Citrus Sinensis ID: 025333

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MDWVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFSYEGSKILTEK
ccEEEccccccccccHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHcccEEEEccccccccHHHHHHHHHHcccccEEEcccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccc
cEEEEEEccccccccHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHcccEEEEcccEEcccHHHHHHHHHHcccccEEEEcccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHccc
MDWVCFIFRFVQERTPNWFSTLKEFFEItpaaavgeigldkgskgreidfmDQVGVFRQQLELAKelkrpasiHCVRAFGDLLEIMKsvgpfpdgviihsylgsaemvpelSKLGAYFSFSGFLMSMKAQKAKKMLKvvpserilletdapdalpkaelnslflvdgdpslpqelsakeehspnvgsasdnqfhaskdsstlpketlnhpanIHNVLDYVASLLDMTKEELAELSYRNAIRLFSYegskiltek
MDWVCFIFRfvqertpnWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELakelkrpasIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRnairlfsyegskiltek
MDWVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFSYEGSKILTEK
**WVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLE**************LFL**********************************************ANIHNVLDYVASLLDMTKEELAELSYRNAIRLFSYEG*******
MDWVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHS******SDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFSY**S******
MDWVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQEL************ASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFSYEGSKILTEK
MDWVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEE**********************PKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFSYEGSK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDWVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFSYEGSKILTEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
P37545255 Uncharacterized deoxyribo yes no 0.688 0.686 0.310 1e-17
Q148G4297 Putative deoxyribonucleas yes no 0.720 0.616 0.281 1e-14
Q93075761 Putative deoxyribonucleas yes no 0.503 0.168 0.401 3e-14
Q6P1N9297 Putative deoxyribonucleas no no 0.720 0.616 0.276 5e-14
Q6P8M1295 Putative deoxyribonucleas no no 0.720 0.620 0.276 2e-13
Q05AV0270 Putative deoxyribonucleas N/A no 0.645 0.607 0.271 4e-13
D8MKW4261 Tat-linked quality contro yes no 0.531 0.517 0.318 5e-13
E6WHK1260 Tat-linked quality contro yes no 0.531 0.519 0.311 3e-12
Q640V9297 Putative deoxyribonucleas N/A no 0.720 0.616 0.281 4e-12
P73335261 Uncharacterized deoxyribo N/A no 0.444 0.432 0.346 9e-12
>sp|P37545|YABD_BACSU Uncharacterized deoxyribonuclease YabD OS=Bacillus subtilis (strain 168) GN=yabD PE=3 SV=1 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 99/222 (44%), Gaps = 47/222 (21%)

Query: 22  LKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGD 81
           +KE        A+GE+GLD        D   Q  VFR Q+ LAKE+  P  IH   A  D
Sbjct: 78  IKELSAHEKVVAIGEMGLDYHWDKSPKDI--QKEVFRNQIALAKEVNLPIIIHNRDATED 135

Query: 82  LLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPS 141
           ++ I+K  G    G I+H + GSAE+  E  K+  Y SF G +    A+K K+++K +P+
Sbjct: 136 VVTILKEEGAEAVGGIMHCFTGSAEVARECMKMNFYLSFGGPVTFKNAKKPKEVVKEIPN 195

Query: 142 ERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSST 201
           +R+L+ETD P           FL       P     K                       
Sbjct: 196 DRLLIETDCP-----------FLT------PHPFRGKR---------------------- 216

Query: 202 LPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLF 243
                 N P+ +  V + +A L +MT EE+A ++  NA RLF
Sbjct: 217 ------NEPSYVKYVAEQIAELKEMTFEEIASITTENAKRLF 252
Putative deoxyribonuclease.
Bacillus subtilis (strain 168) (taxid: 224308)
EC: 3EC: .EC: 1EC: .EC: 2EC: 1EC: .EC: -
>sp|Q148G4|TATD1_BOVIN Putative deoxyribonuclease TATDN1 OS=Bos taurus GN=TATDN1 PE=2 SV=1 Back     alignment and function description
>sp|Q93075|TATD2_HUMAN Putative deoxyribonuclease TATDN2 OS=Homo sapiens GN=TATDN2 PE=1 SV=2 Back     alignment and function description
>sp|Q6P1N9|TATD1_HUMAN Putative deoxyribonuclease TATDN1 OS=Homo sapiens GN=TATDN1 PE=1 SV=2 Back     alignment and function description
>sp|Q6P8M1|TATD1_MOUSE Putative deoxyribonuclease TATDN1 OS=Mus musculus GN=Tatdn1 PE=2 SV=1 Back     alignment and function description
>sp|Q05AV0|TAT3A_XENLA Putative deoxyribonuclease tatdn3-A OS=Xenopus laevis GN=tatdn3-a PE=2 SV=1 Back     alignment and function description
>sp|D8MKW4|TATD_ERWBE Tat-linked quality control protein TatD OS=Erwinia billingiae (strain Eb661) GN=tatD PE=3 SV=1 Back     alignment and function description
>sp|E6WHK1|TATD_PANSA Tat-linked quality control protein TatD OS=Pantoea sp. (strain At-9b) GN=tatD PE=3 SV=1 Back     alignment and function description
>sp|Q640V9|TATD1_XENLA Putative deoxyribonuclease TATDN1 OS=Xenopus laevis GN=tatdn1 PE=2 SV=1 Back     alignment and function description
>sp|P73335|Y1786_SYNY3 Uncharacterized deoxyribonuclease sll1786 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1786 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
297807779325 hypothetical protein ARALYDRAFT_326186 [ 0.968 0.756 0.738 1e-103
18418353325 TatD related DNase [Arabidopsis thaliana 0.968 0.756 0.730 1e-100
224126133308 predicted protein [Populus trichocarpa] 0.956 0.788 0.726 3e-98
356559526311 PREDICTED: uncharacterized deoxyribonucl 0.972 0.794 0.710 2e-96
296090223293 unnamed protein product [Vitis vinifera] 0.972 0.843 0.698 4e-96
359489060314 PREDICTED: uncharacterized deoxyribonucl 0.972 0.786 0.698 5e-96
9755782318 putative protein [Arabidopsis thaliana] 0.940 0.751 0.710 7e-96
449432305314 PREDICTED: uncharacterized deoxyribonucl 0.933 0.754 0.735 7e-91
356561321295 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.972 0.837 0.674 1e-90
255566046274 deoxyribonuclease, putative [Ricinus com 0.846 0.784 0.724 3e-86
>gi|297807779|ref|XP_002871773.1| hypothetical protein ARALYDRAFT_326186 [Arabidopsis lyrata subsp. lyrata] gi|297317610|gb|EFH48032.1| hypothetical protein ARALYDRAFT_326186 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/252 (73%), Positives = 213/252 (84%), Gaps = 6/252 (2%)

Query: 5   CFIFR--FVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLE 62
           CF     +V ER+P WF TLK FFE TP AAVGEIGLDKGSKGREIDF DQV VFRQQLE
Sbjct: 60  CFGIHPWYVAERSPQWFETLKSFFETTPTAAVGEIGLDKGSKGREIDFSDQVTVFRQQLE 119

Query: 63  LAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSG 122
           LAKEL RPAS+HCVRAFGDLLEI+KSVGPFP GV++HSYLGSAE+VPE +KLGAYFSFSG
Sbjct: 120 LAKELNRPASVHCVRAFGDLLEILKSVGPFPSGVMLHSYLGSAEIVPEFAKLGAYFSFSG 179

Query: 123 FLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHS 182
           FLMSM  +KAKKMLK VPS+RILLETD+PDALPKAE  SL+ VDGDPSLP+E ++ ++  
Sbjct: 180 FLMSMSEKKAKKMLKAVPSDRILLETDSPDALPKAESGSLYFVDGDPSLPEEGNSAQD-- 237

Query: 183 PNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRL 242
             + SAS+++ + S DS+ LPKETLNHPANIH VL YVA LLDM  EELAELSY+NA+RL
Sbjct: 238 --LDSASNDKSNVSSDSTKLPKETLNHPANIHMVLGYVARLLDMKNEELAELSYQNAVRL 295

Query: 243 FSYEGSKILTEK 254
           FSYEGSK+L E+
Sbjct: 296 FSYEGSKMLLER 307

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|18418353|ref|NP_568352.1| TatD related DNase [Arabidopsis thaliana] gi|124301002|gb|ABN04753.1| At5g17570 [Arabidopsis thaliana] gi|332005061|gb|AED92444.1| TatD related DNase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224126133|ref|XP_002319763.1| predicted protein [Populus trichocarpa] gi|222858139|gb|EEE95686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356559526|ref|XP_003548050.1| PREDICTED: uncharacterized deoxyribonuclease sll1786-like [Glycine max] Back     alignment and taxonomy information
>gi|296090223|emb|CBI40042.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489060|ref|XP_002275929.2| PREDICTED: uncharacterized deoxyribonuclease YabD-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|9755782|emb|CAC01901.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449432305|ref|XP_004133940.1| PREDICTED: uncharacterized deoxyribonuclease YabD-like [Cucumis sativus] gi|449525820|ref|XP_004169914.1| PREDICTED: uncharacterized deoxyribonuclease YabD-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356561321|ref|XP_003548931.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized deoxyribonuclease sll1786-like [Glycine max] Back     alignment and taxonomy information
>gi|255566046|ref|XP_002524011.1| deoxyribonuclease, putative [Ricinus communis] gi|223536738|gb|EEF38379.1| deoxyribonuclease, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
TAIR|locus:2151406325 AT5G17570 "AT5G17570" [Arabido 0.948 0.741 0.742 9e-93
TAIR|locus:2099684272 AT3G03500 "AT3G03500" [Arabido 0.688 0.643 0.561 1.5e-49
TIGR_CMR|GSU_3287255 GSU_3287 "hydrolase, TatD fami 0.492 0.490 0.407 6.2e-24
TIGR_CMR|CPS_2305255 CPS_2305 "hydrolase, TatD fami 0.476 0.474 0.349 6.7e-19
UNIPROTKB|K7GLH4168 LOC100156175 "Uncharacterized 0.366 0.553 0.357 1.1e-17
TIGR_CMR|CBU_0502255 CBU_0502 "hydrolase, putative" 0.519 0.517 0.359 1.8e-17
UNIPROTKB|Q148G4297 TATDN1 "Putative deoxyribonucl 0.456 0.390 0.344 1.5e-16
UNIPROTKB|E2RRK7265 TATDN1 "Uncharacterized protei 0.456 0.437 0.352 2.1e-16
UNIPROTKB|I3LKU9297 TATDN1 "Uncharacterized protei 0.456 0.390 0.344 2.3e-16
DICTYBASE|DDB_G0285437322 DDB_G0285437 "Uncharacterized 0.519 0.409 0.342 5.4e-16
TAIR|locus:2151406 AT5G17570 "AT5G17570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 924 (330.3 bits), Expect = 9.0e-93, P = 9.0e-93
 Identities = 182/245 (74%), Positives = 208/245 (84%)

Query:    10 FVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKR 69
             +V ER+P WF TLK FFE TP AAVGEIGLDKGSKGREIDF +QV VFRQQLELAKELK+
Sbjct:    67 YVAERSPQWFETLKSFFETTPTAAVGEIGLDKGSKGREIDFSEQVTVFRQQLELAKELKK 126

Query:    70 PASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKA 129
             PAS+HCVRAFGDLLEI+KSVGPFP GV++HSYLGSAEMVPE +KLGAYFSFSGFLMSM  
Sbjct:   127 PASVHCVRAFGDLLEILKSVGPFPSGVMLHSYLGSAEMVPEFAKLGAYFSFSGFLMSMSE 186

Query:   130 QKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSAS 189
             +KAKKMLK VPS+RILLETD+PDALPKAE   L+ VDGDPSLP+E ++ ++    + SAS
Sbjct:   187 KKAKKMLKAVPSDRILLETDSPDALPKAESGCLYFVDGDPSLPEEGNSAQD----LDSAS 242

Query:   190 DNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFSYEGSK 249
              ++ + S DS  L KETLNHPANIH VL YVA LLDM  EELAELSY+NA+RLFSYEGSK
Sbjct:   243 YDKPNVSSDSMKLTKETLNHPANIHIVLGYVAQLLDMKNEELAELSYQNAVRLFSYEGSK 302

Query:   250 ILTEK 254
             IL ++
Sbjct:   303 ILLDR 307
GO:0004536 "deoxyribonuclease activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0016888 "endodeoxyribonuclease activity, producing 5'-phosphomonoesters" evidence=IEA
TAIR|locus:2099684 AT3G03500 "AT3G03500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3287 GSU_3287 "hydrolase, TatD family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2305 CPS_2305 "hydrolase, TatD family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|K7GLH4 LOC100156175 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0502 CBU_0502 "hydrolase, putative" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q148G4 TATDN1 "Putative deoxyribonuclease TATDN1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRK7 TATDN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LKU9 TATDN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285437 DDB_G0285437 "Uncharacterized protein YMR262W" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.21LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh1_pm.C_scaffold_6001406
annotation not avaliable (325 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
scaffold_502663.1
annotation not avaliable (615 aa)
•       0.512

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
pfam01026255 pfam01026, TatD_DNase, TatD related DNase 3e-51
cd01310251 cd01310, TatD_DNAse, TatD like proteins; E 1e-49
COG0084256 COG0084, TatD, Mg-dependent DNase [DNA replication 1e-42
TIGR00010252 TIGR00010, TIGR00010, hydrolase, TatD family 1e-34
PRK10812265 PRK10812, PRK10812, putative DNAse; Provisional 1e-13
COG1099254 COG1099, COG1099, Predicted metal-dependent hydrol 9e-11
PRK10425258 PRK10425, PRK10425, DNase TatD; Provisional 1e-10
PRK11449258 PRK11449, PRK11449, putative deoxyribonuclease Yjj 3e-09
>gnl|CDD|216250 pfam01026, TatD_DNase, TatD related DNase Back     alignment and domain information 
 Score =  167 bits (425), Expect = 3e-51
 Identities = 73/237 (30%), Positives = 103/237 (43%), Gaps = 48/237 (20%)

Query: 10  FVQERTPNWFSTLKEF--FEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKEL 67
              E +      L++    E     A+GEIGLD      E     Q  VFR+QLELAKEL
Sbjct: 65  EADEASEEVLEALEKLLLAEHPKVVAIGEIGLDYYYV-DESPKEAQEEVFRRQLELAKEL 123

Query: 68  KRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSM 127
             P  IH   A  DLLEI+K  G     V++H + GS E   E+  LG Y S SG +   
Sbjct: 124 DLPVVIHTRDAEEDLLEILKEAGAPGLRVVLHCFTGSLETAKEILDLGFYISISGIVTFK 183

Query: 128 KAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGS 187
            A+K ++++  +P +R+L+ETDAP   P                           P  G 
Sbjct: 184 NAKKLREVVAEIPLDRLLVETDAPYLAPV--------------------------PYRGK 217

Query: 188 ASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFS 244
                               N PA +  V + +A L  +++EE+A+++  NA RLF 
Sbjct: 218 R-------------------NEPAYVPYVAEKLAELKGISEEEVAKITTENAKRLFG 255

This family of proteins are related to a large superfamily of metalloenzymes. TatD, a member of this family has been shown experimentally to be a DNase enzyme. Length = 255
>gnl|CDD|238635 cd01310, TatD_DNAse, TatD like proteins; E Back     alignment and domain information
>gnl|CDD|223162 COG0084, TatD, Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|232780 TIGR00010, TIGR00010, hydrolase, TatD family Back     alignment and domain information
>gnl|CDD|236767 PRK10812, PRK10812, putative DNAse; Provisional Back     alignment and domain information
>gnl|CDD|224024 COG1099, COG1099, Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|182449 PRK10425, PRK10425, DNase TatD; Provisional Back     alignment and domain information
>gnl|CDD|171118 PRK11449, PRK11449, putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
COG0084256 TatD Mg-dependent DNase [DNA replication, recombin 100.0
PRK10425258 DNase TatD; Provisional 100.0
PRK10812265 putative DNAse; Provisional 100.0
PRK11449258 putative deoxyribonuclease YjjV; Provisional 100.0
PF01026255 TatD_DNase: TatD related DNase The Pfam entry find 100.0
KOG3020296 consensus TatD-related DNase [Replication, recombi 100.0
TIGR00010252 hydrolase, TatD family. Several genomes have multi 100.0
cd01310251 TatD_DNAse TatD like proteins; E.coli TatD is a cy 100.0
cd00530293 PTE Phosphotriesterase (PTE) catalyzes the hydroly 99.98
COG1099254 Predicted metal-dependent hydrolases with the TIM- 99.97
COG1831285 Predicted metal-dependent hydrolase (urease superf 99.85
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. 99.74
PRK09875292 putative hydrolase; Provisional 99.61
cd01295 422 AdeC Adenine deaminase (AdeC) directly deaminates 99.43
cd01307338 Met_dep_hydrolase_B Metallo-dependent hydrolases, 99.38
PF04909273 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 99.2
PF02126308 PTE: Phosphotriesterase family; InterPro: IPR00155 99.08
PRK09237380 dihydroorotase; Provisional 99.07
COG2159293 Predicted metal-dependent hydrolase of the TIM-bar 99.01
cd01292275 metallo-dependent_hydrolases Superfamily of metall 98.93
COG1735316 Php Predicted metal-dependent hydrolase with the T 98.79
cd01311263 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) 98.35
TIGR01975389 isoAsp_dipep isoaspartyl dipeptidase IadA. The L-i 98.26
COG3964386 Predicted amidohydrolase [General function predict 98.01
PRK12394379 putative metallo-dependent hydrolase; Provisional 97.95
PRK10657388 isoaspartyl dipeptidase; Provisional 97.93
cd01297415 D-aminoacylase D-aminoacylases (N-acyl-D-Amino aci 97.87
TIGR01178 552 ade adenine deaminase. The family described by thi 97.82
TIGR01430324 aden_deam adenosine deaminase. This family include 97.72
TIGR02967401 guan_deamin guanine deaminase. This model describe 97.61
cd01312381 Met_dep_hydrolase_D Metallo-dependent hydrolases, 97.61
cd01293398 Bact_CD Bacterial cytosine deaminase and related m 97.58
PRK09228433 guanine deaminase; Provisional 97.56
PRK07213375 chlorohydrolase; Provisional 97.53
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 97.5
COG2355313 Zn-dependent dipeptidase, microsomal dipeptidase h 97.48
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hy 97.44
PRK09045443 N-ethylammeline chlorohydrolase; Provisional 97.41
cd01309359 Met_dep_hydrolase_C Metallo-dependent hydrolases, 97.38
cd01320325 ADA Adenosine deaminase (ADA) is a monomeric zinc 97.36
COG3618279 Predicted metal-dependent hydrolase of the TIM-bar 97.32
PRK08203451 hydroxydechloroatrazine ethylaminohydrolase; Revie 97.29
PRK06687419 chlorohydrolase; Validated 97.27
PRK08204449 hypothetical protein; Provisional 97.25
PRK07583438 cytosine deaminase-like protein; Validated 97.24
PRK09358340 adenosine deaminase; Provisional 97.22
cd01298411 ATZ_TRZ_like TRZ/ATZ family contains enzymes from 97.19
cd01296371 Imidazolone-5PH Imidazolonepropionase/imidazolone- 97.19
cd01300479 YtcJ_like YtcJ_like metal dependent amidohydrolase 97.18
PLN02942486 dihydropyrimidinase 97.14
PRK07228445 N-ethylammeline chlorohydrolase; Provisional 97.11
PRK07572426 cytosine deaminase; Validated 97.11
cd01305263 archeal_chlorohydrolases Predicted chlorohydrolase 97.08
PF01244320 Peptidase_M19: Membrane dipeptidase (Peptidase fam 97.04
PRK15493435 5-methylthioadenosine/S-adenosylhomocysteine deami 96.98
PRK06380418 metal-dependent hydrolase; Provisional 96.95
PRK10027 588 cryptic adenine deaminase; Provisional 96.95
PRK06038430 N-ethylammeline chlorohydrolase; Provisional 96.95
PRK09356406 imidazolonepropionase; Validated 96.95
PLN02795505 allantoinase 96.9
PRK08393424 N-ethylammeline chlorohydrolase; Provisional 96.89
cd01303429 GDEase Guanine deaminase (GDEase). Guanine deamina 96.87
PRK12393457 amidohydrolase; Provisional 96.86
cd01294335 DHOase Dihydroorotase (DHOase) catalyzes the rever 96.84
cd01313418 Met_dep_hydrolase_E Metallo-dependent hydrolases, 96.79
PRK06886329 hypothetical protein; Validated 96.68
cd01301309 rDP_like renal dipeptidase (rDP), best studied in 96.64
TIGR01224377 hutI imidazolonepropionase. This enzyme catalyzes 96.61
PF07969404 Amidohydro_3: Amidohydrolase family; InterPro: IPR 96.6
PRK09061 509 D-glutamate deacylase; Validated 96.57
PRK06846410 putative deaminase; Validated 96.53
PRK06151488 N-ethylammeline chlorohydrolase; Provisional 96.51
PRK08418408 chlorohydrolase; Provisional 96.35
cd01304541 FMDH_A Formylmethanofuran dehydrogenase (FMDH) sub 96.22
PTZ00124362 adenosine deaminase; Provisional 96.21
COG1001 584 AdeC Adenine deaminase [Nucleotide transport and m 96.18
PRK09230426 cytosine deaminase; Provisional 96.11
PRK14085382 imidazolonepropionase; Provisional 96.1
cd01306325 PhnM PhnM is believed to be a subunit of the membr 96.09
PRK07203442 putative chlorohydrolase/aminohydrolase; Validated 96.01
cd01315447 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinas 95.97
PRK05985391 cytosine deaminase; Provisional 95.94
PRK09229456 N-formimino-L-glutamate deiminase; Validated 95.68
PRK15446383 phosphonate metabolism protein PhnM; Provisional 95.63
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, inc 95.54
COG1574535 Predicted metal-dependent hydrolase with the TIM-b 95.48
COG0418344 PyrC Dihydroorotase [Nucleotide transport and meta 95.22
cd00443305 ADA_AMPD Adenosine/AMP deaminase. Adenosine deamin 95.08
TIGR02022455 hutF formiminoglutamate deiminase. In some species 95.03
PLN02599364 dihydroorotase 94.91
TIGR02318376 phosphono_phnM phosphonate metabolism protein PhnM 94.9
PRK07369418 dihydroorotase; Provisional 94.87
cd01317374 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; 94.62
PRK05451345 dihydroorotase; Provisional 94.32
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, 94.3
TIGR02033454 D-hydantoinase D-hydantoinase. This model represen 94.05
PRK09357423 pyrC dihydroorotase; Validated 93.95
COG1228406 HutI Imidazolonepropionase and related amidohydrol 93.86
PRK08417386 dihydroorotase; Provisional 93.79
cd01321345 ADGF Adenosine deaminase-related growth factors (A 93.76
TIGR03314441 Se_ssnA putative selenium metabolism protein SsnA. 93.74
PF00962331 A_deaminase: Adenosine/AMP deaminase immunodeficie 93.72
TIGR00857411 pyrC_multi dihydroorotase, multifunctional complex 93.66
TIGR03178443 allantoinase allantoinase. This enzyme carries out 93.26
PRK11170382 nagA N-acetylglucosamine-6-phosphate deacetylase; 93.2
PRK08323459 phenylhydantoinase; Validated 93.02
COG0402421 SsnA Cytosine deaminase and related metal-dependen 92.49
KOG4245297 consensus Predicted metal-dependent hydrolase of t 92.47
PRK08044449 allantoinase; Provisional 92.05
PRK13404477 dihydropyrimidinase; Provisional 91.84
cd01314447 D-HYD D-hydantoinases (D-HYD) also called dihydrop 91.6
TIGR00221380 nagA N-acetylglucosamine-6-phosphate deacetylase. 91.32
TIGR00856341 pyrC_dimer dihydroorotase, homodimeric type. This 90.95
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 90.17
PRK09236444 dihydroorotase; Reviewed 90.14
PRK06189451 allantoinase; Provisional 89.69
TIGR03121556 one_C_dehyd_A formylmethanofuran dehydrogenase sub 89.35
PRK09059429 dihydroorotase; Validated 89.32
PRK07575438 dihydroorotase; Provisional 88.7
PRK07627425 dihydroorotase; Provisional 87.58
cd01318361 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; 87.31
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 86.61
PRK06361212 hypothetical protein; Provisional 85.62
PRK09060444 dihydroorotase; Validated 82.65
PRK02382443 dihydroorotase; Provisional 81.64
TIGR01431479 adm_rel adenosine deaminase-related growth factor. 81.32
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information 
Probab=100.00  E-value=8.1e-56  Score=392.85  Aligned_cols=197  Identities=38%  Similarity=0.483  Sum_probs=182.5

Q ss_pred             ceeeccccccccCChhHHHHHHHHhhc-CCceEEEeecCCCCCCCCCCCHHHHHHHHHHHHHHHHhcCCceEEeccchHH
Q 025333            2 DWVCFIFRFVQERTPNWFSTLKEFFEI-TPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFG   80 (254)
Q Consensus         2 ~~~G~HP~~~~~~~~~~l~~l~~ll~~-~~~~aIGEiGLD~~~~~~~~~~~~Q~~vf~~ql~lA~~~~lPvilH~~~a~~   80 (254)
                      .++|+||++..+..++.++.|.+++.+ ++++|||||||||++.... .++.|+++|++||++|+++++||+||+|+|++
T Consensus        59 ~~~G~HP~~~~~~~~~~~~~l~~~~~~~~~vvaIGEiGLDy~~~~~~-~~~~Q~~~F~~ql~lA~~~~lPviIH~R~A~~  137 (256)
T COG0084          59 AAVGVHPLDADEHSEEDLEELEQLAEHHPKVVAIGEIGLDYYWDKEP-DKERQEEVFEAQLELAKELNLPVIIHTRDAHE  137 (256)
T ss_pred             EEEeeCCCccccccHHHHHHHHHHHhcCCCeEEEEecccCccccccc-cHHHHHHHHHHHHHHHHHcCCCEEEEccccHH
Confidence            368999999445568889999999985 8999999999999985322 68899999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCCCcEEEEeCCCCHHHHHHHHHCCcEEeecccccccchHHHHHHHHhCCCCcEEEecCCCCCCchhhhh
Q 025333           81 DLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELN  160 (254)
Q Consensus        81 ~~l~il~~~~~~~~~~IiH~fsg~~e~~~~~l~~G~y~s~~~~~~~~~~~~~~~~l~~ip~driLlETD~P~~~p~~~~~  160 (254)
                      +++++|++.+. +.++|+|||||+.+++++++++|+||||||.+|+.+..+++++++.+|+||||+|||+||+.|.|++ 
T Consensus       138 d~~~iL~~~~~-~~~gi~HcFsGs~e~a~~~~d~G~yisisG~itfk~a~~~~ev~~~iPldrLL~ETDsPyl~P~p~r-  215 (256)
T COG0084         138 DTLEILKEEGA-PVGGVLHCFSGSAEEARKLLDLGFYISISGIVTFKNAEKLREVARELPLDRLLLETDAPYLAPVPYR-  215 (256)
T ss_pred             HHHHHHHhcCC-CCCEEEEccCCCHHHHHHHHHcCeEEEECceeecCCcHHHHHHHHhCCHhHeEeccCCCCCCCcCCC-
Confidence            99999999874 4679999999999999999999999999999999888999999999999999999999999998765 


Q ss_pred             cccccCCCCCCcccccccccCCCCCCCCCccccccCCCCCCCCCCCCCCcccHHHHHHHHHhccCCCHHHHHHHHHHHHH
Q 025333          161 SLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAI  240 (254)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~neP~~l~~v~~~lA~i~~~~~eev~~~~~~N~~  240 (254)
                                                         |         ++|+|+++..|++.||+++|+++++|++++++|++
T Consensus       216 -----------------------------------G---------krNeP~~v~~v~~~iAelk~~~~eeva~~t~~N~~  251 (256)
T COG0084         216 -----------------------------------G---------KRNEPAYVRHVAEKLAELKGISAEEVAEITTENAK  251 (256)
T ss_pred             -----------------------------------C---------CCCCchHHHHHHHHHHHHhCCCHHHHHHHHHHHHH
Confidence                                               4         89999999999999999999999999999999999


Q ss_pred             HhcCC
Q 025333          241 RLFSY  245 (254)
Q Consensus       241 ~~f~~  245 (254)
                      ++|++
T Consensus       252 ~lf~~  256 (256)
T COG0084         252 RLFGL  256 (256)
T ss_pred             HHhcC
Confidence            99985

>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>PRK10812 putative DNAse; Provisional Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>PF01026 TatD_DNase: TatD related DNase The Pfam entry finds members not in the Prosite definition Back     alignment and domain information
>KOG3020 consensus TatD-related DNase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00010 hydrolase, TatD family Back     alignment and domain information
>cd01310 TatD_DNAse TatD like proteins; E Back     alignment and domain information
>cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon Back     alignment and domain information
>COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>COG1831 Predicted metal-dependent hydrolase (urease superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PF04909 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 These proteins are related to the metal-dependent hydrolase superfamily [] Back     alignment and domain information
>PF02126 PTE: Phosphotriesterase family; InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3 Back     alignment and domain information
>PRK09237 dihydroorotase; Provisional Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd01311 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM) Back     alignment and domain information
>TIGR01975 isoAsp_dipep isoaspartyl dipeptidase IadA Back     alignment and domain information
>COG3964 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>PRK12394 putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>PRK10657 isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics Back     alignment and domain information
>TIGR01178 ade adenine deaminase Back     alignment and domain information
>TIGR01430 aden_deam adenosine deaminase Back     alignment and domain information
>TIGR02967 guan_deamin guanine deaminase Back     alignment and domain information
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases Back     alignment and domain information
>PRK09228 guanine deaminase; Provisional Back     alignment and domain information
>PRK07213 chlorohydrolase; Provisional Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>COG2355 Zn-dependent dipeptidase, microsomal dipeptidase homolog [Amino acid transport and metabolism] Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>PRK09045 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively Back     alignment and domain information
>COG3618 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>PRK06687 chlorohydrolase; Validated Back     alignment and domain information
>PRK08204 hypothetical protein; Provisional Back     alignment and domain information
>PRK07583 cytosine deaminase-like protein; Validated Back     alignment and domain information
>PRK09358 adenosine deaminase; Provisional Back     alignment and domain information
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>PLN02942 dihydropyrimidinase Back     alignment and domain information
>PRK07228 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK07572 cytosine deaminase; Validated Back     alignment and domain information
>cd01305 archeal_chlorohydrolases Predicted chlorohydrolases Back     alignment and domain information
>PF01244 Peptidase_M19: Membrane dipeptidase (Peptidase family M19); InterPro: IPR008257 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK15493 5-methylthioadenosine/S-adenosylhomocysteine deaminase; Provisional Back     alignment and domain information
>PRK06380 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK10027 cryptic adenine deaminase; Provisional Back     alignment and domain information
>PRK06038 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK09356 imidazolonepropionase; Validated Back     alignment and domain information
>PLN02795 allantoinase Back     alignment and domain information
>PRK08393 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd01303 GDEase Guanine deaminase (GDEase) Back     alignment and domain information
>PRK12393 amidohydrolase; Provisional Back     alignment and domain information
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK06886 hypothetical protein; Validated Back     alignment and domain information
>cd01301 rDP_like renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipeptidase, is a membrane-bound glycoprotein hydrolyzing dipeptides and is involved in hydrolytic metabolism of penem and carbapenem beta-lactam antibiotics Back     alignment and domain information
>TIGR01224 hutI imidazolonepropionase Back     alignment and domain information
>PF07969 Amidohydro_3: Amidohydrolase family; InterPro: IPR013108 Amidohydrolases are a diverse superfamily of enzymes which catalyse the hydrolysis of amide or amine bonds in a large number of different substrates including urea, cytosine, AMP, formylmethanofuran, etc [, ] Back     alignment and domain information
>PRK09061 D-glutamate deacylase; Validated Back     alignment and domain information
>PRK06846 putative deaminase; Validated Back     alignment and domain information
>PRK06151 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK08418 chlorohydrolase; Provisional Back     alignment and domain information
>cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A; Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor Back     alignment and domain information
>PTZ00124 adenosine deaminase; Provisional Back     alignment and domain information
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09230 cytosine deaminase; Provisional Back     alignment and domain information
>PRK14085 imidazolonepropionase; Provisional Back     alignment and domain information
>cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex Back     alignment and domain information
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>PRK05985 cytosine deaminase; Provisional Back     alignment and domain information
>PRK09229 N-formimino-L-glutamate deiminase; Validated Back     alignment and domain information
>PRK15446 phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>COG0418 PyrC Dihydroorotase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00443 ADA_AMPD Adenosine/AMP deaminase Back     alignment and domain information
>TIGR02022 hutF formiminoglutamate deiminase Back     alignment and domain information
>PLN02599 dihydroorotase Back     alignment and domain information
>TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM Back     alignment and domain information
>PRK07369 dihydroorotase; Provisional Back     alignment and domain information
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PRK05451 dihydroorotase; Provisional Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>TIGR02033 D-hydantoinase D-hydantoinase Back     alignment and domain information
>PRK09357 pyrC dihydroorotase; Validated Back     alignment and domain information
>COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08417 dihydroorotase; Provisional Back     alignment and domain information
>cd01321 ADGF Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase Back     alignment and domain information
>TIGR03314 Se_ssnA putative selenium metabolism protein SsnA Back     alignment and domain information
>PF00962 A_deaminase: Adenosine/AMP deaminase immunodeficiency disease (SCID); InterPro: IPR001365 Adenosine deaminase (3 Back     alignment and domain information
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type Back     alignment and domain information
>TIGR03178 allantoinase allantoinase Back     alignment and domain information
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>PRK08323 phenylhydantoinase; Validated Back     alignment and domain information
>COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG4245 consensus Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK08044 allantoinase; Provisional Back     alignment and domain information
>PRK13404 dihydropyrimidinase; Provisional Back     alignment and domain information
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>TIGR00221 nagA N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>TIGR00856 pyrC_dimer dihydroorotase, homodimeric type Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK09236 dihydroorotase; Reviewed Back     alignment and domain information
>PRK06189 allantoinase; Provisional Back     alignment and domain information
>TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A Back     alignment and domain information
>PRK09059 dihydroorotase; Validated Back     alignment and domain information
>PRK07575 dihydroorotase; Provisional Back     alignment and domain information
>PRK07627 dihydroorotase; Provisional Back     alignment and domain information
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK06361 hypothetical protein; Provisional Back     alignment and domain information
>PRK09060 dihydroorotase; Validated Back     alignment and domain information
>PRK02382 dihydroorotase; Provisional Back     alignment and domain information
>TIGR01431 adm_rel adenosine deaminase-related growth factor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
2xio_A301 Structure Of Putative Deoxyribonuclease Tatdn1 Isof 2e-14
1yix_A265 Crystal Structure Of Ycfh, Tatd Homolog From Escher 1e-12
2gzx_A265 Crystal Structure Of The Tatd Deoxyribonuclease Mw0 9e-12
1xwy_A264 Crystal Structure Of Tatd Deoxyribonuclease From Es 7e-10
1zzm_A259 Crystal Structure Of Yjjv, Tatd Homolog From Escher 1e-09
3gg7_A254 Crystal Structure Of An Uncharacterized Metalloprot 9e-09
2y1h_A272 Crystal Structure Of The Human Tatd-Domain Protein 2e-08
1j6o_A268 Crystal Structure Of Tatd-related Deoxyribonuclease 2e-07
3rcm_A287 Crystal Structure Of Efi Target 500140:tatd Family 2e-06
3ipw_A325 Crystal Structure Of Hydrolase Tatd Family Protein 1e-05
3e2v_A401 Crystal Structure Of An Uncharacterized Amidohydrol 5e-04
>pdb|2XIO|A Chain A, Structure Of Putative Deoxyribonuclease Tatdn1 Isoform A Length = 301 Back     alignment and structure 
Iteration: 1

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 98/217 (45%), Gaps = 34/217 (15%)
Query: 31  AAAVGEIGLDKGSKGREIDFM---DQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMK 87
             A+GE GLD       + F     Q+  F +Q EL+++ K P  +HC  +  + L+I K
Sbjct: 104 VVAIGECGLDFD----RLQFCPKDTQLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDITK 159
Query: 88  SVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLE 147
                  G ++HS+ G+ E    L  L  Y  F+G   S+K +   ++LK +PSE++++E
Sbjct: 160 RNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNG--CSLKTEANLEVLKSIPSEKLMIE 217
Query: 148 TDAP-DALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKET 206
           TDAP   +      S ++    P+  +  S                 H  KD        
Sbjct: 218 TDAPWCGVKSTHAGSKYIRTAFPTKKKWESG----------------HCLKDR------- 254
Query: 207 LNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLF 243
            N P +I  +L+ ++++ D    ELA   Y N I++F
Sbjct: 255 -NEPCHIIQILEIMSAVRDEDPLELANTLYNNTIKVF 290
>pdb|1YIX|A Chain A, Crystal Structure Of Ycfh, Tatd Homolog From Escherichia Coli K12, At 1.9 A Resolution Length = 265 Back     alignment and structure
>pdb|2GZX|A Chain A, Crystal Structure Of The Tatd Deoxyribonuclease Mw0446 From Staphylococcus Aureus. Northeast Structural Genomics Consortium Target Zr237. Length = 265 Back     alignment and structure
>pdb|1XWY|A Chain A, Crystal Structure Of Tatd Deoxyribonuclease From Escherichia Coli K12 At 2.0 A Resolution Length = 264 Back     alignment and structure
>pdb|1ZZM|A Chain A, Crystal Structure Of Yjjv, Tatd Homolog From Escherichia Coli K12, At 1.8 A Resolution Length = 259 Back     alignment and structure
>pdb|3GG7|A Chain A, Crystal Structure Of An Uncharacterized Metalloprotein From Deinococcus Radiodurans Length = 254 Back     alignment and structure
>pdb|2Y1H|A Chain A, Crystal Structure Of The Human Tatd-Domain Protein 3 (Tatdn3) Length = 272 Back     alignment and structure
>pdb|1J6O|A Chain A, Crystal Structure Of Tatd-related Deoxyribonuclease (tm0667) From Thermotoga Maritima At 1.8 A Resolution Length = 268 Back     alignment and structure
>pdb|3RCM|A Chain A, Crystal Structure Of Efi Target 500140:tatd Family Hydrolase From Pseudomonas Putida Length = 287 Back     alignment and structure
>pdb|3IPW|A Chain A, Crystal Structure Of Hydrolase Tatd Family Protein From Entamoeba Histolytica Length = 325 Back     alignment and structure
>pdb|3E2V|A Chain A, Crystal Structure Of An Uncharacterized Amidohydrolase From Saccharomyces Cerevisiae Length = 401 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
2xio_A301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19 5e-41
3rcm_A287 TATD family hydrolase; HET: CIT; 2.05A {Pseudomona 8e-40
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, z 4e-39
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seat 2e-38
2y1h_A272 Putative deoxyribonuclease tatdn3; hydrolase; 2.50 7e-38
3e2v_A401 3'-5'-exonuclease; structural genomics, hydrolase, 3e-35
3gg7_A254 Uncharacterized metalloprotein; structural genomic 5e-33
3guw_A261 Uncharacterized protein AF_1765; alpha-beta protei 1e-32
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, 2e-32
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, 2e-06
1j6o_A268 TATD-related deoxyribonuclease; structural genomic 5e-32
1j6o_A268 TATD-related deoxyribonuclease; structural genomic 2e-06
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NE 4e-31
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NE 2e-06
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW 4e-30
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW 5e-06
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promis 1e-08
1bf6_A291 Phosphotriesterase homology protein; hypothetical 8e-07
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protei 2e-06
3ojg_A330 Phosphotriesterase; (beta/alpha)8 barrel, lactonas 7e-05
3pnz_A330 Phosphotriesterase family protein; amidohydrolase 2e-04
3gtx_A339 Organophosphorus hydrolase; mutant, amidohydrolase 8e-04
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Length = 301 Back     alignment and structure
 Score =  141 bits (358), Expect = 5e-41
 Identities = 55/214 (25%), Positives = 95/214 (44%), Gaps = 32/214 (14%)

Query: 33  AVGEIGLD---KGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMKSV 89
           A+GE GLD        ++     Q+  F +Q EL+++ K P  +HC  +  + L+I K  
Sbjct: 106 AIGECGLDFDRLQFCPKDT----QLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDITKRN 161

Query: 90  GPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETD 149
                G ++HS+ G+ E    L  L  Y  F+G   S+K +   ++LK +PSE++++ETD
Sbjct: 162 RDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNG--CSLKTEANLEVLKSIPSEKLMIETD 219

Query: 150 APDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNH 209
           AP           +         +   A  ++               K  S    +  N 
Sbjct: 220 AP-----------WC------GVKSTHAGSKY------IRTAFPTKKKWESGHCLKDRNE 256

Query: 210 PANIHNVLDYVASLLDMTKEELAELSYRNAIRLF 243
           P +I  +L+ ++++ D    ELA   Y N I++F
Sbjct: 257 PCHIIQILEIMSAVRDEDPLELANTLYNNTIKVF 290
>3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} Length = 287 Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Length = 264 Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Length = 325 Back     alignment and structure
>2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens} Length = 272 Back     alignment and structure
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein initiative, NEW YORK SGX research center for structural GEN nysgxrc; 1.50A {Saccharomyces cerevisiae} Length = 401 Back     alignment and structure
>3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} Length = 254 Back     alignment and structure
>3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Length = 261 Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Length = 259 Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Length = 259 Back     alignment and structure
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Length = 268 Back     alignment and structure
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Length = 268 Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Length = 265 Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Length = 265 Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Length = 265 Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Length = 265 Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Length = 314 Back     alignment and structure
>1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Length = 291 Back     alignment and structure
>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Length = 363 Back     alignment and structure
>3ojg_A Phosphotriesterase; (beta/alpha)8 barrel, lactonase, hydrolase; HET: KCX HL4; 1.60A {Geobacillus kaustophilus} PDB: 3orw_A* 3f4c_A* 3f4d_A* Length = 330 Back     alignment and structure
>3pnz_A Phosphotriesterase family protein; amidohydrolase fold; HET: KCX; 1.60A {Listeria monocytogenes serotype 4b strorganism_taxid} Length = 330 Back     alignment and structure
>3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* Length = 339 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seat 100.0
3rcm_A287 TATD family hydrolase; HET: CIT; 2.05A {Pseudomona 100.0
3gg7_A254 Uncharacterized metalloprotein; structural genomic 100.0
3e2v_A401 3'-5'-exonuclease; structural genomics, hydrolase, 100.0
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, z 100.0
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, 100.0
2xio_A301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19 100.0
1j6o_A268 TATD-related deoxyribonuclease; structural genomic 100.0
2y1h_A272 Putative deoxyribonuclease tatdn3; hydrolase; 2.50 100.0
3guw_A261 Uncharacterized protein AF_1765; alpha-beta protei 100.0
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW 100.0
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NE 100.0
2ob3_A330 Parathion hydrolase; metalloenzyme, TIM barrel, ne 100.0
3rhg_A365 Putative phophotriesterase; hydrolase, amidohydrol 100.0
3k2g_A364 Resiniferatoxin-binding, phosphotriesterase- relat 100.0
3gtx_A339 Organophosphorus hydrolase; mutant, amidohydrolase 99.97
1bf6_A291 Phosphotriesterase homology protein; hypothetical 99.96
3pnz_A330 Phosphotriesterase family protein; amidohydrolase 99.96
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promis 99.96
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protei 99.96
3tn4_A360 Phosphotriesterase; lactonase, hydrolase; HET: KCX 99.92
3cjp_A272 Predicted amidohydrolase, dihydroorotase family; s 99.91
2f6k_A307 Metal-dependent hydrolase; metal dependent hydroly 99.84
4i6k_A294 Amidohydrolase family protein; enzyme function ini 99.84
2ffi_A288 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; 99.83
3irs_A291 Uncharacterized protein BB4693; structural genomic 99.82
2dvt_A327 Thermophilic reversible gamma-resorcylate decarbo; 99.82
2gwg_A350 4-oxalomesaconate hydratase; TIM-barrel like prote 99.78
2wm1_A336 2-amino-3-carboxymuconate-6-semialdehyde decarboxy 99.65
4do7_A303 Amidohydrolase 2; enzyme function initiative, EFI, 99.6
2hbv_A334 2-amino-3-carboxymuconate 6-semialdehyde decarbox; 99.54
2qpx_A376 Predicted metal-dependent hydrolase of the TIM-BA; 99.45
3nqb_A 608 Adenine deaminase 2; PSI-II, structural genomics, 99.41
3nur_A357 Amidohydrolase; TIM barrel; 1.75A {Staphylococcus 99.3
2ics_A379 Adenine deaminase; TIM barrel, binuclear zinc, ade 99.25
4inf_A373 Metal-dependent hydrolase; amidohydrolase, metal b 99.2
3ij6_A312 Uncharacterized metal-dependent hydrolase; structu 99.12
3hm7_A448 Allantoinase; metallo-dependent hydrolase, protein 98.99
4f0r_A447 5-methylthioadenosine/S-adenosylhomocysteine DEAM; 98.83
2vun_A386 Enamidase; nicotinate degradation, binuclear metal 98.69
3ooq_A396 Amidohydrolase; structural genomics, protein struc 98.64
2z00_A426 Dihydroorotase; zinc binding protein, hydrolase, m 98.49
4dzi_A423 Putative TIM-barrel metal-dependent hydrolase; ami 98.49
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 98.38
4d9a_A303 2-pyrone-4,6-dicarbaxylate hydrolase; structural g 98.37
3lnp_A468 Amidohydrolase family protein OLEI01672_1_465; TIM 98.17
2qt3_A403 N-isopropylammelide isopropyl amidohydrolase; N-is 98.1
3be7_A408 Zn-dependent arginine carboxypeptidase; unknown so 98.06
2ogj_A417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 98.04
3feq_A423 Putative amidohydrolase; unknown source, sargasso 97.98
3mpg_A428 Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus 97.94
3h4u_A479 Amidohydrolase; signature of Zn ligands, structura 97.86
4dyk_A451 Amidohydrolase; adenosine deaminase, nysgrc, struc 97.82
4dzh_A472 Amidohydrolase; adenosine deaminase, nysgrc, struc 97.81
2r8c_A426 Putative amidohydrolase; unknown source, sargasso 97.74
2qs8_A418 XAA-Pro dipeptidase; amidohydrolase, TIM barrel, p 97.65
3ls9_A456 Triazine hydrolase; atrazine chlorohydrolase TRZN; 97.64
2q09_A416 Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio 97.56
3sfw_A461 Dihydropyrimidinase; hydrolase, zinc binding; HET: 97.38
2i5g_A325 Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, stru 97.32
2vm8_A 501 Dihydropyrimidinase-related protein 2; neurogenesi 97.27
4aql_A476 Guanine deaminase; hydrolase, purine metabolism; H 97.12
2p9b_A458 Possible prolidase; protein structure initiative I 97.07
1gkr_A458 Hydantoinase, non-ATP dependent L-selective hydant 97.07
2puz_A419 Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino 97.03
3icj_A534 Uncharacterized metal-dependent hydrolase; structu 97.03
2imr_A420 Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, 96.96
2ftw_A 521 Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba 96.93
2i9u_A439 Cytosine/guanine deaminase related protein; protei 96.9
2ood_A475 BLR3880 protein; PSI-II, PSI-2, guanine deaminase, 96.88
2z26_A347 Dihydroorotase, dhoase; TIM barrel, hydrolase; HET 96.75
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 96.7
1gkp_A458 Hydantoinase; hydrolase, dihydropyrimidinase, cycl 96.69
3gri_A424 Dihydroorotase, dhoase; hydrolase, IDP00795, metal 96.65
1itu_A369 Renal dipeptidase; glycoprotein, membrane-bound, z 96.64
2bb0_A421 Imidazolonepropionase; TIM barrel, hydrolase; 2.00 96.54
3pao_A326 Adenosine deaminase; structural genomics, PSI-2, p 96.51
1ra0_A430 Cytosine deaminase; alpha-beta barrel, hexamer, co 96.45
2pgf_A371 Adenosine deaminase; metallo-dependent hydrolase, 96.36
3rys_A343 Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2 96.32
2paj_A492 Putative cytosine/guanine deaminase; NYSGXRC, PSI- 96.26
3dc8_A 490 Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K 96.11
3pnu_A359 Dihydroorotase; TIM barrel, zinc binding, hydrolas 95.99
4gxw_A380 Adenosine deaminase; amidohydrolase, COG1816, EFI, 95.9
3mdu_A453 N-formimino-L-glutamate iminohydrolase; amonohydra 95.87
3b40_A417 PVDM, probable dipeptidase; structural genomics, h 95.85
3gip_A480 N-acyl-D-glutamate deacylase; amidohydrolase famil 95.83
3v7p_A427 Amidohydrolase family protein; iron binding site, 95.75
1xrt_A467 Dihydroorotase, dhoase; amidohydrolase, metalloenz 95.71
3neh_A318 Renal dipeptidase family protein; structural genom 95.61
3e74_A473 Allantoinase; (beta/alpha)8-barrel domain, small b 95.46
1onw_A390 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 95.45
2rag_A417 Dipeptidase; aminohydrolase, structural genomics, 95.34
2vr2_A 541 Dihydropyrimidinase; hydantoinase, metal-binding, 94.93
3iar_A367 Adenosine deaminase; purine metabolism structural 94.48
3ly0_A364 Dipeptidase AC. metallo peptidase. merops family M 93.93
4f0l_A458 Amidohydrolase; ssgcid, structural genomics, seatt 93.67
3id7_A400 Dipeptidase; streptomyces coelicolor A3(2), hydrol 93.37
2fty_A 559 Dihydropyrimidinase; alpha/beta barrel, beta-sandw 93.04
1p1m_A406 Hypothetical protein TM0936; putative metal depend 92.96
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 92.15
1nfg_A457 D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2 91.51
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 91.43
2vhl_A396 N-acetylglucosamine-6-phosphate deacetylase; N- ac 91.38
2q01_A497 Uronate isomerase; structural genomics, protein st 90.46
1j5s_A463 Uronate isomerase; TM0064, structural genomics, JC 89.23
1rk6_A496 D-aminoacylase; TIM barrel, beta barrel, insertion 87.58
3lgd_A508 Adenosine deaminase CECR1; TIM barrel, dimerizatio 85.64
2gwn_A452 Dihydroorotase; zinc-binding prote structural geno 84.64
3hpa_A479 Amidohydrolase; signature of Zn ligands, structura 84.05
2eja_A338 URO-D, UPD, uroporphyrinogen decarboxylase; dimer, 83.49
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 81.04
3vni_A294 Xylose isomerase domain protein TIM barrel; D-psic 80.89
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
Probab=100.00  E-value=5.8e-52  Score=379.39  Aligned_cols=220  Identities=20%  Similarity=0.236  Sum_probs=184.4

Q ss_pred             eeeccccccccCChh-HHHHHHHHhhcC--CceEEEeecCCCCCCCCCCCHHHHHHHHHHHHHHHHh-cCCceEEeccch
Q 025333            3 WVCFIFRFVQERTPN-WFSTLKEFFEIT--PAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKE-LKRPASIHCVRA   78 (254)
Q Consensus         3 ~~G~HP~~~~~~~~~-~l~~l~~ll~~~--~~~aIGEiGLD~~~~~~~~~~~~Q~~vf~~ql~lA~~-~~lPvilH~~~a   78 (254)
                      ++|+|||++.+..++ +++.|+++++.+  +++|||||||||++. ...+.+.|+++|++||++|++ +++||+||||++
T Consensus       100 ~~GiHP~~~~~~~~~~~l~~L~~l~~~~~~~vvAIGEiGLD~~~~-~~~~~~~Q~~~F~~ql~lA~e~~~lPviiH~r~A  178 (325)
T 3ipw_A          100 TIGVHPTRTNELKQEGYLDELLLLCEKNIDKVVAIGEIGLDYERL-QFSDKETQLSGYRTLSILHQKYPYLPFFFHCRKS  178 (325)
T ss_dssp             EECCCGGGGGGGGSTTHHHHHHHHHHHTGGGEEEEEEEEEETTCC-SSSCHHHHHHHHHHTHHHHHHCTTCCEEEEEESC
T ss_pred             EEEECcchhhcCCchHHHHHHHHHHhcCCCCEEEEEeeecCCCcC-CCCCHHHHHHHHHHHHHHHHHhhCCeEEEEeCch
Confidence            689999999887665 899999998764  899999999999863 235789999999999999999 999999999999


Q ss_pred             HHHHHHHHHhcCCCCCcEEEEeCCCCHHHHHHHHHCCcEEeecccccccchHHHHHHHHhCCCCcEEEecCCCCCCchhh
Q 025333           79 FGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAE  158 (254)
Q Consensus        79 ~~~~l~il~~~~~~~~~~IiH~fsg~~e~~~~~l~~G~y~s~~~~~~~~~~~~~~~~l~~ip~driLlETD~P~~~p~~~  158 (254)
                      .++++++|++++....++|+|||+|+.+++++++++|+||||+|. ++ ++.+.+++++.+|+||||+|||+||+.|.|.
T Consensus       179 ~~d~l~iL~~~~~~~~~gViH~FsGs~e~a~~~l~lG~yis~~G~-~~-k~~~~~~~v~~iPldrlLlETDaP~l~~~~~  256 (325)
T 3ipw_A          179 WSDLCQLNKELGYNGCKGVVHCFDGTEEEMNQILNEGWDIGVTGN-SL-QSIELLNVMKQIPIERLHIETDCPYCGIKKT  256 (325)
T ss_dssp             HHHHHHHHHHTTCTTSCEEECSCCCCHHHHHHHHHTTCEEEECSG-GG-SSHHHHHHHTTSCGGGEEECCCTTSCCCCTT
T ss_pred             HHHHHHHHHhcCCCCCcEEEEECCCCHHHHHHHHhcCcEEeeCcc-cc-CcHHHHHHHHhCCcccEEEeCCCcccccccc
Confidence            999999999986544578999999999999999999999999996 44 3455668999999999999999999988776


Q ss_pred             hhcccccCCCCCCcccccccccCCCCCCCCCccccccCCCCCCCCCCCCCCcccHHHHHHHHHhccCCCHHHHHHHHHHH
Q 025333          159 LNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRN  238 (254)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~neP~~l~~v~~~lA~i~~~~~eev~~~~~~N  238 (254)
                      ..+..|+....+..+                     +.||....+.++||+|++|+.|++.||+++|+++++|++++++|
T Consensus       257 ~~~~~~~~~p~p~r~---------------------~~k~~~~~~~g~rNeP~~v~~v~~~iA~l~g~~~eeva~~t~~N  315 (325)
T 3ipw_A          257 SAGFKYLKEKDFGVK---------------------VEKYQRNKYVQRRNEPSNIIDIAIIMSSIKHISLFEFVNKVYSN  315 (325)
T ss_dssp             SGGGGGCSSCCCCBC---------------------GGGCCTTSCBTTCCCGGGHHHHHHHHHHHHTCCHHHHHHHHHHH
T ss_pred             ccchhcccccCcccc---------------------ccccccccccCCcCcHHHHHHHHHHHHHhhCcCHHHHHHHHHHH
Confidence            555555543221000                     01222223335899999999999999999999999999999999


Q ss_pred             HHHhcCCC
Q 025333          239 AIRLFSYE  246 (254)
Q Consensus       239 ~~~~f~~~  246 (254)
                      +.++|++.
T Consensus       316 a~~lF~~~  323 (325)
T 3ipw_A          316 SMNMYFPT  323 (325)
T ss_dssp             HHHHHSCC
T ss_pred             HHHHhCcC
Confidence            99999874
>3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} Back     alignment and structure
>3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} SCOP: c.1.9.0 Back     alignment and structure
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein initiative, NEW YORK SGX research center for structural GEN nysgxrc; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Back     alignment and structure
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Back     alignment and structure
>2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens} Back     alignment and structure
>3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Back     alignment and structure
>3rhg_A Putative phophotriesterase; hydrolase, amidohydrolase, zinc binding site, enzyme functio initiative, EFI; HET: SO4; 1.53A {Proteus mirabilis} Back     alignment and structure
>3k2g_A Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* Back     alignment and structure
>1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Back     alignment and structure
>3pnz_A Phosphotriesterase family protein; amidohydrolase fold; HET: KCX; 1.60A {Listeria monocytogenes serotype 4b strorganism_taxid} SCOP: c.1.9.0 Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Back     alignment and structure
>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Back     alignment and structure
>3tn4_A Phosphotriesterase; lactonase, hydrolase; HET: KCX; 1.50A {Geobacillus kaustophilus} PDB: 3tnb_A* 3tn3_A* 3tn5_A* 3tn6_A* 3ojg_A* 3orw_A* 3f4c_A* 3f4d_A* Back     alignment and structure
>3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2f6k_A Metal-dependent hydrolase; metal dependent hydrolyse, aminohydro_2, ACMDS, ACMS, trypto metabolism, quinolinic acid, QUIN; 2.50A {Lactobacillus plantarum} SCOP: c.1.9.15 Back     alignment and structure
>4i6k_A Amidohydrolase family protein; enzyme function initiative, isomerase, structural; HET: CIT; 2.28A {Acinetobacter baumannii} Back     alignment and structure
>2ffi_A 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; TIM-barrel protein., structural genomics, PSI, protein struc initiative; 2.61A {Pseudomonas putida} SCOP: c.1.9.15 Back     alignment and structure
>3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TI protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A Back     alignment and structure
>2dvt_A Thermophilic reversible gamma-resorcylate decarbo; TIM barrel, lyase; 1.70A {Rhizobium SP} SCOP: c.1.9.15 PDB: 2dvu_A* 2dvx_A* 3s4t_A* Back     alignment and structure
>2gwg_A 4-oxalomesaconate hydratase; TIM-barrel like protein, structural genomics, PSI, protein S initiative; 1.80A {Rhodopseudomonas palustris} SCOP: c.1.9.15 Back     alignment and structure
>2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens} Back     alignment and structure
>4do7_A Amidohydrolase 2; enzyme function initiative, EFI, structural TIM-barrel fold, putative lactonase; 1.70A {Burkholderia multivorans} PDB: 4dlm_A 4dnm_A* 4dlf_A Back     alignment and structure
>2hbv_A 2-amino-3-carboxymuconate 6-semialdehyde decarbox; ACMSD, TIM-barrel, decarboxylase, metaloenzyme, lyase; 1.65A {Pseudomonas fluorescens} SCOP: c.1.9.15 PDB: 2hbx_A Back     alignment and structure
>2qpx_A Predicted metal-dependent hydrolase of the TIM-BA; YP_805737.1, putative metal-dependent hydrolase; HET: KCX MSE; 1.40A {Lactobacillus casei} Back     alignment and structure
>3nqb_A Adenine deaminase 2; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics, nysgxrc; 2.21A {Agrobacterium tumefaciens} PDB: 3t81_A 3t8l_A Back     alignment and structure
>3nur_A Amidohydrolase; TIM barrel; 1.75A {Staphylococcus aureus} Back     alignment and structure
>2ics_A Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} SCOP: b.92.1.8 c.1.9.14 Back     alignment and structure
>4inf_A Metal-dependent hydrolase; amidohydrolase, metal binding site, enzyme functi initiative, EFI; 1.48A {Novosphingobium aromaticivorans} PDB: 4ing_A* Back     alignment and structure
>3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Back     alignment and structure
>3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} Back     alignment and structure
>4f0r_A 5-methylthioadenosine/S-adenosylhomocysteine DEAM; structural genomics, PSI-biology; HET: MSE MTA; 1.80A {Chromobacterium violaceum} PDB: 4f0s_A* Back     alignment and structure
>2vun_A Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} Back     alignment and structure
>3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} Back     alignment and structure
>2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus} Back     alignment and structure
>4dzi_A Putative TIM-barrel metal-dependent hydrolase; amidohydrolase, bimetal binding site, enzyme FUNC initiative, EFI; HET: SO4; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3lnp_A Amidohydrolase family protein OLEI01672_1_465; TIM barrel, beta-fold, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Oleispira antarctica} Back     alignment and structure
>2qt3_A N-isopropylammelide isopropyl amidohydrolase; N-isopropylammelide isopropylaminohydrolase ATZC, structural genomics, NYSGXRC, target 9364B; 2.24A {Pseudomonas SP} Back     alignment and structure
>3be7_A Zn-dependent arginine carboxypeptidase; unknown source, amidohydrolase, sargasso SEA, structural GEN protein structure initiative, PSI; HET: ARG; 2.30A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3dug_A* Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Back     alignment and structure
>3mpg_A Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus anthracis} Back     alignment and structure
>4dyk_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO PSI-biology, NEW YORK structural genomics research consorti hydrolase; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>4dzh_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO YORK structural genomics research consortium; 1.55A {Xanthomonas campestris PV} Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* Back     alignment and structure
>2qs8_A XAA-Pro dipeptidase; amidohydrolase, TIM barrel, protein structure initiative, PSI-2, NYSGXRC, structural genomics; 2.33A {Alteromonas macleodii} SCOP: b.92.1.9 c.1.9.18 Back     alignment and structure
>3ls9_A Triazine hydrolase; atrazine chlorohydrolase TRZN; 1.40A {Arthrobacter aurescens} PDB: 3lsc_A* 3lsb_A* Back     alignment and structure
>2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* Back     alignment and structure
>3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* Back     alignment and structure
>2i5g_A Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, structural genomics, protein structure initiative; 2.60A {Pseudomonas aeruginosa} Back     alignment and structure
>2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A Back     alignment and structure
>4aql_A Guanine deaminase; hydrolase, purine metabolism; HET: TXC; 1.99A {Homo sapiens} PDB: 2uz9_A* 3e0l_A Back     alignment and structure
>2p9b_A Possible prolidase; protein structure initiative II, PSI-2, amidohydrolase, structural genomics; 1.70A {Bifidobacterium longum NCC2705} SCOP: b.92.1.10 c.1.9.17 Back     alignment and structure
>1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A Back     alignment and structure
>3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structur initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* Back     alignment and structure
>2imr_A Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, structural genomics, protein structure initiative; 1.78A {Deinococcus radiodurans} SCOP: b.92.1.11 c.1.9.16 Back     alignment and structure
>2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2i9u_A Cytosine/guanine deaminase related protein; protein structure initiative II (PSI-II), amidohydrol guanine deaminase; HET: GUN; 2.05A {Clostridium acetobutylicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>2ood_A BLR3880 protein; PSI-II, PSI-2, guanine deaminase, guanine, structural genomics, protein structure initiative; HET: GUN; 2.62A {Bradyrhizobium japonicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>2z26_A Dihydroorotase, dhoase; TIM barrel, hydrolase; HET: KCX DOR NCD; 1.29A {Escherichia coli} PDB: 2z24_A* 2z25_A* 2eg6_A* 1xge_A* 2eg7_A* 2eg8_A* 2z27_A* 2e25_A* 2z28_A* 2z29_A* 3mjm_A* 2z2a_A* 1j79_A* 2z2b_A* 3ihn_A* 3jze_A* Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Back     alignment and structure
>1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* Back     alignment and structure
>3gri_A Dihydroorotase, dhoase; hydrolase, IDP00795, metal-binding, pyrimidine biosynthesis, structural genomics; 2.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1itu_A Renal dipeptidase; glycoprotein, membrane-bound, zinc protease BET lactamase, cilastatin, complex (hydrolase-inhibitor), hydro; HET: NAG CIL; 2.00A {Homo sapiens} SCOP: c.1.9.7 PDB: 1itq_A* Back     alignment and structure
>2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A Back     alignment and structure
>3pao_A Adenosine deaminase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; HET: ADE; 2.49A {Pseudomonas aeruginosa} PDB: 3pan_A* 3ou8_A* 3pbm_A* Back     alignment and structure
>1ra0_A Cytosine deaminase; alpha-beta barrel, hexamer, conformation change, D314G mutant, hydrolase; 1.12A {Escherichia coli} SCOP: b.92.1.2 c.1.9.5 PDB: 1r9x_A 1ra5_A 1r9y_A 1r9z_A 1rak_A 3r0d_A* 3o7u_A* 3rn6_A* 1k6w_A 1k70_A 3g77_A Back     alignment and structure
>2pgf_A Adenosine deaminase; metallo-dependent hydrolase, structural genomics, medical ST genomics of pathogenic protozoa consortium, MSGPP; HET: MSE ADN; 1.89A {Plasmodium vivax} PDB: 2pgr_A* 2qvn_A* 3ewc_A* 3ewd_A* 2amx_A Back     alignment and structure
>3rys_A Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2.60A {Arthrobacter aurescens} SCOP: c.1.9.0 Back     alignment and structure
>2paj_A Putative cytosine/guanine deaminase; NYSGXRC, PSI-II, amidohydrolase, sargasso SEA, enviro sample, structural genomics; 2.70A {Unidentified} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} Back     alignment and structure
>3pnu_A Dihydroorotase; TIM barrel, zinc binding, hydrolase, structu genomics, center for structural genomics of infectious DISE csgid; HET: KCX; 2.40A {Campylobacter jejuni subsp} Back     alignment and structure
>4gxw_A Adenosine deaminase; amidohydrolase, COG1816, EFI, structural genomics, hydrolase; 1.30A {Burkholderia ambifaria} Back     alignment and structure
>3mdu_A N-formimino-L-glutamate iminohydrolase; amonohydralase family, N-formimino-L-glutamate iminohydrolas guanidino-L-glutamate; HET: NGQ; 1.40A {Pseudomonas aeruginosa} PDB: 3mdw_A* Back     alignment and structure
>3b40_A PVDM, probable dipeptidase; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3gip_A N-acyl-D-glutamate deacylase; amidohydrolase family, hydrolase; 1.50A {Bordetella bronchiseptica} PDB: 3giq_A* Back     alignment and structure
>3v7p_A Amidohydrolase family protein; iron binding site, enzyme functio initiative, EFI; HET: TLA; 1.35A {Nitratiruptor SP} Back     alignment and structure
>1xrt_A Dihydroorotase, dhoase; amidohydrolase, metalloenzyme, pyrimidine; 1.61A {Aquifex aeolicus} SCOP: b.92.1.3 c.1.9.6 PDB: 1xrf_A 3d6n_A* Back     alignment and structure
>3neh_A Renal dipeptidase family protein; structural genomics, nysgrc, dipeptide L-Leu-D-Ala, PSI-2, P structure initiative; HET: L3A; 1.64A {Listeria monocytogenes} PDB: 3lu2_A Back     alignment and structure
>3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} Back     alignment and structure
>1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* Back     alignment and structure
>2rag_A Dipeptidase; aminohydrolase, structural genomics, NYSGXRC, target 9257A, protein structure initiative; 2.00A {Caulobacter crescentus} Back     alignment and structure
>2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>3iar_A Adenosine deaminase; purine metabolism structural genomics, structural genomics consortium, SGC, D mutation, hereditary hemolytic anemia, hydrolase; HET: 3D1; 1.52A {Homo sapiens} SCOP: c.1.9.1 PDB: 2bgn_E* 1w1i_E* 1qxl_A* 1krm_A* 1vfl_A 1ndv_A* 1ndy_A* 1ndz_A* 1o5r_A* 1uml_A* 1v79_A* 1v7a_A* 1ndw_A 1wxy_A* 1wxz_A* 2e1w_A* 2z7g_A* 2ada_A* 3mvi_A 1a4l_A* ... Back     alignment and structure
>3ly0_A Dipeptidase AC. metallo peptidase. merops family M19; structural genomics, nysgrc, target 9523C, phosphinate inhibitor, PSI-2; HET: LY0; 1.40A {Rhodobacter sphaeroides} PDB: 3fdg_A Back     alignment and structure
>4f0l_A Amidohydrolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>3id7_A Dipeptidase; streptomyces coelicolor A3(2), hydrolase; 1.30A {Streptomyces coelicolor} PDB: 3isi_X* 3itc_A* 3k5x_A* 3s2j_A* 3s2l_A* 3s2m_A* 3s2n_A* Back     alignment and structure
>2fty_A Dihydropyrimidinase; alpha/beta barrel, beta-sandwich, hydrolase; HET: KCX; 2.40A {Lachancea kluyveri} SCOP: b.92.1.3 c.1.9.6 PDB: 2fvk_A* 2fvm_A* Back     alignment and structure
>1p1m_A Hypothetical protein TM0936; putative metal dependent hydrolase, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: b.92.1.4 c.1.9.9 PDB: 2plm_A* 1j6p_A Back     alignment and structure
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Back     alignment and structure
>1nfg_A D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2.70A {Ralstonia pickettii} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Back     alignment and structure
>2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} Back     alignment and structure
>2q01_A Uronate isomerase; structural genomics, protein structure initiative NEW YORK SGX research center for structural genomics, nysgx; 2.34A {Caulobacter crescentus} Back     alignment and structure
>1j5s_A Uronate isomerase; TM0064, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.85A {Thermotoga maritima} SCOP: c.1.9.8 Back     alignment and structure
>1rk6_A D-aminoacylase; TIM barrel, beta barrel, insertion, hydrolase; 1.43A {Alcaligenes faecalis} SCOP: b.92.1.6 b.92.1.6 c.1.9.11 PDB: 1rjp_A 1v51_A 1rjq_A 1rjr_A 1rk5_A 1v4y_A 1m7j_A Back     alignment and structure
>3lgd_A Adenosine deaminase CECR1; TIM barrel, dimerization and receptor binding domains, glyco hydrolase, growth factor, secreted; HET: NAG; 2.00A {Homo sapiens} PDB: 3lgg_A* Back     alignment and structure
>2gwn_A Dihydroorotase; zinc-binding prote structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; HET: KCX GOL; 1.85A {Porphyromonas gingivalis} Back     alignment and structure
>3hpa_A Amidohydrolase; signature of Zn ligands, structural genomics, NYSGXRC, target 9236E, PSI-2, protein structure initiative; 2.20A {Unidentified} Back     alignment and structure
>2eja_A URO-D, UPD, uroporphyrinogen decarboxylase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 254
d1j6oa_260 c.1.9.12 (A:) Hypothetical protein TM0667 {Thermot 2e-21
d1yixa1265 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH 6e-21
d1zzma1259 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV 4e-20
d1xwya1260 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) { 5e-16
d1bf6a_291 c.1.9.3 (A:) Phosphotriesterase homology protein { 7e-14
d1i0da_331 c.1.9.3 (A:) Phosphotriesterase (parathion hydrola 5e-07
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: TatD Mg-dependent DNase-like
domain: Hypothetical protein TM0667
species: Thermotoga maritima [TaxId: 2336]

 Score = 88.1 bits (217), Expect = 2e-21
 Identities = 48/242 (19%), Positives = 91/242 (37%), Gaps = 47/242 (19%)

Query: 3   WVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLE 62
            V       +E   ++   L++F +     A+GE GLD        +   +V  F +Q+E
Sbjct: 62  SVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRV--FVEQIE 119

Query: 63  LAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSG 122
           LA +L  P  +H   A+ +  EI+++        +IH++    E   +   LG      G
Sbjct: 120 LAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGG 179

Query: 123 FLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHS 182
            +   K +  ++++K V  E I+LETD P   P+                          
Sbjct: 180 PVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQP------------------------- 214

Query: 183 PNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRL 242
                                +   N P  +  V++ ++ +L + + ++ E +  NA R+
Sbjct: 215 --------------------FRGKRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRI 254

Query: 243 FS 244
           F 
Sbjct: 255 FL 256
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Length = 260 Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Length = 331 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d1j6oa_260 Hypothetical protein TM0667 {Thermotoga maritima [ 100.0
d1yixa1265 Putative deoxyribonuclease YcfH {Escherichia coli 100.0
d1xwya1260 Deoxyribonuclease TatD (MttC) {Escherichia coli [T 100.0
d1zzma1259 Putative deoxyribonuclease YjjV {Escherichia coli 100.0
d1bf6a_291 Phosphotriesterase homology protein {Escherichia c 100.0
d1i0da_331 Phosphotriesterase (parathion hydrolase, PTE) {Pse 99.81
d2dvta1325 Thermophilic reversible gamma-resorcylate decarbox 98.94
d2f6ka1306 Putative amidohydrolase LP2961 {Lactobacillus plan 98.79
d2ffia1271 Putative 2-pyrone-4,6-dicarboxylic acid hydrolase 98.79
d2gwga1342 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas 98.74
d2hbva1331 2-amino-3-carboxymuconate 6-semialdehyde decarboxy 98.55
d2uz9a2313 Guanine deaminase {Human (Homo sapiens) [TaxId: 96 97.1
d1p1ma2281 Hypothetical protein TM0936, probable catalytic do 96.84
d2ftwa2334 Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli 96.78
d1gkpa2335 D-hydantoinase {Thermus sp. [TaxId: 275]} 96.71
d1kcxa2334 Dihydropyrimidinase related protein-1 {Mouse (Mus 96.7
d1gkra2325 L-hydantoinase {Arthrobacter aurescens [TaxId: 436 96.69
d1nfga2330 D-hydantoinase {Burkholderia pickettii [TaxId: 329 96.53
d1ynya2332 D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} 96.37
d1xrta2310 Two-domain dihydroorotase {Aquifex aeolicus [TaxId 95.98
d2qeec1415 Uncharacterized protein BH0493 {Bacillus haloduran 95.79
d1itua_369 Renal dipeptidase {Human (Homo sapiens) [TaxId: 96 95.7
d1onwa2284 Isoaspartyl dipeptidase, catalytic domain {Escheri 95.7
d2fvka2384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 95.5
d2i9ua2310 Guanine deaminase {Clostridium acetobutylicum [Tax 95.49
d2bb0a2300 Imidazolonepropionase {Bacillus subtilis [TaxId: 1 95.11
d2imra2308 Hypothetical protein DR0824 {Deinococcus radiodura 94.43
d1j5sa_451 Uronate isomerase TM0064 {Thermotoga maritima [Tax 94.43
d1a4ma_349 Adenosine deaminase (ADA) {Mouse (Mus musculus) [T 93.68
d2q09a2301 Probable 4-imidazolone-5-propanoate amidohydrolase 93.6
d2puza2301 Imidazolonepropionase {Agrobacterium tumefaciens [ 93.55
d2amxa1357 Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI 93.14
d2paja2336 Hypothetical protein GOS_1943094 {Environmental sa 90.77
d2icsa2267 Putative adenine deaminase EF0837 {Enterococcus fa 90.17
d1ra0a2320 Cytosine deaminase catalytic domain {Escherichia c 84.9
d2eg6a1343 Dihydroorotase {Escherichia coli [TaxId: 562]} 81.22
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: TatD Mg-dependent DNase-like
domain: Hypothetical protein TM0667
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=9.6e-55  Score=384.44  Aligned_cols=195  Identities=25%  Similarity=0.321  Sum_probs=183.7

Q ss_pred             eeeccccccccCChhHHHHHHHHhhcCCceEEEeecCCCCCCCCCCCHHHHHHHHHHHHHHHHhcCCceEEeccchHHHH
Q 025333            3 WVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDL   82 (254)
Q Consensus         3 ~~G~HP~~~~~~~~~~l~~l~~ll~~~~~~aIGEiGLD~~~~~~~~~~~~Q~~vf~~ql~lA~~~~lPvilH~~~a~~~~   82 (254)
                      ++|+|||++.+...++++.++.++.+++++|||||||||++.  ..+.+.|+++|++||++|.++++||+||||++++++
T Consensus        62 a~GiHP~~~~~~~~~~~~~l~~~~~~~~vvaIGEiGLD~~~~--~~~~~~Q~~vF~~ql~lA~~~~lPviiH~r~a~~~~  139 (260)
T d1j6oa_          62 SVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRN--ISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEA  139 (260)
T ss_dssp             EECCCGGGGGGCCTTHHHHHHHHTTSTTEEEEEEEEEETTTC--SSCHHHHHHHHHHHHHHHHHHTCCEEEEEESCHHHH
T ss_pred             ccccChhhcccccchhhhhhHHHHhhCCeeeEeecccccccc--ccHHHHHHHHHHHHHHHHHhcCcceEEeeccchHHH
Confidence            689999999998888999999999999999999999999863  457899999999999999999999999999999999


Q ss_pred             HHHHHhcCCCCCcEEEEeCCCCHHHHHHHHHCCcEEeecccccccchHHHHHHHHhCCCCcEEEecCCCCCCchhhhhcc
Q 025333           83 LEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQKAKKMLKVVPSERILLETDAPDALPKAELNSL  162 (254)
Q Consensus        83 l~il~~~~~~~~~~IiH~fsg~~e~~~~~l~~G~y~s~~~~~~~~~~~~~~~~l~~ip~driLlETD~P~~~p~~~~~~~  162 (254)
                      ++++++++..+.++|+|||+|+.+++++++++|+||||+|.+++.+.++++++++.+|+||||+|||+||+.|.+.+   
T Consensus       140 ~~il~~~~~~~~~~i~H~fsG~~~~~~~~l~~g~~is~~g~~~~~~~~~~~~~v~~iPldrlllETD~P~l~p~~~~---  216 (260)
T d1j6oa_         140 YEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFR---  216 (260)
T ss_dssp             HHHHHHSCCCSSCEEETTCCSCHHHHHHHHHHTEEEEECGGGGCTTCHHHHHHHHHHCGGGEEECCCBTSCCCGGGT---
T ss_pred             HHHHHhhcCCCCCeeeeccccCHHHHHHHHhCCCceeeccccccchHHHHHHHHHhcccceEEEecCCCCCCCcccC---
Confidence            99999987655679999999999999999999999999999998888899999999999999999999999997753   


Q ss_pred             cccCCCCCCcccccccccCCCCCCCCCccccccCCCCCCCCCCCCCCcccHHHHHHHHHhccCCCHHHHHHHHHHHHHHh
Q 025333          163 FLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRL  242 (254)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~neP~~l~~v~~~lA~i~~~~~eev~~~~~~N~~~~  242 (254)
                                                       |         .+|+|++|+.|++.+|+++|+++++|++++++|+.++
T Consensus       217 ---------------------------------~---------~~n~P~~l~~v~~~iA~~~~~~~~ev~~~~~~N~~rl  254 (260)
T d1j6oa_         217 ---------------------------------G---------KRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRI  254 (260)
T ss_dssp             ---------------------------------T---------SCCCGGGHHHHHHHHHHHHTSCHHHHHHHHHHHHHHH
T ss_pred             ---------------------------------C---------CCCChHHHHHHHHHHHHHhCcCHHHHHHHHHHHHHHH
Confidence                                             3         7999999999999999999999999999999999999


Q ss_pred             cC
Q 025333          243 FS  244 (254)
Q Consensus       243 f~  244 (254)
                      |+
T Consensus       255 F~  256 (260)
T d1j6oa_         255 FL  256 (260)
T ss_dssp             HH
T ss_pred             HH
Confidence            95
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Back     information, alignment and structure
>d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} Back     information, alignment and structure
>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2uz9a2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ftwa2 c.1.9.6 (A:60-393) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1gkpa2 c.1.9.6 (A:55-389) D-hydantoinase {Thermus sp. [TaxId: 275]} Back     information, alignment and structure
>d1kcxa2 c.1.9.6 (A:67-400) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkra2 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d1nfga2 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Back     information, alignment and structure
>d1ynya2 c.1.9.6 (A:53-384) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Back     information, alignment and structure
>d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2qeec1 c.1.9.8 (C:2-416) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d2i9ua2 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2bb0a2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1j5sa_ c.1.9.8 (A:) Uronate isomerase TM0064 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a4ma_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2q09a2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} Back     information, alignment and structure
>d2puza2 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2paja2 c.1.9.9 (A:70-405) Hypothetical protein GOS_1943094 {Environmental samples} Back     information, alignment and structure
>d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eg6a1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure