Citrus Sinensis ID: 024705
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 264 | ||||||
| 359496049 | 398 | PREDICTED: DNA repair protein recA homol | 0.875 | 0.580 | 0.737 | 4e-94 | |
| 356571990 | 386 | PREDICTED: DNA repair protein recA homol | 0.890 | 0.608 | 0.706 | 4e-89 | |
| 357509615 | 394 | RecA [Medicago truncatula] gi|355500111| | 0.901 | 0.604 | 0.679 | 1e-85 | |
| 224139890 | 323 | predicted protein [Populus trichocarpa] | 0.731 | 0.597 | 0.813 | 1e-80 | |
| 6143863 | 389 | putative RecA protein [Arabidopsis thali | 0.943 | 0.640 | 0.641 | 5e-80 | |
| 22330951 | 389 | DNA repair protein recA-like 2 [Arabidop | 0.943 | 0.640 | 0.641 | 6e-80 | |
| 255586516 | 388 | DNA repair protein reca, putative [Ricin | 0.954 | 0.649 | 0.648 | 5e-77 | |
| 449449809 | 401 | PREDICTED: DNA repair protein recA homol | 0.943 | 0.620 | 0.610 | 2e-73 | |
| 133711814 | 395 | putative recA protein [Solanum lycopersi | 0.943 | 0.630 | 0.637 | 6e-70 | |
| 224086956 | 335 | predicted protein [Populus trichocarpa] | 0.704 | 0.555 | 0.692 | 2e-68 |
| >gi|359496049|ref|XP_002278976.2| PREDICTED: DNA repair protein recA homolog 2, mitochondrial-like [Vitis vinifera] gi|296087050|emb|CBI33377.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 350 bits (897), Expect = 4e-94, Method: Compositional matrix adjust.
Identities = 171/232 (73%), Positives = 201/232 (86%), Gaps = 1/232 (0%)
Query: 27 QNGRRDAITCIGMNIHSLSSAAEVPEFD-DEPHDDAKIMQKDNALRLALSQLANDFGKES 85
Q G+RDA+ CIGM+ SLSS+ E E + DE +D K +KD ALRLA+S+LA DFG+ES
Sbjct: 29 QTGKRDAVACIGMHTRSLSSSVEFLEIECDEYGNDVKAAEKDTALRLAISRLAGDFGRES 88
Query: 86 MLSLKRFFGSRRGPVISTGSLKLDLALGIGGLPKGRIVEIYGREASGKTTLALHVIKEAQ 145
MLSL+RFF SR PVISTGSLKLDLALGIGGLPKGRIVEIYG+EASGKTTLALH+IKEAQ
Sbjct: 89 MLSLQRFFVSRHAPVISTGSLKLDLALGIGGLPKGRIVEIYGQEASGKTTLALHIIKEAQ 148
Query: 146 KLGGYCAYLDVENALDPSLAEAMGIDAENLLIAQPDSAENLLSVVDTLTKSGSIDVIVVD 205
KLGGYCAYLDVENA++PS AE+MG++ +NLLI+ PDSAENLLS+V+TLTKSGS+DVIVVD
Sbjct: 149 KLGGYCAYLDVENAMNPSFAESMGVNVDNLLISPPDSAENLLSMVNTLTKSGSMDVIVVD 208
Query: 206 SVAALIPKCEIGVPINGMYSDAQSRIMTQALRKIHYSLCQSHTLIIFLNQVK 257
SVAAL+P+ E+ V I G Y D QS+IM QALRKIHYSLC+S TLIIF+NQV+
Sbjct: 209 SVAALVPQHELDVVIGGTYQDVQSQIMAQALRKIHYSLCRSETLIIFVNQVR 260
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356571990|ref|XP_003554153.1| PREDICTED: DNA repair protein recA homolog 2, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357509615|ref|XP_003625096.1| RecA [Medicago truncatula] gi|355500111|gb|AES81314.1| RecA [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224139890|ref|XP_002323326.1| predicted protein [Populus trichocarpa] gi|222867956|gb|EEF05087.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|6143863|gb|AAF04410.1|AC010927_3 putative RecA protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22330951|ref|NP_187625.2| DNA repair protein recA-like 2 [Arabidopsis thaliana] gi|75158993|sp|Q8RY99.1|RECAM_ARATH RecName: Full=DNA repair protein recA homolog 2, mitochondrial; AltName: Full=Recombinase A homolog 2; Flags: Precursor gi|18996122|gb|AAL79768.1| RecA protein [Arabidopsis thaliana] gi|22531124|gb|AAM97066.1| putative RecA protein [Arabidopsis thaliana] gi|23198012|gb|AAN15533.1| putative RecA protein [Arabidopsis thaliana] gi|332641343|gb|AEE74864.1| DNA repair protein recA-like 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255586516|ref|XP_002533897.1| DNA repair protein reca, putative [Ricinus communis] gi|223526148|gb|EEF28487.1| DNA repair protein reca, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449449809|ref|XP_004142657.1| PREDICTED: DNA repair protein recA homolog 2, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|133711814|gb|ABO36632.1| putative recA protein [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|224086956|ref|XP_002308017.1| predicted protein [Populus trichocarpa] gi|222853993|gb|EEE91540.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 264 | ||||||
| TAIR|locus:2100038 | 389 | RECA3 "RECA homolog 3" [Arabid | 0.871 | 0.591 | 0.619 | 6.7e-72 | |
| TAIR|locus:2050439 | 430 | RECA2 "A. thaliana recA homolo | 0.806 | 0.495 | 0.497 | 2.5e-49 | |
| TIGR_CMR|CHY_1166 | 343 | CHY_1166 "recA protein" [Carbo | 0.727 | 0.559 | 0.463 | 2.8e-43 | |
| TIGR_CMR|SO_3430 | 357 | SO_3430 "recA protein" [Shewan | 0.727 | 0.537 | 0.481 | 7.5e-41 | |
| TIGR_CMR|SPO_2034 | 347 | SPO_2034 "recA protein" [Ruege | 0.731 | 0.556 | 0.461 | 2e-40 | |
| UNIPROTKB|P0A7G6 | 353 | recA [Escherichia coli K-12 (t | 0.727 | 0.543 | 0.476 | 5.3e-40 | |
| TIGR_CMR|CBU_1054 | 343 | CBU_1054 "recA protein" [Coxie | 0.731 | 0.562 | 0.461 | 5.3e-40 | |
| TIGR_CMR|NSE_0530 | 327 | NSE_0530 "recA protein" [Neori | 0.727 | 0.587 | 0.451 | 5.3e-40 | |
| TIGR_CMR|GSU_0145 | 338 | GSU_0145 "recA protein" [Geoba | 0.734 | 0.573 | 0.427 | 6.8e-40 | |
| DICTYBASE|DDB_G0276073 | 452 | recA "recombinase A" [Dictyost | 0.829 | 0.484 | 0.392 | 8.7e-40 |
| TAIR|locus:2100038 RECA3 "RECA homolog 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 727 (261.0 bits), Expect = 6.7e-72, P = 6.7e-72
Identities = 143/231 (61%), Positives = 173/231 (74%)
Query: 28 NGRRDAITCIGMNIHSLSSAAEVPEFD-DEPHDDAKIMQKDNALRLALSQLANDFGKESM 86
NGRR + C G LSS E + + DE DD K+ +KD AL LALSQL+ DF K+S
Sbjct: 23 NGRRSVLACSGYENRYLSSLVEASDCELDEVPDDRKVAEKDTALHLALSQLSGDFDKDSK 82
Query: 87 LSLKRFFGSRRGPVISTGSLKLDLALGIGGLPKGRIVEIYGREASGKTTLALHVIKEAQK 146
LSL+RF+ RR VISTGSL LDLALG+GGLPKGR+VE+YG+EASGKTTLALH+IKEAQK
Sbjct: 83 LSLQRFYRKRRVSVISTGSLNLDLALGVGGLPKGRMVEVYGKEASGKTTLALHIIKEAQK 142
Query: 147 LGGYCAYLDVENALDPSLAEAMGIDAENLLIAQPDSAENLLSVVDTLTKSGXXXXXXXXX 206
LGGYCAYLD ENA+DPSLAE++G++ E LLI++P SAE +L++VD LTKSG
Sbjct: 143 LGGYCAYLDAENAMDPSLAESIGVNTEELLISRPSSAEKMLNIVDVLTKSGSVDVIVVDS 202
Query: 207 XXXLIPKCEIGVPINGMYSDAQSRIMTQALRKIHYSLCQSHTLIIFLNQVK 257
L P+CE+ P+ Y D QSRIMTQALRKIHYS+ S TLI+FLNQV+
Sbjct: 203 VAALAPQCELDAPVGERYRDTQSRIMTQALRKIHYSVGYSQTLIVFLNQVR 253
|
|
| TAIR|locus:2050439 RECA2 "A. thaliana recA homolog 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1166 CHY_1166 "recA protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_3430 SO_3430 "recA protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2034 SPO_2034 "recA protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A7G6 recA [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1054 CBU_1054 "recA protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0530 NSE_0530 "recA protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0145 GSU_0145 "recA protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0276073 recA "recombinase A" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.XVI.1854.1 | hypothetical protein (323 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 264 | |||
| cd00983 | 325 | cd00983, recA, RecA is a bacterial enzyme which ha | 1e-96 | |
| PRK09354 | 349 | PRK09354, recA, recombinase A; Provisional | 2e-88 | |
| pfam00154 | 322 | pfam00154, RecA, recA bacterial DNA recombination | 4e-82 | |
| TIGR02012 | 321 | TIGR02012, tigrfam_recA, protein RecA | 3e-80 | |
| PRK09519 | 790 | PRK09519, recA, DNA recombination protein RecA; Re | 4e-55 | |
| COG0468 | 279 | COG0468, RecA, RecA/RadA recombinase [DNA replicat | 2e-53 | |
| cd01393 | 226 | cd01393, recA_like, RecA is a bacterial enzyme whi | 4e-52 | |
| cd01123 | 235 | cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B | 1e-15 | |
| cd01394 | 218 | cd01394, radB, RadB | 2e-10 | |
| PRK09361 | 225 | PRK09361, radB, DNA repair and recombination prote | 2e-09 | |
| PRK04301 | 317 | PRK04301, radA, DNA repair and recombination prote | 2e-09 | |
| COG0467 | 260 | COG0467, RAD55, RecA-superfamily ATPases implicate | 5e-09 | |
| PLN03187 | 344 | PLN03187, PLN03187, meiotic recombination protein | 9e-09 | |
| TIGR02237 | 209 | TIGR02237, recomb_radB, DNA repair and recombinati | 1e-08 | |
| pfam08423 | 261 | pfam08423, Rad51, Rad51 | 6e-08 | |
| TIGR02238 | 313 | TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 | 8e-08 | |
| PTZ00035 | 337 | PTZ00035, PTZ00035, Rad51 protein; Provisional | 2e-07 | |
| TIGR02236 | 310 | TIGR02236, recomb_radA, DNA repair and recombinati | 6e-07 | |
| cd01120 | 165 | cd01120, RecA-like_NTPases, RecA-like NTPases | 9e-07 | |
| cd01121 | 372 | cd01121, Sms, Sms (bacterial radA) DNA repair prot | 1e-06 | |
| TIGR03880 | 224 | TIGR03880, KaiC_arch_3, KaiC domain protein, AF_03 | 1e-06 | |
| TIGR02239 | 316 | TIGR02239, recomb_RAD51, DNA repair protein RAD51 | 2e-06 | |
| pfam06745 | 231 | pfam06745, KaiC, KaiC | 2e-06 | |
| PLN03186 | 342 | PLN03186, PLN03186, DNA repair protein RAD51 homol | 5e-06 | |
| PRK06067 | 234 | PRK06067, PRK06067, flagellar accessory protein Fl | 2e-05 | |
| pfam13481 | 154 | pfam13481, AAA_25, AAA domain | 3e-05 | |
| PRK09302 | 509 | PRK09302, PRK09302, circadian clock protein KaiC; | 7e-05 | |
| COG1066 | 456 | COG1066, Sms, Predicted ATP-dependent serine prote | 8e-05 | |
| TIGR03881 | 229 | TIGR03881, KaiC_arch_4, KaiC domain protein, PAE11 | 1e-04 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 2e-04 | |
| PRK11823 | 446 | PRK11823, PRK11823, DNA repair protein RadA; Provi | 4e-04 | |
| COG2874 | 235 | COG2874, FlaH, Predicted ATPases involved in bioge | 5e-04 | |
| pfam01637 | 223 | pfam01637, Arch_ATPase, Archaeal ATPase | 0.002 | |
| COG4544 | 260 | COG4544, COG4544, Uncharacterized conserved protei | 0.002 |
| >gnl|CDD|238483 cd00983, recA, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
Score = 286 bits (733), Expect = 1e-96
Identities = 105/193 (54%), Positives = 142/193 (73%), Gaps = 1/193 (0%)
Query: 65 QKDNALRLALSQLANDFGKESMLSLKRFFGSRRGPVISTGSLKLDLALGIGGLPKGRIVE 124
+K AL LAL Q+ FGK S++ L + VI TGSL LD+ALGIGG PKGRI+E
Sbjct: 1 EKQKALELALKQIEKKFGKGSIMKLGDD-AVQDVEVIPTGSLSLDIALGIGGYPKGRIIE 59
Query: 125 IYGREASGKTTLALHVIKEAQKLGGYCAYLDVENALDPSLAEAMGIDAENLLIAQPDSAE 184
IYG E+SGKTTLALH I EAQKLGG A++D E+ALDP A+ +G+D +NLLI+QPD+ E
Sbjct: 60 IYGPESSGKTTLALHAIAEAQKLGGTVAFIDAEHALDPVYAKKLGVDLDNLLISQPDTGE 119
Query: 185 NLLSVVDTLTKSGSIDVIVVDSVAALIPKCEIGVPINGMYSDAQSRIMTQALRKIHYSLC 244
L + D+L +SG++D+IVVDSVAAL+PK EI + + Q+R+M+QALRK+ S+
Sbjct: 120 QALEIADSLVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGSIN 179
Query: 245 QSHTLIIFLNQVK 257
+S+T +IF+NQ++
Sbjct: 180 KSNTTVIFINQLR 192
|
RecA couples ATP hydrolysis to DNA strand exchange. Length = 325 |
| >gnl|CDD|236476 PRK09354, recA, recombinase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215755 pfam00154, RecA, recA bacterial DNA recombination protein | Back alignment and domain information |
|---|
| >gnl|CDD|162659 TIGR02012, tigrfam_recA, protein RecA | Back alignment and domain information |
|---|
| >gnl|CDD|77219 PRK09519, recA, DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223544 COG0468, RecA, RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|238687 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >gnl|CDD|238543 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >gnl|CDD|238688 cd01394, radB, RadB | Back alignment and domain information |
|---|
| >gnl|CDD|236482 PRK09361, radB, DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235273 PRK04301, radA, DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223543 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215620 PLN03187, PLN03187, meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233793 TIGR02237, recomb_radB, DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >gnl|CDD|117002 pfam08423, Rad51, Rad51 | Back alignment and domain information |
|---|
| >gnl|CDD|131292 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >gnl|CDD|185407 PTZ00035, PTZ00035, Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131290 TIGR02236, recomb_radA, DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases | Back alignment and domain information |
|---|
| >gnl|CDD|238541 cd01121, Sms, Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >gnl|CDD|163592 TIGR03880, KaiC_arch_3, KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >gnl|CDD|233794 TIGR02239, recomb_RAD51, DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >gnl|CDD|219158 pfam06745, KaiC, KaiC | Back alignment and domain information |
|---|
| >gnl|CDD|178728 PLN03186, PLN03186, DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180381 PRK06067, PRK06067, flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222165 pfam13481, AAA_25, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|236461 PRK09302, PRK09302, circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223993 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|163593 TIGR03881, KaiC_arch_4, KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|236994 PRK11823, PRK11823, DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225429 COG2874, FlaH, Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|216619 pfam01637, Arch_ATPase, Archaeal ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|226918 COG4544, COG4544, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| PRK09354 | 349 | recA recombinase A; Provisional | 100.0 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 100.0 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 100.0 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 100.0 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 99.97 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 99.96 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 99.94 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 99.93 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 99.93 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 99.91 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 99.91 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 99.91 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 99.91 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 99.91 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 99.91 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 99.91 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 99.9 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 99.9 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 99.9 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 99.89 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 99.89 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 99.89 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 99.88 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 99.88 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 99.88 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 99.88 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 99.86 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 99.86 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 99.86 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 99.86 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 99.85 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 99.85 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 99.85 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 99.85 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 99.84 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 99.84 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 99.84 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 99.84 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 99.83 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 99.83 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 99.83 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 99.83 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 99.82 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 99.82 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 99.81 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 99.81 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 99.81 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 99.81 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 99.8 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 99.8 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 99.8 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 99.79 | |
| PRK06749 | 428 | replicative DNA helicase; Provisional | 99.78 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 99.77 | |
| KOG1434 | 335 | consensus Meiotic recombination protein Dmc1 [Cell | 99.77 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 99.75 | |
| COG0305 | 435 | DnaB Replicative DNA helicase [DNA replication, re | 99.74 | |
| KOG1564 | 351 | consensus DNA repair protein RHP57 [Replication, r | 99.73 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 99.71 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 99.69 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 99.66 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 99.54 | |
| KOG1433 | 326 | consensus DNA repair protein RAD51/RHP55 [Replicat | 99.51 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 99.41 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 99.38 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.38 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.36 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.34 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.33 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.32 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.3 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.27 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.26 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 99.26 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.25 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.24 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.24 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.24 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.23 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 99.22 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.22 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.21 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.19 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.19 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.19 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.19 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.19 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.17 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.17 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.16 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.16 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.16 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 99.15 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.15 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.15 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.15 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.15 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.14 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.14 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.14 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.14 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.14 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.13 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.13 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.13 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.13 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.12 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.12 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.11 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.11 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.11 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.11 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.11 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.11 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.1 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 99.1 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.1 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.1 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.1 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.1 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 99.09 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.09 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.09 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.08 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.08 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 99.08 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.08 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.08 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.08 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.07 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.07 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.07 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.07 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.06 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.06 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.05 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.05 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.05 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.05 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.05 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.05 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.05 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.05 | |
| KOG2373 | 514 | consensus Predicted mitochondrial DNA helicase twi | 99.05 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.04 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.04 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.04 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.04 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.04 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 99.04 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.04 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.04 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.03 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.03 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.03 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 99.03 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.03 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.03 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.03 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.03 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.03 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.02 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 99.02 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.02 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.02 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.02 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.02 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 99.02 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.02 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.01 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.01 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.0 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.0 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.0 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.0 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.0 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.0 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 98.99 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 98.99 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 98.99 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.99 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.98 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 98.98 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 98.98 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.98 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 98.98 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.98 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 98.98 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 98.98 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 98.98 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 98.98 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 98.98 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 98.97 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 98.97 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 98.97 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 98.97 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 98.97 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 98.97 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.97 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 98.97 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 98.96 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 98.96 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 98.96 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 98.96 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 98.95 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.95 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 98.95 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.95 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 98.95 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 98.95 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.94 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 98.94 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 98.94 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 98.93 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 98.93 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 98.93 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 98.93 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 98.92 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 98.92 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.92 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 98.92 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 98.91 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 98.91 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 98.91 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 98.91 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 98.91 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 98.91 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.9 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 98.9 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 98.9 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.89 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.89 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 98.89 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.89 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.89 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.89 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 98.88 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 98.88 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.87 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 98.87 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 98.87 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.87 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 98.85 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 98.85 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 98.85 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.85 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.84 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 98.84 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 98.84 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 98.84 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 98.84 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.84 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 98.84 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 98.84 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 98.84 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 98.83 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 98.83 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 98.83 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 98.83 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 98.83 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 98.83 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 98.83 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 98.82 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 98.81 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 98.81 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 98.81 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 98.81 | |
| PF13479 | 213 | AAA_24: AAA domain | 98.8 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 98.8 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 98.8 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 98.79 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 98.79 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 98.79 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 98.79 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 98.79 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 98.78 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.78 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 98.77 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 98.77 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 98.77 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 98.77 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 98.77 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 98.76 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 98.76 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 98.76 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 98.76 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 98.74 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 98.74 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 98.74 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 98.74 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.74 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 98.74 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 98.73 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 98.73 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 98.73 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 98.73 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 98.72 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 98.72 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.72 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 98.72 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 98.72 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 98.72 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 98.72 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 98.72 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 98.71 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 98.71 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 98.71 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.71 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 98.7 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 98.7 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 98.7 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 98.69 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 98.69 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 98.69 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.69 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 98.69 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 98.68 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.68 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 98.68 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 98.67 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 98.67 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 98.67 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 98.67 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.67 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 98.67 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 98.67 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 98.67 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 98.66 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.66 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 98.66 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 98.66 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 98.66 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 98.66 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 98.65 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.65 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 98.65 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 98.65 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 98.65 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 98.64 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 98.64 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 98.64 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.64 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 98.64 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 98.64 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 98.63 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.63 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 98.63 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 98.63 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 98.63 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 98.62 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 98.62 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 98.61 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.61 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 98.61 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 98.61 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 98.61 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.61 | |
| PRK08181 | 269 | transposase; Validated | 98.61 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.6 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 98.6 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 98.59 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 98.59 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 98.59 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 98.59 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 98.59 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 98.58 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 98.58 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 98.58 | |
| PRK06526 | 254 | transposase; Provisional | 98.57 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.57 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 98.56 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.56 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 98.56 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 98.56 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 98.55 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 98.55 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 98.55 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 98.55 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 98.54 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 98.54 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 98.53 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 98.53 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 98.52 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 98.52 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 98.51 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 98.51 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 98.51 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 98.51 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 98.51 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 98.51 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 98.51 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 98.5 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 98.5 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 98.5 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.5 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 98.49 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 98.49 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.49 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.49 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 98.49 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 98.48 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 98.48 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 98.48 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 98.48 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 98.48 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 98.47 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 98.47 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 98.47 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 98.46 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 98.46 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 98.46 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.45 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.45 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 98.44 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 98.44 | |
| PRK12377 | 248 | putative replication protein; Provisional | 98.44 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 98.44 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 98.44 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 98.43 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 98.43 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.43 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 98.43 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 98.42 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 98.42 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 98.42 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.42 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 98.41 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 98.41 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 98.41 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.4 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.4 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 98.4 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 98.4 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 98.4 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 98.4 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.39 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 98.39 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 98.39 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 98.39 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.39 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.38 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 98.38 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 98.37 | |
| KOG0059 | 885 | consensus Lipid exporter ABCA1 and related protein | 98.37 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 98.37 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 98.36 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 98.36 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 98.36 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 98.36 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 98.36 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 98.35 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.35 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.33 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 98.33 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 98.32 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 98.32 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 98.31 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 98.31 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.3 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 98.3 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 98.3 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 98.29 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 98.29 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 98.29 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 98.28 | |
| PRK08116 | 268 | hypothetical protein; Validated | 98.28 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 98.28 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 98.27 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 98.26 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 98.26 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 98.25 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 98.25 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 98.24 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 98.24 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 98.24 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 98.24 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 98.24 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 98.23 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.22 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 98.22 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 98.21 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 98.21 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 98.21 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 98.21 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 98.21 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 98.2 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 98.2 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 98.19 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 98.19 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 98.18 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 98.18 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 98.18 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 98.17 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 98.17 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 98.17 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 98.17 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 98.17 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.16 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 98.16 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 98.15 |
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-34 Score=255.84 Aligned_cols=197 Identities=53% Similarity=0.795 Sum_probs=182.4
Q ss_pred hHHHHHHHHHHHHHHHhcCCccccccccccCCCCCCccccCcHHHHHHhcCCCCCCCcEEEEEecCCCChHHHHHHHHHH
Q 024705 64 MQKDNALRLALSQLANDFGKESMLSLKRFFGSRRGPVISTGSLKLDLALGIGGLPKGRIVEIYGREASGKTTLALHVIKE 143 (264)
Q Consensus 64 ~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~i~tG~~~LD~~l~~gGl~~G~~~~I~G~~GsGKTtl~~~l~~~ 143 (264)
+++...|+.++.+++++||++..+++.+... ...+.+|||++.||.+||+||+++|++++|+||+|+|||||+++++.+
T Consensus 5 ~~~~~~~~~~~~~i~~~~g~~~~~~~~~~~~-~~~~~isTGi~~LD~~LG~GGip~G~IteI~G~~GsGKTtLal~~~~~ 83 (349)
T PRK09354 5 EEKQKALEAALKQIEKQFGKGSIMRLGDDAA-MDVEVISTGSLALDIALGIGGLPRGRIVEIYGPESSGKTTLALHAIAE 83 (349)
T ss_pred hHHHHHHHHHHHHHHHHhCCCCceEcccccc-cCCceecCCcHHHHHHhcCCCCcCCeEEEEECCCCCCHHHHHHHHHHH
Confidence 3678899999999999999999999886443 378899999999999998899999999999999999999999999999
Q ss_pred HhhcCCeEEEEecCCCCCHHHHHHcCCCccceeEeCCCCHHHHHHHHHHHhhcCCccEEEEcCccccccccccCCCcCCC
Q 024705 144 AQKLGGYCAYLDVENALDPSLAEAMGIDAENLLIAQPDSAENLLSVVDTLTKSGSIDVIVVDSVAALIPKCEIGVPINGM 223 (264)
Q Consensus 144 ~~~~g~~v~~~~~e~~~~~~~~~~~g~~~~~l~~~~~~~~ee~~~~i~~~~~~~~~~~vvIDsl~~~~~~~~~~~~~~~~ 223 (264)
++..|++|+||++|+..++.+++.+|++.+++.+.++.+.++.++.+..++++..+++|||||+.++.++.+++++.++.
T Consensus 84 ~~~~G~~~~yId~E~s~~~~~a~~lGvdld~lli~qp~~~Eq~l~i~~~li~s~~~~lIVIDSvaaL~~~~E~eg~~gd~ 163 (349)
T PRK09354 84 AQKAGGTAAFIDAEHALDPVYAKKLGVDIDNLLVSQPDTGEQALEIADTLVRSGAVDLIVVDSVAALVPKAEIEGEMGDS 163 (349)
T ss_pred HHHcCCcEEEECCccchHHHHHHHcCCCHHHeEEecCCCHHHHHHHHHHHhhcCCCCEEEEeChhhhcchhhhcCCcccc
Confidence 99999999999999999999999999999999999999999999999999988999999999999999878888887776
Q ss_pred CcHHHHHHHHHHHHHHHHHHhccCcEEEEEcccchHhh
Q 024705 224 YSDAQSRIMTQALRKIHYSLCQSHTLIIFLNQVKVLLL 261 (264)
Q Consensus 224 ~~~~q~r~i~~~L~~l~~~l~~~g~tVi~i~h~~~~~~ 261 (264)
..+.|++.+++.|++|...++++|+++|++||++.++.
T Consensus 164 ~~~~qar~ms~~Lr~L~~~l~k~~itvI~tNQvr~~ig 201 (349)
T PRK09354 164 HVGLQARLMSQALRKLTGNISKSNTTVIFINQIREKIG 201 (349)
T ss_pred chhHHHHHHHHHHHHHHHHHHHcCcEEEEEEeeeeccc
Confidence 77788998999999999999999999999999998764
|
|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK06749 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >KOG1434 consensus Meiotic recombination protein Dmc1 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1564 consensus DNA repair protein RHP57 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >KOG1433 consensus DNA repair protein RAD51/RHP55 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 264 | ||||
| 3hr8_A | 356 | Crystal Structure Of Thermotoga Maritima Reca Lengt | 2e-44 | ||
| 1ubc_A | 349 | Structure Of Reca Protein Length = 349 | 4e-43 | ||
| 2zr0_A | 349 | Msreca-Q196e Mutant Length = 349 | 1e-42 | ||
| 3cmu_A | 2050 | Mechanism Of Homologous Recombination From The Reca | 1e-42 | ||
| 1u94_A | 356 | Crystal Structure Of E. Coli Reca In A Compressed H | 1e-42 | ||
| 2rec_A | 353 | Reca Hexamer Model, Electron Microscopy Length = 35 | 1e-42 | ||
| 1n03_A | 352 | Model For Active Reca Filament Length = 352 | 1e-42 | ||
| 3cmt_A | 1706 | Mechanism Of Homologous Recombination From The Reca | 2e-42 | ||
| 3cmv_A | 1357 | Mechanism Of Homologous Recombination From The Reca | 2e-42 | ||
| 2zrc_A | 349 | Msreca Q196n Form Iv Length = 349 | 2e-42 | ||
| 2zrh_A | 349 | Msreca Q196a Form Iv Length = 349 | 3e-42 | ||
| 1g18_A | 350 | Reca-Adp-Alf4 Complex Length = 350 | 4e-42 | ||
| 1xp8_A | 366 | "deinococcus Radiodurans Reca In Complex With Atp-G | 1e-41 | ||
| 2cvf_A | 220 | Crystal Structure Of The Radb Recombinase Length = | 5e-06 | ||
| 4b2i_A | 231 | Humanised Monomeric Rada In Complex With Indazole L | 8e-05 | ||
| 4a6p_A | 231 | Rada C-Terminal Atpase Domain From Pyrococcus Furio | 8e-05 | ||
| 1pzn_A | 349 | Rad51 (Rada) Length = 349 | 8e-05 | ||
| 2w0m_A | 235 | Crystal Structure Of Sso2452 From Sulfolobus Solfat | 9e-05 | ||
| 1szp_A | 321 | A Crystal Structure Of The Rad51 Filament Length = | 1e-04 | ||
| 3lda_A | 400 | Yeast Rad51 H352y Filament Interface Mutant Length | 3e-04 |
| >pdb|3HR8|A Chain A, Crystal Structure Of Thermotoga Maritima Reca Length = 356 | Back alignment and structure |
|
| >pdb|1UBC|A Chain A, Structure Of Reca Protein Length = 349 | Back alignment and structure |
| >pdb|2ZR0|A Chain A, Msreca-Q196e Mutant Length = 349 | Back alignment and structure |
| >pdb|3CMU|A Chain A, Mechanism Of Homologous Recombination From The Reca- SsdnaDSDNA STRUCTURES Length = 2050 | Back alignment and structure |
| >pdb|1U94|A Chain A, Crystal Structure Of E. Coli Reca In A Compressed Helical Filament Form 2 Length = 356 | Back alignment and structure |
| >pdb|2REC|A Chain A, Reca Hexamer Model, Electron Microscopy Length = 353 | Back alignment and structure |
| >pdb|1N03|A Chain A, Model For Active Reca Filament Length = 352 | Back alignment and structure |
| >pdb|3CMT|A Chain A, Mechanism Of Homologous Recombination From The Reca- SsdnaDSDNA STRUCTURES Length = 1706 | Back alignment and structure |
| >pdb|3CMV|A Chain A, Mechanism Of Homologous Recombination From The Reca- SsdnaDSDNA STRUCTURES Length = 1357 | Back alignment and structure |
| >pdb|2ZRC|A Chain A, Msreca Q196n Form Iv Length = 349 | Back alignment and structure |
| >pdb|2ZRH|A Chain A, Msreca Q196a Form Iv Length = 349 | Back alignment and structure |
| >pdb|1G18|A Chain A, Reca-Adp-Alf4 Complex Length = 350 | Back alignment and structure |
| >pdb|1XP8|A Chain A, "deinococcus Radiodurans Reca In Complex With Atp-Gamma-S" Length = 366 | Back alignment and structure |
| >pdb|2CVF|A Chain A, Crystal Structure Of The Radb Recombinase Length = 220 | Back alignment and structure |
| >pdb|4B2I|A Chain A, Humanised Monomeric Rada In Complex With Indazole Length = 231 | Back alignment and structure |
| >pdb|4A6P|A Chain A, Rada C-Terminal Atpase Domain From Pyrococcus Furiosus Length = 231 | Back alignment and structure |
| >pdb|1PZN|A Chain A, Rad51 (Rada) Length = 349 | Back alignment and structure |
| >pdb|2W0M|A Chain A, Crystal Structure Of Sso2452 From Sulfolobus Solfataricus P2 Length = 235 | Back alignment and structure |
| >pdb|1SZP|A Chain A, A Crystal Structure Of The Rad51 Filament Length = 321 | Back alignment and structure |
| >pdb|3LDA|A Chain A, Yeast Rad51 H352y Filament Interface Mutant Length = 400 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 264 | |||
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 4e-84 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 3e-83 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 6e-83 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 7e-83 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 1e-77 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 7e-77 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 9e-77 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 1e-76 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 5e-76 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 6e-71 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 7e-77 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 9e-77 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 1e-76 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 3e-76 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 7e-71 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 1e-58 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 3e-39 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 2e-38 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 1e-31 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 3e-31 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 6e-28 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 2e-27 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 1e-18 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 9e-13 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 4e-09 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 3e-10 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 8e-10 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 2e-05 |
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Length = 356 | Back alignment and structure |
|---|
Score = 254 bits (651), Expect = 4e-84
Identities = 99/201 (49%), Positives = 139/201 (69%), Gaps = 8/201 (3%)
Query: 61 AKIMQKDNALRLALSQLANDFGKESMLSLKRFFGSRRGPVISTGSLKLDLALGIGGLPKG 120
+ QK + L AL ++ +FGK S++ L + VI TGSL +D+A G+GG P+G
Sbjct: 2 PEEKQKKSVLEKALKRIEENFGKGSIMILGDETQVQPVEVIPTGSLAIDIATGVGGYPRG 61
Query: 121 RIVEIYGREASGKTTLALHVIKEAQKLGGYCAYLDVENALDPSLAEAMGIDAENLLIAQP 180
RIVEI+G+E+SGKTTLALH I EAQK+GG A++D E+ALDP A+ +G+D ++LLI+QP
Sbjct: 62 RIVEIFGQESSGKTTLALHAIAEAQKMGGVAAFIDAEHALDPVYAKNLGVDLKSLLISQP 121
Query: 181 DSAENLLSVVDTLTKSGSIDVIVVDSVAALIPKCEIGVPINGMYSDA----QSRIMTQAL 236
D E L +VD L +SG +D+IVVDSVAAL+P+ E I G D Q+R+M+QAL
Sbjct: 122 DHGEQALEIVDELVRSGVVDLIVVDSVAALVPRAE----IEGAMGDMQVGLQARLMSQAL 177
Query: 237 RKIHYSLCQSHTLIIFLNQVK 257
RKI S+ +S ++IF NQ++
Sbjct: 178 RKIAGSVNKSKAVVIFTNQIR 198
|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Length = 349 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Length = 366 | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Length = 356 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Length = 2050 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Length = 2050 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Length = 2050 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Length = 2050 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Length = 2050 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Length = 2050 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Length = 1706 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Length = 1706 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Length = 1706 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Length = 1706 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Length = 1706 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Length = 333 | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Length = 324 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Length = 343 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Length = 400 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Length = 349 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Length = 243 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Length = 322 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Length = 220 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Length = 247 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Length = 235 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Length = 260 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 100.0 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 99.97 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 99.97 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 99.97 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 99.97 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 99.97 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 99.96 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 99.95 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 99.95 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 99.92 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 99.92 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 99.91 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 99.89 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 99.88 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 99.88 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 99.88 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 99.87 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 99.87 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 99.87 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 99.86 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 99.85 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 99.84 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 99.84 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 99.83 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 99.83 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 99.83 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 99.8 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 99.74 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 99.74 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.69 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 99.67 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.59 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 99.55 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.28 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.27 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.27 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.25 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.21 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.21 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.2 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.2 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.2 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.2 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.2 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.19 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.19 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.19 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 99.16 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.16 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.14 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.11 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.1 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.09 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.09 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.06 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.05 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.04 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.0 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.0 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 98.98 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 98.96 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 98.94 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.94 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 98.91 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.91 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 98.81 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 98.79 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 98.78 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 98.76 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 98.75 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 98.74 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 98.73 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.72 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 98.72 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 98.72 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 98.71 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 98.7 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 98.7 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 98.69 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.69 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 98.69 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 98.67 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 98.67 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 98.67 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 98.66 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 98.66 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.64 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 98.64 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 98.63 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 98.63 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 98.63 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 98.62 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 98.61 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 98.61 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 98.6 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 98.59 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.58 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 98.56 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 98.55 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 98.55 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 98.53 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 98.52 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 98.51 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 98.5 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 98.49 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.48 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 98.48 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 98.47 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.46 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 98.43 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 98.41 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 98.41 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 98.41 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 98.41 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 98.4 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 98.39 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 98.38 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 98.38 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 98.37 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 98.35 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 98.33 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 98.31 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 98.29 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 98.28 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 98.28 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 98.28 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 98.27 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 98.27 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 98.26 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 98.26 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 98.26 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 98.26 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 98.24 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 98.24 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 98.23 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 98.23 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 98.23 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 98.23 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 98.22 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 98.22 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 98.21 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 98.21 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 98.2 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 98.2 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 98.2 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 98.19 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 98.19 | |
| 1oft_A | 161 | SULA, hypothetical protein PA3008; bacterial cell | 98.19 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 98.17 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 98.16 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 98.16 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 98.15 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 98.14 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 98.14 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 98.13 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 98.12 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 98.11 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 98.1 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 98.09 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 98.07 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.05 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 98.05 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 98.03 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 98.02 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 98.01 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 98.01 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 98.0 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 97.99 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.98 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 97.97 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.96 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.96 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 97.95 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.95 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.94 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.94 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 97.93 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 97.92 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 97.91 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 97.91 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.91 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 97.91 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 97.91 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 97.9 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.9 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.87 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 97.87 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.84 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.84 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 97.84 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.84 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 97.83 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.82 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.82 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.8 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 97.8 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.79 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 97.79 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 97.77 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 97.77 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.76 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.76 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.76 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.75 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 97.75 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 97.74 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 97.74 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 97.73 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 97.73 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 97.73 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 97.72 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.72 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.71 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.7 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 97.7 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.69 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 97.67 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.67 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 97.66 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.66 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.65 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 97.65 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 97.64 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 97.64 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 97.63 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.62 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.61 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.61 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 97.61 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 97.6 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 97.6 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.59 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 97.58 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 97.58 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.58 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 97.57 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 97.57 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 97.57 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 97.56 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 97.56 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 97.55 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.54 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 97.53 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.53 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.53 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 97.52 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 97.51 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 97.49 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 97.49 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 97.49 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.48 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 97.46 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 97.46 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 97.46 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 97.44 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 97.44 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 97.44 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 97.43 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 97.43 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.43 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.42 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 97.42 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 97.41 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.41 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 97.4 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.38 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 97.38 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 97.37 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 97.36 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.36 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 97.35 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 97.34 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 97.34 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 97.33 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 97.33 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 97.33 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.33 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 97.3 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.3 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.29 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 97.28 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 97.28 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 97.27 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 97.27 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 97.27 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 97.26 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 97.26 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.26 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 97.23 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.22 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 97.21 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 97.21 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 97.2 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.2 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 97.2 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 97.19 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 97.19 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 97.17 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 97.17 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 97.17 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.15 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 97.15 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 97.15 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 97.15 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.14 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.13 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 97.13 | |
| 4a8j_A | 361 | Elongator complex protein 4; transcription; 2.10A | 97.12 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 97.12 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 97.09 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 97.08 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 97.05 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.05 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 97.04 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.03 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 97.03 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.02 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 97.01 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.0 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 96.99 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 96.99 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 96.97 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 96.97 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 96.97 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 96.96 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 96.96 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 96.96 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 96.96 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 96.95 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 96.95 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.95 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 96.94 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 96.94 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 96.93 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 96.93 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 96.92 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.91 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 96.91 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 96.9 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 96.89 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 96.89 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 96.89 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 96.88 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.88 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.88 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.88 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 96.87 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 96.85 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 96.82 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 96.81 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 96.81 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 96.8 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 96.79 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 96.78 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 96.78 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 96.77 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 96.75 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 96.75 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 96.75 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 96.74 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.73 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.73 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 96.72 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 96.72 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 96.71 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 96.71 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 96.7 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 96.69 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 96.69 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 96.68 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 96.67 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 96.67 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 96.66 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.65 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 96.65 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 96.64 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 96.64 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.63 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 96.62 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 96.62 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 96.61 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 96.6 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 96.6 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.59 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 96.59 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 96.57 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 96.55 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 96.55 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 96.55 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 96.54 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 96.53 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 96.53 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 96.52 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.52 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 96.52 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 96.52 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 96.51 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.5 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 96.47 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 96.46 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 96.45 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.45 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 96.45 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 96.45 | |
| 1ofu_X | 119 | SULA, hypothetical protein PA3008; bacterial cell | 96.44 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 96.43 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 96.43 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 96.42 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.42 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 96.4 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 96.38 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 96.38 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 96.38 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 96.38 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 96.34 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.34 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 96.33 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.29 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 96.26 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 96.24 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 96.23 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 96.22 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 96.21 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 96.2 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 96.15 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 96.14 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 96.13 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 96.12 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 96.09 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 96.09 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.07 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 96.06 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 96.05 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 96.01 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 96.0 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 95.98 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 95.97 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 95.96 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 95.96 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 95.96 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 95.95 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 95.94 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 95.92 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.91 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 95.87 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 95.87 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.85 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 95.84 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 95.83 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 95.82 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 95.82 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 95.76 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 95.75 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 95.74 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 95.73 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 95.68 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.67 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 95.64 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 95.59 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 95.58 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 95.58 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 95.52 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 95.5 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 95.37 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 95.36 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 95.35 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 95.25 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 95.24 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 95.23 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 95.23 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 95.19 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 95.16 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 95.14 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 95.13 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 95.12 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 95.11 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 95.05 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 95.03 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 95.03 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 95.02 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 95.02 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 95.0 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 94.96 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 94.84 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 94.84 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 94.84 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 94.83 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 94.81 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 94.79 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 94.77 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 94.76 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 94.76 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 94.74 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 94.73 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 94.73 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 94.72 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 94.72 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 94.71 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 94.7 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 94.68 |
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.3e-32 Score=242.30 Aligned_cols=200 Identities=49% Similarity=0.755 Sum_probs=179.6
Q ss_pred chHHHHHHHHHHHHHHHhcCCccccccccccCCCCCCccccCcHHHHHHhcCCCCCCCcEEEEEecCCCChHHHHHHHHH
Q 024705 63 IMQKDNALRLALSQLANDFGKESMLSLKRFFGSRRGPVISTGSLKLDLALGIGGLPKGRIVEIYGREASGKTTLALHVIK 142 (264)
Q Consensus 63 ~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~i~tG~~~LD~~l~~gGl~~G~~~~I~G~~GsGKTtl~~~l~~ 142 (264)
..++.++|..++.|++++||++..+++.......+.++++||+++||.+||+||+++|++++|+||||+|||||+++++.
T Consensus 4 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~i~TG~~~LD~~Lg~GGi~~G~i~~I~GppGsGKSTLal~la~ 83 (356)
T 3hr8_A 4 EKQKKSVLEKALKRIEENFGKGSIMILGDETQVQPVEVIPTGSLAIDIATGVGGYPRGRIVEIFGQESSGKTTLALHAIA 83 (356)
T ss_dssp CHHHHHHHHHHHHHHHHHHCTTSSCCTTCCSCCCCCCEECCSCHHHHHHTSSSSEETTEEEEEEESTTSSHHHHHHHHHH
T ss_pred chHHHHHHHHHHHHHHHHhCCCCceechhccccCCCceecCCCHHHHHHhccCCccCCcEEEEECCCCCCHHHHHHHHHH
Confidence 35688899999999999999998888776543333789999999999999889999999999999999999999999999
Q ss_pred HHhhcCCeEEEEecCCCCCHHHHHHcCCCccceeEeCCCCHHHHHHHHHHHhhcCCccEEEEcCccccccccccCCCcCC
Q 024705 143 EAQKLGGYCAYLDVENALDPSLAEAMGIDAENLLIAQPDSAENLLSVVDTLTKSGSIDVIVVDSVAALIPKCEIGVPING 222 (264)
Q Consensus 143 ~~~~~g~~v~~~~~e~~~~~~~~~~~g~~~~~l~~~~~~~~ee~~~~i~~~~~~~~~~~vvIDsl~~~~~~~~~~~~~~~ 222 (264)
.+...+++|+|++.|+...+.+++++|++++++.+..+.+.++++..++.++...++++++|||++.+++..++++.+++
T Consensus 84 ~~~~~gg~VlyId~E~s~~~~ra~rlgv~~~~l~i~~~~~~e~~l~~~~~l~~~~~~dlvVIDSi~~l~~~~el~g~~G~ 163 (356)
T 3hr8_A 84 EAQKMGGVAAFIDAEHALDPVYAKNLGVDLKSLLISQPDHGEQALEIVDELVRSGVVDLIVVDSVAALVPRAEIEGAMGD 163 (356)
T ss_dssp HHHHTTCCEEEEESSCCCCHHHHHHHTCCGGGCEEECCSSHHHHHHHHHHHHHTSCCSEEEEECTTTCCCHHHHTTCCCS
T ss_pred HHHhcCCeEEEEecccccchHHHHHcCCchhhhhhhhccCHHHHHHHHHHHhhhcCCCeEEehHhhhhcChhhhcccchh
Confidence 99999999999999999999999999999999999999999999999988888789999999999999976788887777
Q ss_pred CCcHHHHHHHHHHHHHHHHHHhccCcEEEEEcccchHhhh
Q 024705 223 MYSDAQSRIMTQALRKIHYSLCQSHTLIIFLNQVKVLLLK 262 (264)
Q Consensus 223 ~~~~~q~r~i~~~L~~l~~~l~~~g~tVi~i~h~~~~~~~ 262 (264)
...+.+++.+++.++.|...+++.|++||++||+++++..
T Consensus 164 ~q~~~qar~la~~L~~L~~lak~~~~tVI~inqv~~k~g~ 203 (356)
T 3hr8_A 164 MQVGLQARLMSQALRKIAGSVNKSKAVVIFTNQIRMKIGV 203 (356)
T ss_dssp SCSSHHHHHHHHHHHHHHHHHHTSSCEEEEEEESSSCSSS
T ss_pred hHHHHHHHHHHHHHHHHHHHHHhcCCEEEEEeeeeecccc
Confidence 6667888999999999998889999999999999766543
|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1oft_A SULA, hypothetical protein PA3008; bacterial cell division inhibitor, FTSZ, SULA protein; 2.9A {Pseudomonas aeruginosa} SCOP: c.37.1.22 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >4a8j_A Elongator complex protein 4; transcription; 2.10A {Saccharomyces cerevisiae} PDB: 4ejs_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ofu_X SULA, hypothetical protein PA3008; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.37.1.22 | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 264 | ||||
| d1xp8a1 | 268 | c.37.1.11 (A:15-282) RecA protein, ATPase-domain { | 5e-64 | |
| d1mo6a1 | 269 | c.37.1.11 (A:1-269) RecA protein, ATPase-domain {M | 4e-63 | |
| d1u94a1 | 263 | c.37.1.11 (A:6-268) RecA protein, ATPase-domain {E | 3e-61 | |
| d1v5wa_ | 258 | c.37.1.11 (A:) Meiotic recombination protein DMC1/ | 1e-21 | |
| d1pzna2 | 254 | c.37.1.11 (A:96-349) DNA repair protein Rad51, cat | 1e-21 | |
| d1szpa2 | 251 | c.37.1.11 (A:145-395) DNA repair protein Rad51, ca | 2e-21 | |
| d2i1qa2 | 258 | c.37.1.11 (A:65-322) DNA repair protein Rad51, cat | 1e-18 | |
| d1n0wa_ | 242 | c.37.1.11 (A:) DNA repair protein Rad51, catalytic | 2e-16 | |
| d1tf7a2 | 242 | c.37.1.11 (A:256-497) Circadian clock protein KaiC | 4e-16 | |
| d1tf7a1 | 242 | c.37.1.11 (A:14-255) Circadian clock protein KaiC | 1e-13 | |
| d1nlfa_ | 274 | c.37.1.11 (A:) Hexameric replicative helicase repA | 7e-05 | |
| d1cr2a_ | 277 | c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), | 3e-04 |
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Length = 268 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: RecA protein, ATPase-domain species: Deinococcus radiodurans [TaxId: 1299]
Score = 199 bits (507), Expect = 5e-64
Identities = 95/195 (48%), Positives = 136/195 (69%), Gaps = 7/195 (3%)
Query: 65 QKDNALRLALSQLANDFGKESMLSLKRFFGSRRG---PVISTGSLKLDLALGIGGLPKGR 121
++ A+ A+SQ+ FGK S++ L G+ V+STGSL LDLALG+GG+P+GR
Sbjct: 3 ERSKAIETAMSQIEKAFGKGSIMKL----GAESKLDVQVVSTGSLSLDLALGVGGIPRGR 58
Query: 122 IVEIYGREASGKTTLALHVIKEAQKLGGYCAYLDVENALDPSLAEAMGIDAENLLIAQPD 181
I EIYG E+ GKTTLAL ++ +AQK GG CA++D E+ALDP A A+G++ + LL++QPD
Sbjct: 59 ITEIYGPESGGKTTLALAIVAQAQKAGGTCAFIDAEHALDPVYARALGVNTDELLVSQPD 118
Query: 182 SAENLLSVVDTLTKSGSIDVIVVDSVAALIPKCEIGVPINGMYSDAQSRIMTQALRKIHY 241
+ E L +++ L +SG+IDV+VVDSVAAL P+ EI + Q+R+M+QALRK+
Sbjct: 119 NGEQALEIMELLVRSGAIDVVVVDSVAALTPRAEIEGDMGDSLPGLQARLMSQALRKLTA 178
Query: 242 SLCQSHTLIIFLNQV 256
L ++ T IF+NQV
Sbjct: 179 ILSKTGTAAIFINQV 193
|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 269 | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Length = 263 | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Length = 277 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 100.0 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 100.0 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 100.0 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 99.87 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 99.83 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 99.83 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 99.8 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 99.8 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 99.79 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 99.74 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 99.69 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 99.56 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.47 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.45 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.44 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.41 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.39 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.38 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.35 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.34 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.33 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.3 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.25 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.24 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.15 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.1 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.1 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.1 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.05 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 98.96 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 98.91 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 98.75 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.72 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 98.72 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.68 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 98.65 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 98.58 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 98.57 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.56 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.54 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 98.52 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.45 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.43 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.13 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.12 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 98.1 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 98.06 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 98.01 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 97.99 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.92 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.86 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 97.86 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 97.85 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 97.84 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 97.84 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.81 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.79 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 97.79 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 97.74 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.73 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 97.73 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.7 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 97.69 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 97.67 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 97.62 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.62 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.62 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 97.6 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 97.58 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.54 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.53 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 97.52 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 97.52 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.52 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 97.5 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.48 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.48 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 97.46 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.46 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.44 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 97.43 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.43 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.41 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 97.41 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.41 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.36 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.36 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 97.36 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.36 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.36 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.36 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 97.35 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.31 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.3 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.29 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 97.29 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.29 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 97.27 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 97.26 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 97.25 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 97.19 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 97.18 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.18 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 97.16 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 97.14 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 97.14 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.12 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 97.11 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.09 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 97.06 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 97.04 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 97.03 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 97.03 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 97.02 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 97.01 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 97.0 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 97.0 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.0 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 96.97 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 96.97 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 96.96 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 96.95 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.94 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.9 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.87 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.85 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 96.84 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 96.84 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.83 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.82 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 96.82 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.81 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.79 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.75 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 96.73 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 96.7 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.69 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 96.64 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 96.62 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.61 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 96.58 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.56 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 96.55 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.49 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 96.47 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 96.45 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 96.44 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 96.42 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.35 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 96.31 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 96.3 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 96.29 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 96.29 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 96.26 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.23 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 96.19 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 96.13 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.09 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 96.05 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 96.0 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 95.96 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 95.84 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 95.84 | |
| d1ofux_ | 119 | Hypothetical protein PA3008 {Pseudomonas aeruginos | 95.79 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 95.78 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 95.77 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 95.76 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 95.76 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.75 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 95.71 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 95.7 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 95.66 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 95.65 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 95.64 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 95.6 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 95.54 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 95.43 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.42 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 95.37 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 95.35 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 95.28 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 95.26 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 95.23 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 95.22 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 95.22 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 95.2 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 95.2 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 95.16 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 95.13 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 95.07 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 94.96 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 94.94 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 94.94 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 94.92 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 94.92 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 94.91 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 94.89 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 94.85 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.81 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 94.8 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 94.75 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 94.75 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 94.74 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 94.72 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 94.7 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 94.69 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 94.64 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 94.64 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 94.59 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 94.59 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 94.58 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 94.57 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 94.57 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 94.54 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 94.51 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 94.5 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 94.48 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 94.45 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 94.43 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 94.43 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 94.43 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 94.41 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 94.38 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 94.37 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 94.34 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 94.29 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 94.28 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 94.26 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 94.25 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 94.21 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 94.2 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 94.19 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 94.06 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 93.95 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 93.93 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 93.9 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 93.89 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 93.85 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 93.8 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 93.78 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 93.77 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 93.74 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 93.7 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 93.69 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 93.64 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 93.64 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 93.63 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 93.56 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 93.51 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 93.5 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 93.45 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 93.3 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 93.26 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 93.21 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 93.0 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 92.39 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 92.29 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 92.18 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 91.89 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 90.04 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 89.92 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 89.78 | |
| d1j3ba1 | 318 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 89.41 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 89.16 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 89.01 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 88.77 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 88.56 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 88.4 | |
| d1ii2a1 | 323 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 87.84 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 86.73 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 86.19 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 85.48 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 84.7 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 84.56 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 84.47 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 84.22 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 83.96 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 83.83 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 82.84 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 82.75 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 82.09 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 81.12 |
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: RecA protein, ATPase-domain species: Deinococcus radiodurans [TaxId: 1299]
Probab=100.00 E-value=3.2e-34 Score=245.33 Aligned_cols=198 Identities=47% Similarity=0.759 Sum_probs=170.4
Q ss_pred hHHHHHHHHHHHHHHHhcCCccccccccccCCCCCCccccCcHHHHHHhcCCCCCCCcEEEEEecCCCChHHHHHHHHHH
Q 024705 64 MQKDNALRLALSQLANDFGKESMLSLKRFFGSRRGPVISTGSLKLDLALGIGGLPKGRIVEIYGREASGKTTLALHVIKE 143 (264)
Q Consensus 64 ~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~i~tG~~~LD~~l~~gGl~~G~~~~I~G~~GsGKTtl~~~l~~~ 143 (264)
.++++.|..++.++.++||++..+.+.... ..+.+.+|||++.||.+||.||+|.|.+++|+||+|+|||+||++++.+
T Consensus 2 ~~~~~~~~~~~~~i~k~~g~~~~~~~~~~~-~~~~~~i~TGs~~lD~~Lg~GGip~g~itei~G~~~sGKT~l~l~~~~~ 80 (268)
T d1xp8a1 2 KERSKAIETAMSQIEKAFGKGSIMKLGAES-KLDVQVVSTGSLSLDLALGVGGIPRGRITEIYGPESGGKTTLALAIVAQ 80 (268)
T ss_dssp CHHHHHHHHHHHHHHHHHCTTSSCCTTSCC-CCCCCEECCSCHHHHHHTSSSSEETTSEEEEEESTTSSHHHHHHHHHHH
T ss_pred chHHHHHHHHHHHHHHHhCCcceEECCCcC-CCCCCeEcCCCHHHHHHhcCCCccCceEEEEecCCccchHHHHHHHHHH
Confidence 357888999999999999998876654433 3678899999999999996699999999999999999999999999999
Q ss_pred HhhcCCeEEEEecCCCCCHHHHHHcCCCccceeEeCCCCHHHHHHHHHHHhhcCCccEEEEcCccccccccccCCCcCCC
Q 024705 144 AQKLGGYCAYLDVENALDPSLAEAMGIDAENLLIAQPDSAENLLSVVDTLTKSGSIDVIVVDSVAALIPKCEIGVPINGM 223 (264)
Q Consensus 144 ~~~~g~~v~~~~~e~~~~~~~~~~~g~~~~~l~~~~~~~~ee~~~~i~~~~~~~~~~~vvIDsl~~~~~~~~~~~~~~~~ 223 (264)
+++.|+.|+|+|.|...++.+++++|++++++.+.++.+.|+.++.++.+++...++++||||+.+++++.+++++.++.
T Consensus 81 aqk~g~~v~yiDtE~~~~~~~a~~~Gvd~d~i~~~~~~~~E~~~~~~~~l~~~~~~~liIiDSi~al~~r~e~~~~~~~~ 160 (268)
T d1xp8a1 81 AQKAGGTCAFIDAEHALDPVYARALGVNTDELLVSQPDNGEQALEIMELLVRSGAIDVVVVDSVAALTPRAEIEGDMGDS 160 (268)
T ss_dssp HHHTTCCEEEEESSCCCCHHHHHHTTCCGGGCEEECCSSHHHHHHHHHHHHTTTCCSEEEEECTTTCCCSTTC-------
T ss_pred HHhCCCEEEEEECCccCCHHHHHHhCCCchhEEEEcCCCHHHHHHHHHHHHhcCCCcEEEEecccccccHHHHcccccch
Confidence 99999999999999999999999999999999999999999999999999988899999999999999888888876666
Q ss_pred CcHHHHHHHHHHHHHHHHHHhccCcEEEEEcccchHhhh
Q 024705 224 YSDAQSRIMTQALRKIHYSLCQSHTLIIFLNQVKVLLLK 262 (264)
Q Consensus 224 ~~~~q~r~i~~~L~~l~~~l~~~g~tVi~i~h~~~~~~~ 262 (264)
..+.+++.+...++++...+.++++++|++||++++...
T Consensus 161 ~~~~~a~~l~~~lr~l~~~~~~~~~~vi~tNQv~~~~g~ 199 (268)
T d1xp8a1 161 LPGLQARLMSQALRKLTAILSKTGTAAIFINQVREKIGV 199 (268)
T ss_dssp -CCHHHHHHHHHHHHHHHHHTTTCCEEEEEEEC------
T ss_pred hHHHHHHHHHHHHHHHHhhhhhcCCeEEEEeEEeecccc
Confidence 666788889999999999999999999999999988754
|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1ofux_ c.37.1.22 (X:) Hypothetical protein PA3008 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|