvrC excinuclease ABC subunit C; Provisional	Back alignment and domain information

>PRK14669 uvrC excinuclease ABC subunit C; Provisional	Back alignment and domain information

>TIGR00194 uvrC excinuclease ABC, C subunit	Back alignment and domain information

>PRK00183 hypothetical protein; Provisional	Back alignment and domain information

>PRK04233 hypothetical protein; Provisional	Back alignment and domain information

>COG0322 UvrC Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK01752 hypothetical protein; Provisional	Back alignment and domain information

>PF13355 DUF4101: Protein of unknown function (DUF4101)	Back alignment and domain information

>PRK02250 hypothetical protein; Provisional	Back alignment and domain information

>PRK01842 hypothetical protein; Provisional	Back alignment and domain information

>COG3012 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF02982 Scytalone_dh: Scytalone dehydratase; InterPro: IPR004235 Scytalone dehydratase is a member of the group of enzymes involved in fungal melanin biosynthesis	Back alignment and domain information

>COG4994 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0412 consensus Golgi transport complex COD1 protein [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		265
3cnx_A		170	Crystal Structure Of A Putative Dehydratase From Th		2e-11
3gwr_A		144	Crystal Structure Of Putative CalciumCALMODULIN-Dep		5e-06

>pdb|3CNX|A Chain A, Crystal Structure Of A Putative Dehydratase From The Ntf2-Like Family (Sav_4671) From Streptomyces Avermitilis At 2.10 A Resolution Length = 170

Back alignment and structure

Iteration: 1

Score = 65.9 bits (159), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 46/141 (32%), Positives = 63/141 (44%), Gaps = 27/141 (19%) Query: 149 ANARFYDSFKNGDLATMQGLW---------------ARGDNVCCVHPGASGISGYDPVME 193 AN FY++ + GD T+ LW A V CVHPG +SG V+ Sbjct: 17 ANTAFYEAXERGDFETLSSLWLTPADLGVDEEYHDPADAGVVSCVHPGWPVLSGRGEVLR 76 Query: 194 SWEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWG---------GQFV-- 242 S+ ++ N E+ + L +V V V G+ VTC E + + G GQ V Sbjct: 77 SYALIXANTEY-IQFFLTDVHVSVTGDTALVTCTENILSGGPPPDDSDELGPLVGQLVVA 135 Query: 243 TNVFEKLDGQWFICIHHASPV 263 TNVF + W + HHASPV Sbjct: 136 TNVFRRTPDGWKLWSHHASPV 156

PyMOL of 3cnx

>pdb|3GWR|A Chain A, Crystal Structure Of Putative CalciumCALMODULIN-Dependent Protein Kinase Type Ii Association Domain (Yp_315894.1) From Thiobacillus Denitrificans Atcc 25259 At 2.00 A Resolution Length = 144

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		265
3gwr_A		144	Putative calcium/calmodulin-dependent protein KIN	7e-44
3cnx_A		170	Uncharacterized protein; putative dehydratase, NTF	1e-41
3f7s_A		142	Uncharacterized NTF2-like protein; structural geno	3e-26
3hx8_A		129	MLR2180 protein, putative ketosteroid isomerase; s	2e-11
2r4i_A		123	Uncharacterized protein; NTF2-like protein, struct	2e-10
3d9r_A		135	Ketosteroid isomerase-like protein; YP_049581.1, s	1e-06
2ux0_A		143	Calcium-calmodulin dependent protein kinase (CAM I	4e-06
3h51_A		156	Putative calcium/calmodulin dependent protein KIN	1e-05
3cu3_A		172	Domain of unknown function with A cystatin-like F;	2e-05
2gxf_A		142	Hypothetical protein YYBH; alpha-beta protein., st	5e-05
1qzv_F		154	Plant photosystem I: subunit PSAF; photosynthesis,	2e-04
3bb9_A		148	Putative orphan protein; structural genomics, join	2e-04
2bng_A		149	MB2760; epoxide hydrolase, limonene, hydrolase, st	3e-04
1tuh_A		156	BAL32A, hypothetical protein EGC068; unknown funct	3e-04
3gzr_A		146	Uncharacterized protein with A NTF2-like fold; str	4e-04
2rcd_A		129	Uncharacterized protein; structural genomics, join	6e-04
3fgy_A		135	Uncharacterized NTF2-like protein; structural geno	8e-04

>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Length = 144	Back alignment and structure

 Score =  144 bits (364), Expect = 7e-44
 Identities = 33/130 (25%), Positives = 58/130 (44%), Gaps = 3/130 (2%)

Query: 138 LDEDSKTSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEV 197
           + E    +  AA   FY +F+   L  M  +WAR D+V C+HP A+ ++G   V   W  
Sbjct: 2   MSEPVFPTPEAAEDAFYAAFEARSLDDMMAVWARDDHVACIHPLAAPLNGRAAVAAGWRS 61

Query: 198 VWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRT--KGTSWGGQFVTNVFEKLDGQWFI 255
           ++        +++K V    + +       EF+    +         TNV+ +    W +
Sbjct: 62  MFGA-AGRFRLQVKAVHEIRQADHVIRIVDEFLTIGDETAPRPAILATNVYRREADGWRM 120

Query: 256 CIHHASPVDL 265
            +HHASP+ +
Sbjct: 121 VLHHASPLQV 130

PyMOL of 3gwr

>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Length = 170	Back alignment and structure

>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Length = 142	Back alignment and structure

>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Length = 129	Back alignment and structure

>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Length = 123	Back alignment and structure

>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Length = 135	Back alignment and structure

>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Length = 143	Back alignment and structure

>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Length = 156	Back alignment and structure

>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Length = 172	Back alignment and structure

>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Length = 142	Back alignment and structure

>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154	Back alignment and structure

>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Length = 148	Back alignment and structure

>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Length = 149	Back alignment and structure

>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Length = 156	Back alignment and structure

>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Length = 146	Back alignment and structure

>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Length = 129	Back alignment and structure

>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} Length = 135	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		265
3gwr_A		144	Putative calcium/calmodulin-dependent protein KIN	99.96
3cnx_A		170	Uncharacterized protein; putative dehydratase, NTF	99.95
3f7s_A		142	Uncharacterized NTF2-like protein; structural geno	99.91
2ux0_A		143	Calcium-calmodulin dependent protein kinase (CAM I	99.87
3b7c_A		122	Uncharacterized protein; NTF-2 like protein, struc	99.87
3soy_A		145	NTF2-like superfamily protein; structural genomics	99.85
3hx8_A		129	MLR2180 protein, putative ketosteroid isomerase; s	99.85
3h51_A		156	Putative calcium/calmodulin dependent protein KIN	99.83
2rcd_A		129	Uncharacterized protein; structural genomics, join	99.83
3bb9_A		148	Putative orphan protein; structural genomics, join	99.83
4i4k_A		143	Uncharacterized protein SGCJ; structural genomics,	99.82
2r4i_A		123	Uncharacterized protein; NTF2-like protein, struct	99.78
2owp_A		129	Hypothetical protein BXE_B1374; cystatin-like fold	99.78
3fsd_A		134	NTF2-like protein of unknown function in nutrient;	99.77
3ke7_A		134	Putative ketosteroid isomerase; structural genomic	99.77
2gxf_A		142	Hypothetical protein YYBH; alpha-beta protein., st	99.76
2f86_B		143	Hypothetical protein K11E8.1D; UNC-43, oligomeriza	99.76
3gzr_A		146	Uncharacterized protein with A NTF2-like fold; str	99.75
3d9r_A		135	Ketosteroid isomerase-like protein; YP_049581.1, s	99.75
3rob_A		139	Uncharacterized conserved protein; structural geno	99.74
3cu3_A		172	Domain of unknown function with A cystatin-like F;	99.73
3ksp_A		129	Calcium/calmodulin-dependent kinase II associatio;	99.56
2chc_A		170	Protein RV3472; hypothetical protein; 1.69A {Mycob	99.41
3b8l_A		163	Uncharacterized protein; putative aromatic ring hy	99.4
2rfr_A		155	Uncharacterized protein; structural genomics, join	99.4
1tp6_A		128	Hypothetical protein PA1314; structural genomics,	99.3
2a15_A		139	Hypothetical protein RV0760C; beta-alpha-barrel, s	99.25
3a76_A		176	Gamma-hexachlorocyclohexane dehydrochlorinase; bar	99.22
2rgq_A		144	Domain of unknown function with A cystatin-like F;	99.21
3ef8_A		150	Putative scyalone dehydratase; YP_496742.1, struct	99.15
2k54_A		123	Protein ATU0742; protein of unknown function, stru	99.11
3soa_A		444	Calcium/calmodulin-dependent protein kinase type a	99.02
1ohp_A		125	Steroid delta-isomerase; inhibitor; HET: ESR; 1.53	99.01
1nww_A		149	Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R	99.0
1oh0_A		131	Steroid delta-isomerase; ketosteroid isomerase, KS	99.0
4h3u_A		158	Hypothetical protein; structural genomics, PSI-bio	98.97
3dmc_A		134	NTF2-like protein; structural genomics, joint cent	98.96
3ejv_A		179	Uncharacterized protein with cystatin-like fold; s	98.96
3ebt_A		132	Uncharacterized NTF2-like protein; structural geno	98.91
1tuh_A		156	BAL32A, hypothetical protein EGC068; unknown funct	98.89
3f14_A		112	Uncharacterized NTF2-like protein; YP_680363.1, NT	98.89
3dm8_A		143	Uncharacterized protein RPA4348; siras, putative i	98.84
3i0y_A		140	Putative polyketide cyclase; cystatin-like fold, s	98.82
3fh1_A		129	Uncharacterized NTF2-like protein; structural geno	98.8
2gex_A		152	SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St	98.8
3ff2_A		117	Uncharacterized cystatin fold protein (YP_497570.	98.79
2bng_A		149	MB2760; epoxide hydrolase, limonene, hydrolase, st	98.77
3f7x_A		151	Putative polyketide cyclase; structural genomics,	98.77
3ec9_A		140	Uncharacterized NTF2-like protein; structural geno	98.76
3k0z_A		159	Putative polyketide cyclase; structural genomics,	98.75
3g8z_A		148	Protein of unknown function with cystatin-like FO;	98.74
3fgy_A		135	Uncharacterized NTF2-like protein; structural geno	98.73
1s5a_A		150	Hypothetical protein YESE; structural genomics, PS	98.73
2gey_A		158	ACLR protein; alpha+beta barrel, oxidoreductase; H	98.73
3g16_A		156	Uncharacterized protein with cystatin-like fold; Y	98.72
3blz_A		128	NTF2-like protein of unknown function; structural	98.71
4gb5_A		159	Uncharacterized protein; structural genomics, PSI-	98.69
3h3h_A		122	Uncharacterized snoal-like protein; structural gen	98.64
1sjw_A		144	Nogalonic acid methyl ester cyclase; anthracycline	98.59
3hk4_A		136	MLR7391 protein; NTF2-like protein, structural gen	98.58
3grd_A		134	Uncharacterized NTF2-superfamily protein; NP_97724	98.57
3f8h_A		150	Putative polyketide cyclase; structural genomics,	98.55
3en8_A		128	Uncharacterized NTF-2 like protein; YP_553245.1, N	98.54
3fka_A		120	Uncharacterized NTF-2 like protein; structural gen	98.52
2f99_A		153	Aklanonic acid methyl ester cyclase, AKNH; anthrac	98.52
3kkg_A		146	Putative snoal-like polyketide cyclase; structural	98.49
3duk_A		125	NTF2-like protein of unknown function; structural	98.46
3f9s_A		146	Putative polyketide cyclase; structural genomics,	98.46
1z1s_A		163	Hypothetical protein PA3332; beta barrel, conserve	98.44
3rga_A		283	Epoxide hydrolase; NTF2-like, epoxide-opening cycl	98.43
3f40_A		114	Uncharacterized NTF2-like protein; YP_677363.1, NT	98.41
3ehc_A		128	Snoal-like polyketide cyclase; structural genomics	98.36
3rga_A		283	Epoxide hydrolase; NTF2-like, epoxide-opening cycl	98.34
3g0k_A		148	Putative membrane protein; snoal-like polyketide c	98.33
3mso_A		143	Steroid delta-isomerase; structural genomics, join	98.3
3er7_A		131	Uncharacterized NTF2-like protein; YP_001812677.1,	98.24
3dxo_A		121	Uncharacterized snoal-like protein; putative isome	98.22
2b1x_B		172	Naphthalene dioxygenase small subunit; rieske non-	98.18
3flj_A		155	Uncharacterized protein conserved in bacteria WIT	98.08
3f8x_A		148	Putative delta-5-3-ketosteroid isomerase; structur	98.07
3lyg_A		120	NTF2-like protein of unknown function; structural	98.07
2gbw_B		174	Biphenyl 2,3-dioxygenase beta subunit; rieske oxyg	98.04
1e52_A		63	Excinuclease ABC subunit; DNA excision repair, UVR	98.02
1idp_A		172	Scytalone dehydratase; lyase, melanine biosynthesi	97.89
3eby_A		163	Beta subunit of A putative aromatic-ring-hydroxyl	97.85
3e99_A		164	Benzoate 1,2-dioxygenase beta subunit; structural	97.56
1uli_B		187	Biphenyl dioxygenase small subunit; alpha3 BETA3 h	97.55
3hzp_A		131	NTF2-like protein of unknown function; YP_291699.1	97.5
1wql_B		186	Ethylbenzene dioxygenase small subunit; biphenyl d	97.44
3jum_A		185	Phenazine biosynthesis protein A/B; chirality, dru	97.41
3mg1_A		323	OCP, orange carotenoid protein; carotenoid binding	97.17
3ff0_A		163	Phenazine biosynthesis protein PHZB 2; cystatin-li	96.89
2bmo_B		194	Oxygenase-beta NBDO; nitrobenzene dioxygenase, nit	96.85
3gzx_B		186	Biphenyl dioxygenase subunit beta; rieskie, non-he	96.84
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	96.49
3ujm_A		120	Rasputin; NTF2-like fold, RAS signaling, signaling	96.33
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	96.09
3nv0_B		154	NTF2-related export protein; NTF2-like domain, bet	95.69
1jkg_A		140	P15; NTF2-like domain, transport protein; 1.90A {H	95.65
1zo2_A		129	NTF2, nuclear transport factor 2; structural genom	95.25
1gy6_A		127	Nuclear transport factor 2; 1.6A {Rattus norvegicu	95.15
2qiy_A		154	UBP3-associated protein BRE5; deubiquitylation, ub	94.44
1gy7_A		125	Nuclear transport factor 2; protein transport; 1.6	93.97
2jq5_A		128	SEC-C motif; structural genomics, PSI-2, structure	93.88
3q90_A		140	RAS GTPase-activating protein-binding protein 1; s	92.82
2i9w_A		184	Hypothetical protein; cystatin-like fold, SEC-C mo	88.88
1vqq_A		646	Saupbp2A, penicillin-binding protein MECA, low-aff	87.45
1jkg_B		250	TAP; NTF2-like domain, transport protein; 1.90A {H	87.15
3gzb_A		154	Putative snoal-like polyketide cyclase; YP_0011826	86.4
3k7c_A		114	Putative NTF2-like transpeptidase; structural geno	86.28
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	83.72
2fzt_A		79	Hypothetical protein TM0693; structural genomics,	82.17
3ecf_A		130	NTF2-like protein; structural genomics, joint cent	80.81

>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259}	Back alignment and structure

Probab=99.96  E-value=6.8e-29  Score=205.34  Aligned_cols=120  Identities=27%  Similarity=0.486  Sum_probs=109.4

Q ss_pred             hhhHHHHHHHHHHHHHcCCHHHHHhhhcCCCceEEecCCCCCccCHHHHHHHHHHHHhccCcceEEEEEeEEEEEeCCEE
Q 024630          143 KTSVLAANARFYDSFKNGDLATMQGLWARGDNVCCVHPGASGISGYDPVMESWEVVWMNYEFPLAIELKNVRVHVRGNVG  222 (265)
Q Consensus       143 k~aI~aa~~afy~Af~aGDldAL~alwAdDd~V~~vhPgg~~l~Gr~aI~aswe~vfa~~~~pl~iel~dv~V~v~GDvA  222 (265)
                      -+.+.+++++||+||++||+++|+++|++|+.++|++|++..+.|+++|+++|+.+|++.. ++++++.++++.+.||+|
T Consensus         7 ~~~~~~~~~af~~A~~~gD~da~~al~a~d~~v~~v~p~g~~l~G~~ai~~~w~~~f~~~~-~~~i~~~~v~v~~~gd~A   85 (144)
T 3gwr_A            7 FPTPEAAEDAFYAAFEARSLDDMMAVWARDDHVACIHPLAAPLNGRAAVAAGWRSMFGAAG-RFRLQVKAVHEIRQADHV   85 (144)
T ss_dssp             CSSHHHHHHHHHHHHHHTCHHHHHHHBCSSSCCEEECTTCCCEESHHHHHHHHHHHHHHHC-CEEEEEEEEEEEECSSEE
T ss_pred             cCCHHHHHHHHHHHHHcCCHHHHHhhccCCCCEEEECCCCCCcccHHHHHHHHHHHHcCCC-cEEEEEEEEEEEecCCEE
Confidence            4568899999999999999999999999998899999999999999999999999998754 589999999999999999


Q ss_pred             EEEEEEEEecC--CcceeeEEEEEEEEEeCCeEEEEEEeeCCC
Q 024630          223 YVTCIEFVRTK--GTSWGGQFVTNVFEKLDGQWFICIHHASPV  263 (265)
Q Consensus       223 ~Vt~~e~v~~~--G~~~g~~raTnVfrR~dG~WrIVhhHaSp~  263 (265)
                      ++++.+.+...  |+...+.++|+||||++|+|||+|||+||+
T Consensus        86 ~v~~~e~~~~~~~~g~~~~~r~T~V~~r~~g~WrivhhH~S~~  128 (144)
T 3gwr_A           86 IRIVDEFLTIGDETAPRPAILATNVYRREADGWRMVLHHASPL  128 (144)
T ss_dssp             EEEEEEEEEETTCSSCCCCEEEEEEEEECSSSEEEEEEEEEEC
T ss_pred             EEEEEEEEEecCCCCceeeEEEEEEEEEECCEEEEEEEecCCC
Confidence            99999999852  222367899999999999999999999997

PyMOL of 3gwr

>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17	Back alignment and structure

>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440}	Back alignment and structure

>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A*	Back alignment and structure

>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16	Back alignment and structure

>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp}	Back alignment and structure

>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti}	Back alignment and structure

>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV}	Back alignment and structure

>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18	Back alignment and structure

>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16	Back alignment and structure

>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus}	Back alignment and structure

>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15	Back alignment and structure

>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18	Back alignment and structure

>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0	Back alignment and structure

>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503}	Back alignment and structure

>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22	Back alignment and structure

>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7	Back alignment and structure

>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides}	Back alignment and structure

>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27	Back alignment and structure

>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus}	Back alignment and structure

>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28	Back alignment and structure

>3ksp_A Calcium/calmodulin-dependent kinase II associatio; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG; HET: MSE NHE; 2.59A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25	Back alignment and structure

>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12	Back alignment and structure

>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A	Back alignment and structure

>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis}	Back alignment and structure

>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25	Back alignment and structure

>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28	Back alignment and structure

>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29	Back alignment and structure

>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens}	Back alignment and structure

>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A	Back alignment and structure

>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A*	Back alignment and structure

>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ...	Back alignment and structure

>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila}	Back alignment and structure

>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10	Back alignment and structure

>3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28	Back alignment and structure

>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9	Back alignment and structure

>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11	Back alignment and structure

>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20	Back alignment and structure

>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV}	Back alignment and structure

>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9	Back alignment and structure

>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8	Back alignment and structure

>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440}	Back alignment and structure

>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10	Back alignment and structure

>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus}	Back alignment and structure

>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV}	Back alignment and structure

>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0	Back alignment and structure

>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10	Back alignment and structure

>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9	Back alignment and structure

>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1}	Back alignment and structure

>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14	Back alignment and structure

>4gb5_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, snoal-like domain, unknown function; HET: PGE; 1.55A {Kribbella flavida}	Back alignment and structure

>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264}	Back alignment and structure

>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9	Back alignment and structure

>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti}	Back alignment and structure

>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0	Back alignment and structure

>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP}	Back alignment and structure

>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20	Back alignment and structure

>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A*	Back alignment and structure

>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP}	Back alignment and structure

>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0	Back alignment and structure

>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23}	Back alignment and structure

>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10	Back alignment and structure

>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis}	Back alignment and structure

>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str}	Back alignment and structure

>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis}	Back alignment and structure

>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans}	Back alignment and structure

>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa}	Back alignment and structure

>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24	Back alignment and structure

>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19	Back alignment and structure

>2b1x_B Naphthalene dioxygenase small subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 2b24_B	Back alignment and structure

>3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea}	Back alignment and structure

>2gbw_B Biphenyl 2,3-dioxygenase beta subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_B* 2ckf_B	Back alignment and structure

>1idp_A Scytalone dehydratase; lyase, melanine biosynthesis; 1.45A {Magnaporthe grisea} SCOP: d.17.4.1 PDB: 2std_A* 1std_A* 3std_A* 6std_A* 4std_A* 5std_A* 7std_A*	Back alignment and structure

>3eby_A Beta subunit of A putative aromatic-ring-hydroxyl dioxygenase; YP_001165631.1; 1.75A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.4	Back alignment and structure

>3e99_A Benzoate 1,2-dioxygenase beta subunit; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Burkholderia mallei atcc 23344} SCOP: d.17.4.4	Back alignment and structure

>1uli_B Biphenyl dioxygenase small subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 1ulj_B* 3en1_B* 3eqq_B	Back alignment and structure

>3hzp_A NTF2-like protein of unknown function; YP_291699.1, structural genomics, joint center structural genomics, JCSG; HET: MSE 1PE; 1.40A {Prochlorococcus marinus}	Back alignment and structure

>1wql_B Ethylbenzene dioxygenase small subunit; biphenyl dioxygenase, cumene dioxygenase; 2.20A {Pseudomonas fluorescens} SCOP: d.17.4.4	Back alignment and structure

>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A*	Back alignment and structure

>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A*	Back alignment and structure

>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>2bmo_B Oxygenase-beta NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: d.17.4.4 PDB: 2bmq_B 2bmr_B* 1o7n_B 1ndo_B 1o7g_B* 1o7h_B 1o7m_B 1eg9_B 1o7p_B* 1o7w_B 1uuv_B 1uuw_B 2hmj_B 2hmk_B* 2hml_B* 2hmm_B* 2hmn_B* 2hmo_B*	Back alignment and structure

>3gzx_B Biphenyl dioxygenase subunit beta; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} SCOP: d.17.4.4 PDB: 3gzy_B* 2yfi_B 2xr8_B* 2xrx_B* 2xsh_B 2xso_B 2yfj_B* 2yfl_B*	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster}	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans}	Back alignment and structure

>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A	Back alignment and structure

>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2	Back alignment and structure

>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A	Back alignment and structure

>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A	Back alignment and structure

>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A	Back alignment and structure

>2jq5_A SEC-C motif; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; NMR {Rhodopseudomonas palustris}	Back alignment and structure

>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0	Back alignment and structure

>2i9w_A Hypothetical protein; cystatin-like fold, SEC-C motif fold, structural genomics, J center for structural genomics, JCSG; HET: MSE; 1.75A {Psychrobacter arcticus} SCOP: d.17.4.30 g.74.1.1 g.74.1.1	Back alignment and structure

>1vqq_A Saupbp2A, penicillin-binding protein MECA, low-affinity; beta-lactam, D- transpeptidase, D-carboxypeptidase, biosynthetic protein; 1.80A {Staphylococcus aureus} SCOP: d.17.4.5 d.175.1.1 e.3.1.1 PDB: 1mwu_A* 1mwr_A 1mws_A* 1mwt_A*	Back alignment and structure

>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A	Back alignment and structure

>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A*	Back alignment and structure

>3k7c_A Putative NTF2-like transpeptidase; structural genomics, JOIN for structural genomics, JCSG, protein structure initiative unknown function; HET: PGE; 2.00A {Campylobacter jejuni}	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>2fzt_A Hypothetical protein TM0693; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.05A {Thermotoga maritima} SCOP: a.46.3.1 PDB: 2g42_A	Back alignment and structure

>3ecf_A NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Anabaena variabilis atcc 29413} SCOP: d.17.4.21	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		265
d3cnxa1		153	d.17.4.17 (A:5-157) Uncharacterized protein SAV467	5e-36
d2ux0a1		135	d.17.4.7 (A:387-521) Association domain of calcium	4e-22
d3b7ca1		121	d.17.4.16 (A:1-121) Uncharacterized protein SO0125	3e-17
d2owpa1		128	d.17.4.18 (A:1-128) Hypothetical protein BxeB1374	6e-17
d2rcda1		127	d.17.4.18 (A:1-127) Uncharacterized protein ECA350	2e-16
d2f86b1		129	d.17.4.7 (B:343-471) Association domain of calcium	7e-15
d2r4ia1		122	d.17.4.15 (A:1-122) Uncharacterized protein CHU142	2e-13
d2gxfa1		128	d.17.4.22 (A:1-128) Hypothetical protein YybH {Bac	5e-13
d3d9ra1		132	d.17.4.27 (A:3-134) Uncharacterized protein ECA147	7e-12
d3bb9a1		121	d.17.4.16 (A:27-147) Uncharacterized protein Sfri1	1e-11
d3cu3a1		162	d.17.4.28 (A:9-170) Uncharacterized protein NpunR1	5e-09
d2rgqa1		133	d.17.4.25 (A:1-133) Uncharacterized protein NpunR3	2e-05
d1e52a_		56	a.2.9.1 (A:) C-terminal UvrC-binding domain of Uvr	3e-05
d1tuha_		131	d.17.4.11 (A:) Hypothetical protein egc068 from a	0.003

>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Length = 153	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: SAV4671-like
domain: Uncharacterized protein SAV4671
species: Streptomyces avermitilis [TaxId: 33903]

 Score =  123 bits (310), Expect = 5e-36
 Identities = 43/147 (29%), Positives = 59/147 (40%), Gaps = 27/147 (18%)

Query: 143 KTSVLAANARFYDSFKNGDLATMQGLWAR---------------GDNVCCVHPGASGISG 187
              V  AN  FY++ + GD  T+  LW                    V CVHPG   +SG
Sbjct: 6   VEQVGLANTAFYEAMERGDFETLSSLWLTPADLGVDEEYHDPADAGVVSCVHPGWPVLSG 65

Query: 188 YDPVMESWEVVWMNYEFPLAIELKNVRVHVRGNVGYVTCIEFVRTKGTSWGGQ------- 240
              V+ S+ ++  N E+     L +V V V G+   VTC E + + G             
Sbjct: 66  RGEVLRSYALIMANTEYIQ-FFLTDVHVSVTGDTALVTCTENILSGGPPPDDSDELGPLV 124

Query: 241 ----FVTNVFEKLDGQWFICIHHASPV 263
                 TNVF +    W +  HHASPV
Sbjct: 125 GQLVVATNVFRRTPDGWKLWSHHASPV 151

PyMOL of d3cnxa1

>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Length = 135	Back information, alignment and structure

>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Length = 121	Back information, alignment and structure

>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Length = 128	Back information, alignment and structure

>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Length = 127	Back information, alignment and structure

>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Length = 129	Back information, alignment and structure

>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Length = 122	Back information, alignment and structure

>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Length = 128	Back information, alignment and structure

>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Length = 132	Back information, alignment and structure

>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Length = 121	Back information, alignment and structure

>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Length = 162	Back information, alignment and structure

>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Length = 133	Back information, alignment and structure

>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Length = 56	Back information, alignment and structure

>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Length = 131	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		265
d3cnxa1		153	Uncharacterized protein SAV4671 {Streptomyces aver	99.96
d2owpa1		128	Hypothetical protein BxeB1374 {Burkholderia xenovo	99.87
d2ux0a1		135	Association domain of calcium/calmodulin-dependent	99.86
d3b7ca1		121	Uncharacterized protein SO0125 {Shewanella oneiden	99.85
d2rcda1		127	Uncharacterized protein ECA3500 {Pectobacterium at	99.84
d2gxfa1		128	Hypothetical protein YybH {Bacillus subtilis [TaxI	99.83
d3d9ra1		132	Uncharacterized protein ECA1476 {Pectobacterium at	99.83
d2r4ia1		122	Uncharacterized protein CHU142 {Cytophaga hutchins	99.81
d3bb9a1		121	Uncharacterized protein Sfri1973 {Shewanella frigi	99.8
d2f86b1		129	Association domain of calcium/calmodulin-dependent	99.78
d3cu3a1		162	Uncharacterized protein NpunR1993 {Nostoc punctifo	99.76
d2rgqa1		133	Uncharacterized protein NpunR3134 {Nostoc punctifo	99.35
d2rfra1		153	Uncharacterized protein Saro3722 {Novosphingobium	99.26
d3b8la1		144	Uncharacterized protein Saro3538 {Novosphingobium	99.1
d1oh0a_		125	Delta-5-3-ketosteroid isomerase, steroid delta-iso	98.97
d2chca1		167	Uncharacterized protein Rv3472 {Mycobacterium tube	98.95
d3ejva1		159	Uncharacterized protein Saro2766 {Novosphingobium	98.94
d2bnga1		132	Uncharacterized protein Mb2760 {Mycobacterium tube	98.91
d1nwwa_		145	Limonene-1,2-epoxide hydrolase {Rhodococcus erythr	98.9
d3en8a1		127	Uncharacterized protein BxeB2092 {Burkholderia xen	98.87
d3dm8a1		135	Uncharacterized protein Rpa4348 {Rhodopseudomonas	98.86
d2k54a1		123	Uncharacterized protein Atu0742 {Agrobacterium tum	98.85
d3ebta1		131	Uncharacterized protein BPSS0132 {Burkholderia pse	98.85
d3ef8a1		149	Uncharacterized protein Saro1465 {Novosphingobium	98.83
d3blza1		124	Uncharacterized protein Sbal0622 {Shewanella balti	98.83
d1ohpa1		125	Delta-5-3-ketosteroid isomerase, steroid delta-iso	98.82
d3dmca1		133	Uncharacterized protein Ava2261 {Anabaena variabil	98.79
d2a15a1		132	Hypothetical protein Rv0760c {Mycobacterium tuberc	98.71
d1tuha_		131	Hypothetical protein egc068 from a soil-derived mo	98.65
d3ec9a1		130	Uncharacterized protein BTHI0051 {Burkholderia tha	98.61
d1s5aa_		139	Hypothetical protein YesE {Bacillus subtilis [TaxI	98.58
d2f99a1		140	Aklanonic acid methyl ester cyclase, AknH {Strepto	98.57
d2gexa1		138	Nogalamycin biosynthesis protein SnoL {Streptomyce	98.53
d2geya1		144	Putative hydroxylase AclR {Streptomyces galilaeus	98.49
d1z1sa1		129	Uncharacterized protein PA3332 {Pseudomonas aerugi	98.45
d1idpa_		147	Scytalone dehydratase {Fungus (Magnaporthe grisea)	98.35
d1m98a2		142	Orange carotenoid protein, C-terminal domain {Cyan	98.31
d1tp6a_		126	Hypothetical protein PA1314 {Pseudomonas aeruginos	98.25
d3ebya1		157	Putative hydroxylase subunit Saro3860 {Novosphingo	98.2
d1e52a_		56	C-terminal UvrC-binding domain of UvrB {Escherichi	98.12
d3e99a1		163	Benzoate 1,2-dioxygenase beta subunit BenB {Burkho	98.08
d3dxoa1		117	Uncharacterized protein Atu0744 {Agrobacterium tum	98.02
d1sjwa_		142	Nogalonic acid methyl ester cyclase SnoaL {Strepto	97.92
d2b1xb1		167	Naphthalene 1,2-dioxygenase beta subunit {Rhodococ	97.68
d1ulib_		177	Biphenyl dioxygenase small subunit BphA2 {Rhodococ	97.03
d1wqlb1		182	Small subunit of cumene dioxygenase CumA2 {Pseudom	96.78
d1gy7a_		121	Nuclear transport factor-2 (NTF2) {Baker's yeast (	95.67
d1gy6a_		125	Nuclear transport factor-2 (NTF2) {Rat (Rattus nor	95.62
d1vqqa1		112	Penicillin binding protein 2a (PBP2A), N-terminal	95.34
d1zo2a1		117	Nuclear transport factor-2 (NTF2) {Cryptosporidium	94.72
d2qiya1		139	UBP3-associated protein BRE5 {Baker's yeast (Sacch	93.69
d1jkga_		139	NTF2-related export protein 1 (p15) {Human (Homo s	92.78
d2i9wa1		113	Hypothetical protein Psyc2064 {Psychrobacter arcti	91.01
d2fzta1		78	Hypothetical protein TM0693 {Thermotoga maritima [	89.41
d1fpoa2		95	HSC20 (HSCB), C-terminal oligomerisation domain {E	84.4

>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: SAV4671-like
domain: Uncharacterized protein SAV4671
species: Streptomyces avermitilis [TaxId: 33903]

Probab=99.96  E-value=8.6e-29  Score=202.84  Aligned_cols=121  Identities=36%  Similarity=0.578  Sum_probs=107.2

Q ss_pred             chhhHHHHHHHHHHHHHcCCHHHHHhhhcCC---------------CceEEecCCCCCccCHHHHHHHHHHHHhccCcce
Q 024630          142 SKTSVLAANARFYDSFKNGDLATMQGLWARG---------------DNVCCVHPGASGISGYDPVMESWEVVWMNYEFPL  206 (265)
Q Consensus       142 sk~aI~aa~~afy~Af~aGDldAL~alwAdD---------------d~V~~vhPgg~~l~Gr~aI~aswe~vfa~~~~pl  206 (265)
                      .+++|.+++++||+||++||+++|+++|++|               +.++|+||+++++.|+++|+++|+.+|.... .+
T Consensus         5 d~~~v~aa~~af~~A~~~~D~~a~~~~w~~d~~~~~~~~~~~~~~~d~v~~~hpg~~~l~G~~ai~~~~~~~~~~~~-~~   83 (153)
T d3cnxa1           5 DVEQVGLANTAFYEAMERGDFETLSSLWLTPADLGVDEEYHDPADAGVVSCVHPGWPVLSGRGEVLRSYALIMANTE-YI   83 (153)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCHHHHHHHBCCHHHHTC------CCCTTCCEEECTTCCEEEHHHHHHHHHHHHHHTCS-EE
T ss_pred             cHHHHHHHHHHHHHHHHcCCHHHHHHhhcccccccccccccccccccceeeecCCCccccCHHHHHHHHHHHhcccC-cc
Confidence            4679999999999999999999999999753               5689999999999999999999999998754 47


Q ss_pred             EEEEEeEEEEEeCCEEEEEEEEEEec----------CCcc-eeeEEEEEEEEEeCCeEEEEEEeeCCC
Q 024630          207 AIELKNVRVHVRGNVGYVTCIEFVRT----------KGTS-WGGQFVTNVFEKLDGQWFICIHHASPV  263 (265)
Q Consensus       207 ~iel~dv~V~v~GDvA~Vt~~e~v~~----------~G~~-~g~~raTnVfrR~dG~WrIVhhHaSp~  263 (265)
                      .+++.+++|.+.||+|++++.+.+..          +|+. ..+.++|+||||+||+|||+|||+||+
T Consensus        84 ~~~~~~~~v~v~gD~A~v~~~~~v~~~~~~~~~~~~~g~~~~~~~r~T~v~~k~dg~Wkivh~H~Sp~  151 (153)
T d3cnxa1          84 QFFLTDVHVSVTGDTALVTCTENILSGGPPPDDSDELGPLVGQLVVATNVFRRTPDGWKLWSHHASPV  151 (153)
T ss_dssp             EEEEEEEEEEEETTEEEEEEEEEEEEEC---------CCCEEEEEEEEEEEECCTTCCEEEEEEEEEC
T ss_pred             cceEEEeEEEEeCcEEEEEEEEEEEeecccccccccCCcccceeEEEEEEEEEECCEEEEEEEecCCc
Confidence            89999999999999999999988752          2322 346799999999999999999999996

PyMOL of d3cnxa1

>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]}	Back information, alignment and structure

>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]}	Back information, alignment and structure

>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}	Back information, alignment and structure

>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]}	Back information, alignment and structure

>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]}	Back information, alignment and structure

>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]}	Back information, alignment and structure

>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]}	Back information, alignment and structure

>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]}	Back information, alignment and structure

>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]}	Back information, alignment and structure

>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]}	Back information, alignment and structure

>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]}	Back information, alignment and structure

>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1idpa_ d.17.4.1 (A:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]}	Back information, alignment and structure

>d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d3ebya1 d.17.4.4 (A:6-162) Putative hydroxylase subunit Saro3860 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3e99a1 d.17.4.4 (A:1-163) Benzoate 1,2-dioxygenase beta subunit BenB {Burkholderia mallei [TaxId: 13373]}	Back information, alignment and structure

>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]}	Back information, alignment and structure

>d2b1xb1 d.17.4.4 (B:513-679) Naphthalene 1,2-dioxygenase beta subunit {Rhodococcus sp. ncimb12038 [TaxId: 92694]}	Back information, alignment and structure

>d1ulib_ d.17.4.4 (B:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. (strain RHA1) [TaxId: 101510]}	Back information, alignment and structure

>d1wqlb1 d.17.4.4 (B:5-186) Small subunit of cumene dioxygenase CumA2 {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1vqqa1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]}	Back information, alignment and structure

>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i9wa1 d.17.4.30 (A:46-158) Hypothetical protein Psyc2064 {Psychrobacter arcticus [TaxId: 334543]}	Back information, alignment and structure

>d2fzta1 a.46.3.1 (A:1-78) Hypothetical protein TM0693 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1fpoa2 a.23.1.1 (A:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure