Citrus Sinensis ID: 025368

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MGKVKIGINGFGRIGRLVARVILQRDDVELVATYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
cccEEEEEEccccHHHHHHHHHHcccccEEEEEEEEccccccccccccEEEEEcccEEEEccEEEEEEEEccccccccccccccEEEEcccccccHHHHHHHHcccccEEEEccccccccEEEEEEccccccccccEEEEcccccccccHHHHHcccccccccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHcccccccccccEEEEEEccccccEEEEEEEEccccccHHHHHHHHc
cccEEEEEEcccHHHHHHHHHHcccccEEEEEEHHHHccccccccccEEEEEcEccEEEEccEEEEEEccccHHHccHHHHcccEEEEcccccccHHHHHHHHcccccEEEEccccccccEccccccHHHccccccEEEcccHHHHHHHHHHHHHHHHHcEEEEEEEEEEccccccEccccccccccHHHcEcccccEEEcccHHHHHHHHcHHHcccEEEEEEEccccccEEEEEEEEEcccccHHHHHHHHH
mgkvkigingFGRIGRLVARVILQRDDVELVATYMFKYDsvhgqwkhhelkvkddktllfgekpvtvfgvrnpeeipwaetgAEYVVestgvftdkDKAAAHLKGGAKKVIisapskdapmfvvgvneneykpelnivsnascttnclaPLAKVIHDKFGIVEGLMTTVHSITatqktvdgpsskdwrggraasfniipsstgaaKAVGKvlpalngkltgmafrvptvdvSVVDLTVRLEKDASYDEIKAAIK
mgkvkigingfgrigrLVARVILQRDDVELVATYMFKYDSVHGQWKHHelkvkddktllfgekpvtvfgvrnpeeipwaeTGAEYVVESTGVFTDKDKAAAHLKGGAKKViisapskdaPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSItatqktvdgpsskdwrgGRAASFniipsstgaaKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTvrlekdasydeikaaik
MGKVKIGINGFGRIGRLVARVILQRDDVELVATYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTdkdkaaahlkggakkVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
***VKIGINGFGRIGRLVARVILQRDDVELVATYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQ*************GRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEK************
*GKVKIGINGFGRIGRLVARVILQRDDVELVATYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
MGKVKIGINGFGRIGRLVARVILQRDDVELVATYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQ************GGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
*GKVKIGINGFGRIGRLVARVILQRDDVELVATYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKVKIGINGFGRIGRLVARVILQRDDVELVATYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
P34783360 Glyceraldehyde-3-phosphat N/A no 1.0 0.705 0.890 1e-135
P26520337 Glyceraldehyde-3-phosphat N/A no 1.0 0.753 0.886 1e-135
P26518341 Glyceraldehyde-3-phosphat N/A no 0.992 0.739 0.901 1e-133
Q7FAH2337 Glyceraldehyde-3-phosphat yes no 1.0 0.753 0.879 1e-133
Q9FX54338 Glyceraldehyde-3-phosphat yes no 0.992 0.745 0.874 1e-132
P25858338 Glyceraldehyde-3-phosphat yes no 0.992 0.745 0.874 1e-132
P04796338 Glyceraldehyde-3-phosphat N/A no 0.992 0.745 0.874 1e-131
Q42671337 Glyceraldehyde-3-phosphat N/A no 1.0 0.753 0.867 1e-130
Q43247337 Glyceraldehyde-3-phosphat N/A no 1.0 0.753 0.856 1e-130
Q6K5G8337 Glyceraldehyde-3-phosphat no no 1.0 0.753 0.864 1e-130
>sp|P34783|G3P_ATRNU Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1 Back     alignment and function desciption
 Score =  480 bits (1235), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 248/265 (93%), Gaps = 11/265 (4%)

Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVA-----------TYMFKYDSVHGQWKHHE 49
           M KVKIGINGFGRIGRLVARVILQ DD ELVA           TYMFKYDSVHGQWKHHE
Sbjct: 1   MAKVKIGINGFGRIGRLVARVILQSDDCELVAINDPFITTDYMTYMFKYDSVHGQWKHHE 60

Query: 50  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK 109
           LKVKD+KTLLFGE+PVTVFG RNPEEIPW +TGA+YVVESTGVFTDKDKAAAHLKGGAKK
Sbjct: 61  LKVKDEKTLLFGERPVTVFGNRNPEEIPWGQTGADYVVESTGVFTDKDKAAAHLKGGAKK 120

Query: 110 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 169
           VIISAPSKDAPMFVVGVNE+EYK ELNIVSNASCTTNCLAPLAKVI+DKFGIVEGLMTTV
Sbjct: 121 VIISAPSKDAPMFVVGVNEHEYKSELNIVSNASCTTNCLAPLAKVINDKFGIVEGLMTTV 180

Query: 170 HSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 229
           HSITATQKTVDGPS+KDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGM+FRVPTV
Sbjct: 181 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV 240

Query: 230 DVSVVDLTVRLEKDASYDEIKAAIK 254
           DVSVVDLTVRLEK+A+Y++IKAAIK
Sbjct: 241 DVSVVDLTVRLEKEATYEQIKAAIK 265

Atriplex nummularia (taxid: 3553)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2
>sp|P26520|G3PC_PETHY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|P26518|G3PC_MAGLI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|Q7FAH2|G3PC2_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FX54|G3PC2_ARATH Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Arabidopsis thaliana GN=GAPC2 PE=1 SV=1 Back     alignment and function description
>sp|P25858|G3PC1_ARATH Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Arabidopsis thaliana GN=GAPC1 PE=1 SV=2 Back     alignment and function description
>sp|P04796|G3PC_SINAL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2 Back     alignment and function description
>sp|Q42671|G3PC_CRAPL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|Q43247|G3PC3_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic OS=Zea mays GN=GAPC3 PE=2 SV=1 Back     alignment and function description
>sp|Q6K5G8|G3PC3_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
211906518336 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.755 0.909 1e-135
4539543337 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.753 0.905 1e-135
418731090337 glyceraldehyde 3-phosphate dehydrogenase 1.0 0.753 0.905 1e-135
257815169337 NAD-dependent glyceraldehyde 3-P dehydro 1.0 0.753 0.886 1e-135
346682873337 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.753 0.894 1e-135
386278568277 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.916 0.905 1e-134
211906470340 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.747 0.898 1e-134
224119602338 predicted protein [Populus trichocarpa] 1.0 0.751 0.890 1e-133
255540341337 glyceraldehyde 3-phosphate dehydrogenase 1.0 0.753 0.883 1e-133
462141 360 RecName: Full=Glyceraldehyde-3-phosphate 1.0 0.705 0.890 1e-133
>gi|211906518|gb|ACJ11752.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 241/265 (90%), Positives = 247/265 (93%), Gaps = 11/265 (4%)

Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVA-----------TYMFKYDSVHGQWKHHE 49
           MGK+KIGINGFGRIGRLVARV LQ DD+ELVA           TYMFKYDSVHGQWKHHE
Sbjct: 1   MGKIKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTEYMTYMFKYDSVHGQWKHHE 60

Query: 50  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK 109
           LKVKD KTLLFGEKPVTVFG+RNPEEIPWAE GAEYVVESTGVFTDKDKAAAHLKGGAKK
Sbjct: 61  LKVKDSKTLLFGEKPVTVFGIRNPEEIPWAEAGAEYVVESTGVFTDKDKAAAHLKGGAKK 120

Query: 110 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 169
           VIISAPSKDAPMFVVGVNE EYKP+LNIVSNASCTTNCLAPLAKVI+DKFGIVEGLMTTV
Sbjct: 121 VIISAPSKDAPMFVVGVNEKEYKPDLNIVSNASCTTNCLAPLAKVINDKFGIVEGLMTTV 180

Query: 170 HSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 229
           HSITATQKTVDGPS KDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV
Sbjct: 181 HSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 240

Query: 230 DVSVVDLTVRLEKDASYDEIKAAIK 254
           DVSVVDLTVRLEK A+YDEIKAAIK
Sbjct: 241 DVSVVDLTVRLEKKATYDEIKAAIK 265

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|4539543|emb|CAB39974.1| glyceraldehyde-3-phosphate dehydrogenase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|418731090|gb|AFX67011.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|257815169|gb|ACV69976.1| NAD-dependent glyceraldehyde 3-P dehydrogenase [Solanum chacoense] Back     alignment and taxonomy information
>gi|346682873|gb|AEO45785.1| glyceraldehyde-3-phosphate dehydrogenase C [Scoparia dulcis] Back     alignment and taxonomy information
>gi|386278568|gb|AFJ04516.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Vernicia fordii] Back     alignment and taxonomy information
>gi|211906470|gb|ACJ11728.1| glyceraldehyde-3-phosphate dehydrogenase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224119602|ref|XP_002318114.1| predicted protein [Populus trichocarpa] gi|118482565|gb|ABK93203.1| unknown [Populus trichocarpa] gi|222858787|gb|EEE96334.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255540341|ref|XP_002511235.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] gi|223550350|gb|EEF51837.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|462141|sp|P34783.1|G3P_ATRNU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH gi|409575|gb|AAA03442.1| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia] gi|414607|emb|CAA53269.1| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
TAIR|locus:2010007338 GAPC2 "glyceraldehyde-3-phosph 0.992 0.745 0.817 2.3e-110
TAIR|locus:2103085338 GAPC1 "glyceraldehyde-3-phosph 0.992 0.745 0.817 2.9e-110
TAIR|locus:2032810420 GAPCP-2 "glyceraldehyde-3-phos 0.992 0.6 0.685 1.2e-88
TAIR|locus:2206435422 GAPCP-1 "glyceraldehyde-3-phos 0.992 0.597 0.674 5.3e-88
UNIPROTKB|P80534363 P80534 "Glyceraldehyde-3-phosp 0.862 0.603 0.665 2.8e-84
CGD|CAL0005657335 TDH3 [Candida albicans (taxid: 0.980 0.743 0.660 4.4e-84
UNIPROTKB|Q5ADM7335 TDH3 "Glyceraldehyde-3-phospha 0.980 0.743 0.660 4.4e-84
UNIPROTKB|Q5RAB4335 GAPDH "Glyceraldehyde-3-phosph 0.992 0.752 0.637 7.4e-82
UNIPROTKB|P04406335 GAPDH "Glyceraldehyde-3-phosph 0.992 0.752 0.630 9.4e-82
UNIPROTKB|G4NCH2336 MGG_01084 "Glyceraldehyde-3-ph 0.980 0.741 0.645 3.2e-81
TAIR|locus:2010007 GAPC2 "glyceraldehyde-3-phosphate dehydrogenase C2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1090 (388.8 bits), Expect = 2.3e-110, P = 2.3e-110
 Identities = 215/263 (81%), Positives = 231/263 (87%)

Query:     3 KVKIGINGFGRIGRLVARVILQRDDVELVA-----------TYMFKYDSVHGQWKHHELK 51
             K++IGINGFGRIGRLVARV+LQRDDVELVA           TYMFKYDSVHGQWKHHELK
Sbjct:     5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK 64

Query:    52 VKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVI 111
             VKDDKTLLFGEKPVTVFG+RNPE+IPW E GA++VVESTGVFT               V+
Sbjct:    65 VKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV 124

Query:   112 ISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHS 171
             ISAPSKDAPMFVVGVNE+EYK +L+IVSNASCTTNCLAPLAKVI+D+FGIVEGLMTTVHS
Sbjct:   125 ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHS 184

Query:   172 ITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDV 231
             ITATQKTVDGPS KDWRGGRAASFNIIPSSTGAAKAVGKVLP+LNGKLTGM+FRVPTVDV
Sbjct:   185 ITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDV 244

Query:   232 SVVDLTVRLEKDASYDEIKAAIK 254
             SVVDLTVRLEK A+YDEIK AIK
Sbjct:   245 SVVDLTVRLEKAATYDEIKKAIK 267
GO:0005737 "cytoplasm" evidence=ISM
GO:0006006 "glucose metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=ISS;RCA;TAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA;TAS
GO:0006094 "gluconeogenesis" evidence=RCA;TAS
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0042742 "defense response to bacterium" evidence=IEP
GO:0016020 "membrane" evidence=IDA
GO:0004365 "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0051049 "regulation of transport" evidence=RCA
TAIR|locus:2103085 GAPC1 "glyceraldehyde-3-phosphate dehydrogenase C subunit 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P80534 P80534 "Glyceraldehyde-3-phosphate dehydrogenase, muscle" [Jaculus orientalis (taxid:48868)] Back     alignment and assigned GO terms
CGD|CAL0005657 TDH3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ADM7 TDH3 "Glyceraldehyde-3-phosphate dehydrogenase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAB4 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|P04406 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G4NCH2 MGG_01084 "Glyceraldehyde-3-phosphate dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P34923G3PC_PHYPA1, ., 2, ., 1, ., 1, 20.76800.98810.7339N/Ano
Q7FAH2G3PC2_ORYSJ1, ., 2, ., 1, ., 1, 20.87921.00.7537yesno
Q42671G3PC_CRAPL1, ., 2, ., 1, ., 1, 20.86791.00.7537N/Ano
P08477G3PC2_HORVU1, ., 2, ., 1, ., 1, 20.88280.87400.7278N/Ano
P0CN74G3P_CRYNJ1, ., 2, ., 1, ., 1, 20.69080.98030.7345yesno
P04796G3PC_SINAL1, ., 2, ., 1, ., 1, 20.87450.99210.7455N/Ano
A2YQT7G3PC_ORYSI1, ., 2, ., 1, ., 1, 20.83391.00.7537N/Ano
P26518G3PC_MAGLI1, ., 2, ., 1, ., 1, 20.90110.99210.7390N/Ano
Q41595G3PC_TAXBA1, ., 2, ., 1, ., 1, 20.84840.99600.7441N/Ano
P04406G3P_HUMAN2, ., 6, ., 9, 9, ., -0.66410.99210.7522yesno
P26517G3PC1_HORVU1, ., 2, ., 1, ., 1, 20.84901.00.7537N/Ano
Q43247G3PC3_MAIZE1, ., 2, ., 1, ., 1, 20.85661.00.7537N/Ano
P34783G3P_ATRNU1, ., 2, ., 1, ., 1, 20.89051.00.7055N/Ano
P34924G3PC_PINSY1, ., 2, ., 1, ., 1, 20.84090.99600.7441N/Ano
P34922G3PC_PEA1, ., 2, ., 1, ., 1, 20.87070.99210.7455N/Ano
Q9FX54G3PC2_ARATH1, ., 2, ., 1, ., 1, 20.87450.99210.7455yesno
P34921G3PC_DIACA1, ., 2, ., 1, ., 1, 20.86031.00.7514N/Ano
P25861G3PC_ANTMA1, ., 2, ., 1, ., 1, 20.86791.00.7537N/Ano
P09094G3PC_TOBAC1, ., 2, ., 1, ., 1, 20.88180.95660.7453N/Ano
Q09054G3PC2_MAIZE1, ., 2, ., 1, ., 1, 20.84151.00.7537N/Ano
Q6CCU7G3P_YARLI1, ., 2, ., 1, ., 1, 20.68700.98030.7366yesno
Q39769G3PC_GINBI1, ., 2, ., 1, ., 1, 20.85980.99600.7441N/Ano
P26519G3PC_PETCR1, ., 2, ., 1, ., 1, 20.85170.99210.75N/Ano
P26521G3PC_RANAC1, ., 2, ., 1, ., 1, 20.85220.99600.7485N/Ano
P26520G3PC_PETHY1, ., 2, ., 1, ., 1, 20.88671.00.7537N/Ano
Q6BMK0G3P_DEBHA1, ., 2, ., 1, ., 1, 20.69460.98030.7432yesno
P17878G3PC_MESCR1, ., 2, ., 1, ., 1, 20.84521.00.7537N/Ano
Q5RAB4G3P_PONAB2, ., 6, ., 9, 9, ., -0.67160.99210.7522yesno
P08735G3PC1_MAIZE1, ., 2, ., 1, ., 1, 20.83391.00.7537N/Ano
P25858G3PC1_ARATH1, ., 2, ., 1, ., 1, 20.87450.99210.7455yesno
P16858G3P_MOUSE2, ., 6, ., 9, 9, ., -0.67550.98030.7477yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.2.1.120.979
4th Layer1.2.1.59LOW CONFIDENCE prediction!
3rd Layer1.2.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XII1463
SubName- Full=Putative uncharacterized protein; (338 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0154005402
phosphoglycerate kinase (EC-2.7.7.2 2.7.2.3) (402 aa)
•  • •• 0.956
eugene3.00080776
RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (402 aa)
•  • •• 0.956
estExt_fgenesh4_pm.C_LG_VIII0335
phosphoglycerate kinase (481 aa)
•  • •• 0.946
estExt_fgenesh4_pm.C_LG_X0655
phosphoglycerate kinase (481 aa)
•  • •• 0.945
estExt_Genewise1_v1.C_LG_IV0988
hypothetical protein (256 aa)
••   •• 0.929
grail3.0049021504
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (254 aa)
••   •• 0.928
estExt_fgenesh4_pg.C_LG_I1744
triose-phosphate isomerase (EC-5.3.1.1) (255 aa)
••   •• 0.927
estExt_Genewise1_v1.C_LG_X2172
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (256 aa)
••   •• 0.927
eugene3.00091331
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (264 aa)
••   •• 0.923
estExt_Genewise1_v1.C_LG_IX1362
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (315 aa)
••   •• 0.913

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
PLN02358338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 1e-162
PLN02272421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 1e-157
TIGR01534326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 1e-132
COG0057335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 1e-132
PTZ00023337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 1e-127
PRK15425331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 1e-101
PTZ00434361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 1e-100
PRK07729343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 2e-96
PLN02237 442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 2e-86
PLN03096395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 2e-85
PRK07403337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 9e-84
PRK08955334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 3e-68
pfam00044148 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh 3e-66
smart00846149 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de 3e-65
PRK08289477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 2e-64
pfam02800157 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh 6e-64
PRK13535336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 5e-63
TIGR01532325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 3e-60
PTZ00353342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 1e-40
COG0136334 COG0136, Asd, Aspartate-semialdehyde dehydrogenase 8e-08
TIGR01296338 TIGR01296, asd_B, aspartate-semialdehyde dehydroge 5e-04
COG0289266 COG0289, DapB, Dihydrodipicolinate reductase [Amin 7e-04
pfam01113122 pfam01113, DapB_N, Dihydrodipicolinate reductase, 7e-04
TIGR00978341 TIGR00978, asd_EA, aspartate-semialdehyde dehydrog 0.002
PRK04207341 PRK04207, PRK04207, glyceraldehyde-3-phosphate deh 0.002
PRK00048257 PRK00048, PRK00048, dihydrodipicolinate reductase; 0.003
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information 
 Score =  453 bits (1166), Expect = e-162
 Identities = 230/263 (87%), Positives = 246/263 (93%), Gaps = 11/263 (4%)

Query: 3   KVKIGINGFGRIGRLVARVILQRDDVELVA-----------TYMFKYDSVHGQWKHHELK 51
           K++IGINGFGRIGRLVARV+LQRDDVELVA           TYMFKYDSVHGQWKHHELK
Sbjct: 5   KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK 64

Query: 52  VKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVI 111
           VKDDKTLLFGEKPVTVFG+RNPE+IPW E GA++VVESTGVFTDKDKAAAHLKGGAKKV+
Sbjct: 65  VKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV 124

Query: 112 ISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHS 171
           ISAPSKDAPMFVVGVNE+EYK +L+IVSNASCTTNCLAPLAKVI+D+FGIVEGLMTTVHS
Sbjct: 125 ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHS 184

Query: 172 ITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDV 231
           ITATQKTVDGPS KDWRGGRAASFNIIPSSTGAAKAVGKVLP+LNGKLTGM+FRVPTVDV
Sbjct: 185 ITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDV 244

Query: 232 SVVDLTVRLEKDASYDEIKAAIK 254
           SVVDLTVRLEK A+YDEIK AIK
Sbjct: 245 SVVDLTVRLEKAATYDEIKKAIK 267

Length = 338
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223214 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233347 TIGR01296, asd_B, aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>gnl|CDD|223366 COG0289, DapB, Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|216304 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus Back     alignment and domain information
>gnl|CDD|233220 TIGR00978, asd_EA, aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>gnl|CDD|179786 PRK04207, PRK04207, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234595 PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 100.0
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 100.0
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 100.0
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PRK08040336 putative semialdehyde dehydrogenase; Provisional 100.0
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 100.0
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 100.0
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 100.0
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PLN02383344 aspartate semialdehyde dehydrogenase 100.0
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 100.0
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 100.0
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 100.0
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 100.0
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 100.0
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 100.0
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 100.0
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 100.0
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 100.0
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 100.0
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 99.97
KOG4354340 consensus N-acetyl-gamma-glutamyl-phosphate reduct 99.96
KOG0657285 consensus Glyceraldehyde 3-phosphate dehydrogenase 99.96
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 99.94
KOG4777361 consensus Aspartate-semialdehyde dehydrogenase [Am 99.93
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 99.92
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 99.74
PF02800157 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, 99.73
PRK08300302 acetaldehyde dehydrogenase; Validated 99.64
PF02774184 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimer 99.55
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 99.44
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 99.07
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 99.05
TIGR00036266 dapB dihydrodipicolinate reductase. 98.84
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 98.69
PRK00048257 dihydrodipicolinate reductase; Provisional 98.67
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.65
PRK13303265 L-aspartate dehydrogenase; Provisional 98.53
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.42
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 98.4
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.34
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.16
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 98.11
PLN02775286 Probable dihydrodipicolinate reductase 98.0
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 97.94
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.89
PRK06349 426 homoserine dehydrogenase; Provisional 97.87
PRK11579 346 putative oxidoreductase; Provisional 97.75
PRK06270341 homoserine dehydrogenase; Provisional 97.62
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 97.48
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 97.46
COG0673 342 MviM Predicted dehydrogenases and related proteins 97.45
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.45
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.29
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 97.25
PRK06813346 homoserine dehydrogenase; Validated 97.2
PRK06392326 homoserine dehydrogenase; Provisional 97.2
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 97.03
PTZ00431260 pyrroline carboxylate reductase; Provisional 97.03
COG2344211 AT-rich DNA-binding protein [General function pred 97.02
PRK08374336 homoserine dehydrogenase; Provisional 97.02
PRK10206 344 putative oxidoreductase; Provisional 96.96
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.91
CHL00194317 ycf39 Ycf39; Provisional 96.88
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.85
COG2910211 Putative NADH-flavin reductase [General function p 96.82
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.81
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 96.81
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.76
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.74
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 96.63
COG3804350 Uncharacterized conserved protein related to dihyd 96.4
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.28
PLN02700377 homoserine dehydrogenase family protein 96.26
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.15
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 96.11
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.08
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 95.92
COG2085211 Predicted dinucleotide-binding enzymes [General fu 95.9
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.86
PRK07502307 cyclohexadienyl dehydrogenase; Validated 95.68
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 95.66
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 95.62
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 95.6
COG4091 438 Predicted homoserine dehydrogenase [Amino acid tra 95.57
PLN02256304 arogenate dehydrogenase 95.53
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.51
PRK08818 370 prephenate dehydrogenase; Provisional 95.44
PRK06223307 malate dehydrogenase; Reviewed 95.43
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 95.25
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 95.21
PRK07417279 arogenate dehydrogenase; Reviewed 95.16
PTZ00325321 malate dehydrogenase; Provisional 95.13
PLN02688266 pyrroline-5-carboxylate reductase 95.12
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 95.08
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 94.97
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 94.87
PLN02602350 lactate dehydrogenase 94.84
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 94.83
PTZ00117319 malate dehydrogenase; Provisional 94.56
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 94.55
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.54
PLN02695370 GDP-D-mannose-3',5'-epimerase 94.54
PTZ00082321 L-lactate dehydrogenase; Provisional 94.47
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 94.42
PRK07680273 late competence protein ComER; Validated 94.38
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 94.36
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 94.31
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 94.28
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.22
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 94.22
PRK06444197 prephenate dehydrogenase; Provisional 94.16
PLN02166436 dTDP-glucose 4,6-dehydratase 94.08
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.05
PLN00016378 RNA-binding protein; Provisional 94.04
PRK08507275 prephenate dehydrogenase; Validated 93.97
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 93.95
PLN00106323 malate dehydrogenase 93.88
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 93.86
PRK05479330 ketol-acid reductoisomerase; Provisional 93.76
PLN02214342 cinnamoyl-CoA reductase 93.73
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 93.62
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.6
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 93.55
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 93.47
PLN02206442 UDP-glucuronate decarboxylase 93.44
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 93.44
PRK09414445 glutamate dehydrogenase; Provisional 93.38
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 93.2
PRK05086312 malate dehydrogenase; Provisional 93.19
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 93.19
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.16
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 93.14
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.12
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 93.11
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 93.09
PRK08618325 ornithine cyclodeaminase; Validated 92.95
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 92.75
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 92.75
PRK12921305 2-dehydropantoate 2-reductase; Provisional 92.75
PLN02712667 arogenate dehydrogenase 92.75
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 92.67
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 92.59
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 92.51
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 92.38
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 92.25
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 92.17
COG5322351 Predicted dehydrogenase [General function predicti 92.09
TIGR00243 389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 92.04
PRK06545 359 prephenate dehydrogenase; Validated 92.02
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 91.74
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 91.72
PRK11908347 NAD-dependent epimerase/dehydratase family protein 91.53
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.31
PRK08219227 short chain dehydrogenase; Provisional 91.23
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 91.17
PRK08306296 dipicolinate synthase subunit A; Reviewed 91.14
PLN00203519 glutamyl-tRNA reductase 91.0
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.89
PLN02696 454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 90.85
PRK06719157 precorrin-2 dehydrogenase; Validated 90.66
PRK05865 854 hypothetical protein; Provisional 90.6
PRK12320 699 hypothetical protein; Provisional 90.47
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 90.45
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 90.41
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 90.33
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 90.32
PRK06046326 alanine dehydrogenase; Validated 90.28
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 90.25
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.24
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 90.23
PRK08655 437 prephenate dehydrogenase; Provisional 90.18
PRK06718202 precorrin-2 dehydrogenase; Reviewed 90.04
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 90.04
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.03
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 89.68
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 89.65
PRK07236 386 hypothetical protein; Provisional 89.44
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 89.36
PRK13403335 ketol-acid reductoisomerase; Provisional 89.29
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 89.23
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 88.96
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 88.91
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 88.9
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.75
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 88.68
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 88.64
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 88.49
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.35
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 88.21
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.13
PLN02427 386 UDP-apiose/xylose synthase 88.1
PLN02353 473 probable UDP-glucose 6-dehydrogenase 87.97
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 87.68
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 87.63
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 87.61
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 87.56
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.51
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 87.38
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.36
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 87.28
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.27
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 87.03
PRK06487317 glycerate dehydrogenase; Provisional 86.95
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 86.81
COG0743 385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 86.81
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 86.78
KOG2741 351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 86.68
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.65
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.12
PLN00112444 malate dehydrogenase (NADP); Provisional 86.06
PRK08291330 ectoine utilization protein EutC; Validated 85.97
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 85.91
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 85.84
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 85.84
PRK06932314 glycerate dehydrogenase; Provisional 85.72
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.54
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 85.48
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 85.46
PRK07574385 formate dehydrogenase; Provisional 85.41
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 85.4
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 84.93
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 84.9
PLN00198338 anthocyanidin reductase; Provisional 84.88
PRK12480330 D-lactate dehydrogenase; Provisional 84.72
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 84.67
PLN02240352 UDP-glucose 4-epimerase 84.65
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.52
PRK05442326 malate dehydrogenase; Provisional 84.44
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 84.26
KOG2733 423 consensus Uncharacterized membrane protein [Functi 84.21
PLN02928347 oxidoreductase family protein 84.2
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 84.11
PLN02778298 3,5-epimerase/4-reductase 84.02
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 83.78
PRK06436303 glycerate dehydrogenase; Provisional 83.66
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 83.59
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 83.57
PRK13243333 glyoxylate reductase; Reviewed 83.55
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 83.5
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.29
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.23
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 83.22
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 83.2
PRK08605332 D-lactate dehydrogenase; Validated 83.08
COG0569225 TrkA K+ transport systems, NAD-binding component [ 82.87
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 82.52
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 82.51
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 82.36
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 82.15
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 82.02
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 82.0
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 81.93
PRK14031444 glutamate dehydrogenase; Provisional 81.86
PLN00125300 Succinyl-CoA ligase [GDP-forming] subunit alpha 81.84
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 81.7
KOG0455 364 consensus Homoserine dehydrogenase [Amino acid tra 81.7
PLN03139386 formate dehydrogenase; Provisional 81.68
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 81.56
PRK09126 392 hypothetical protein; Provisional 81.36
PRK07340304 ornithine cyclodeaminase; Validated 81.31
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 81.18
PRK06407301 ornithine cyclodeaminase; Provisional 81.16
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 81.15
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 80.86
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 80.78
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 80.63
PRK08223287 hypothetical protein; Validated 80.45
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 80.32
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 80.11
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-52  Score=365.71  Aligned_cols=249  Identities=65%  Similarity=1.033  Sum_probs=230.4

Q ss_pred             CcEEEEEccCHHHHHHHHHHHcCCCceeEEe----------eeeeeccccccccccceeecCCeeEEECCEEEEEeecCC
Q 025368            3 KVKIGINGFGRIGRLVARVILQRDDVELVAT----------YMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRN   72 (254)
Q Consensus         3 ~~~V~IvG~G~~G~~l~~~L~~~p~~~v~~~----------~~~~~~s~~g~~~~~~v~~~~g~~l~~~~~~~~~~~~~~   72 (254)
                      ++||||+|+|++|+.++|.+.++++++++++          ++++|||.+|+|. ..+..+.+ .+.++|+.+.++++.+
T Consensus         2 ~~~i~inGfGRIGr~~~r~~~~~~~~~vvaiNd~~~~~~~ayll~yDs~hg~~~-~~v~~~~~-~l~v~g~~I~v~~~~d   79 (331)
T PRK15425          2 TIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTHGRFD-GTVEVKDG-HLIVNGKKIRVTAERD   79 (331)
T ss_pred             ceEEEEEeeChHHHHHHHHHHHCCCCEEEEEecCCCHHHHHHHHccccCCCCcC-CcEEecCC-EEEECCeEEEEEEcCC
Confidence            3799999999999999999888889999984          6788999999998 77776655 7889999999988778


Q ss_pred             CCCCCcccCCCcEEEEecCCccCHHHHHHHHHCCCCeEEecCCCC-CCCeEEeeeCcccccCCCCeEEcCChhhHhHHHH
Q 025368           73 PEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSK-DAPMFVVGVNENEYKPELNIVSNASCTTNCLAPL  151 (254)
Q Consensus        73 ~~~~~~~~~~~Dvv~~a~~~~~s~~~~~~~~~~G~~~~viS~~~~-~~~~~v~~vn~~~i~~~~~iVa~p~C~~t~~~l~  151 (254)
                      +++++|...++|+||+|++.+.++++++.++++|++++++|++.+ +.|++|||+|++.+.. .++|+||+|++++++++
T Consensus        80 p~~~~w~~~gvDiVle~tG~f~s~~~a~~hl~aGak~V~iSap~~~~vp~vV~gVN~~~~~~-~~IISnaSCtTn~Lapv  158 (331)
T PRK15425         80 PANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAG-QDIVSNASCTTNCLAPL  158 (331)
T ss_pred             hhhCcccccCCCEEEEecchhhcHHHHHHHHHCCCEEEEeCCCCCCCCCEEEcccCHHHcCC-CCEEECCCcHHHHHHHH
Confidence            999999666999999999999999999999999999888888854 4699999999999975 78999999999999999


Q ss_pred             HHHHhhhcCeeEEEEEeeeeccccccccCCCCCCCccccccccceeeccCCChhhhhhhhcccCCCceeEEEEEceeCce
Q 025368          152 AKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDV  231 (254)
Q Consensus       152 l~pL~~~~~i~~~~v~~~~~~sg~~~~~d~~~~~~~~~~~~~~~n~~p~~~~~~~e~~~~l~~~~~~v~~~~~~vP~~rG  231 (254)
                      |+||+++|+|+++.++|+|++|++++..|++++++++++|++++|++|..+|.++++.+++|+++++++.+++|||+++|
T Consensus       159 lk~L~~~fgI~~g~mTTvha~T~~q~llD~~~~~d~r~~R~aa~NiIPt~tGaa~av~kIlP~L~gkl~g~avRVPv~~g  238 (331)
T PRK15425        159 AKVINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNV  238 (331)
T ss_pred             HHHHHHhCCeEEEEEEEEEeccCccccccCCCCcccccCcchhhceecccCCchHHHHhhccccCCeEEEEEEEecccCe
Confidence            99999999999999999999999988889877678999999999999999999999999999999999999999999999


Q ss_pred             eEEEEEEEecCCCCHHHHHHHhC
Q 025368          232 SVVDLTVRLEKDASYDEIKAAIK  254 (254)
Q Consensus       232 ~~~~~~~~~~~~~~~~~v~~~~~  254 (254)
                      |+.+++++++++++.||++++|+
T Consensus       239 s~~dltv~l~~~~t~eev~~al~  261 (331)
T PRK15425        239 SVVDLTVRLEKAATYEQIKAAVK  261 (331)
T ss_pred             EEEEEEEEECCCCCHHHHHHHHH
Confidence            99999999999999999999874

>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>KOG4354 consensus N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PF02774 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimerisation domain; InterPro: IPR012280 This domain contains N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN00125 Succinyl-CoA ligase [GDP-forming] subunit alpha Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>KOG0455 consensus Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
3e5r_O337 Crystal Structure And Functional Analysis Of Glycer 1e-119
3e6a_O336 Crystal Structure And Functional Analysis Of Glycer 1e-118
1znq_O338 Crsytal Structure Of Human Liver Gapdh Length = 338 5e-90
1u8f_O335 Crystal Structure Of Human Placental Glyceraldehyde 6e-90
1ihx_A333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 4e-88
1szj_G333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 9e-88
1gpd_G334 Studies Of Asymmetry In The Three-Dimensional Struc 1e-87
4gpd_1333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 1e-87
3gpd_R334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 2e-86
1dss_G333 Structure Of Active-Site Carboxymethylated D-Glycer 2e-86
2i5p_O342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-86
1j0x_O332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 5e-86
4iq8_A340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 7e-86
3pym_A332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 8e-86
2vyn_D334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 2e-81
3h9e_B346 Crystal Structure Of Human Sperm-Specific Glycerald 3e-81
1s7c_A331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 5e-81
1gae_O330 Comparison Of The Structures Of Wild Type And A N31 5e-81
1gad_O330 Comparison Of The Structures Of Wild Type And A N31 5e-81
3cps_A354 Crystal Structure Of Cryptosporidium Parvum Glycera 1e-80
1vsu_A359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 2e-80
2vyn_A331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 1e-79
3cif_A359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 3e-79
3sth_A361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 9e-77
1ywg_O337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 1e-75
2b4r_O345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-75
1dc4_A330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 2e-72
2x0n_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 3e-72
1k3t_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 9e-69
3dmt_C359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 2e-67
1a7k_A360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 2e-66
1gyp_A358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 3e-66
1dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-63
3dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-63
1gd1_O334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 1e-63
1npt_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-62
1nq5_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-62
1hdg_O332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 8e-59
2ep7_A342 Structural Study Of Project Id Aq_1065 From Aquifex 1e-56
3doc_A335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 9e-56
3hja_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-53
2pkq_O 368 Crystal Structure Of The Photosynthetic A2b2-Glycer 2e-53
3l0d_A356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 8e-52
4dib_A345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 7e-51
1rm3_O337 Crystal Structure Of Mutant T33a Of Photosynthetic 9e-51
1nbo_O337 The Dual Coenzyme Specificity Of Photosynthetic Gly 1e-50
2pkr_O 365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 1e-50
1rm5_O337 Crystal Structure Of Mutant S188a Of Photosynthetic 2e-50
1jn0_O335 Crystal Structure Of The Non-Regulatory A4 Isoform 3e-50
3gnq_A344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 7e-50
1cer_O331 Determinants Of Enzyme Thermostability Observed In 5e-49
3lc7_O339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 3e-48
3k73_Q336 Crystal Structure Of Phosphate Bound Holo Glycerald 3e-48
3vaz_P344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 4e-48
3lvf_P338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 4e-48
1vc2_A331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 6e-48
2g82_O331 High Resolution Structures Of Thermus Aquaticus Gly 1e-47
3lc1_P336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 2e-47
3hq4_R336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 5e-47
3k9q_Q336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 9e-47
3ksd_Q336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 3e-46
3b1j_A339 Crystal Structure Of Dehydrogenese Length = 339 3e-45
2d2i_A 380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 3e-45
3k2b_A337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 6e-45
1obf_O335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 5e-44
2x5j_O339 Crystal Structure Of The Apoform Of The D-Erythrose 2e-39
2xf8_A338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 2e-39
2x5k_O339 Structure Of An Active Site Mutant Of The D-Erythro 7e-37
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure 
Iteration: 1

 Score =  423 bits (1088), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/265 (78%), Positives = 226/265 (85%), Gaps = 11/265 (4%)
Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVA-----------TYMFKYDSVHGQWKHHE 49
           MGK+KIGINGFGRIGRLVARV LQ +DVELVA           TYMFKYD+VHGQWKH +
Sbjct: 1   MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD 60
Query: 50  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXX 109
           +K+KD KTLL GEKPVTVFG+RNP+EIPWAE GAEYVVESTGVFT               
Sbjct: 61  IKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKK 120
Query: 110 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 169
           V+ISAPSKDAPMFV GVNE++Y  +++IVSNASCTTNCLAPLAKVIHD FGI+EGLMTTV
Sbjct: 121 VVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTV 180
Query: 170 HSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 229
           H+ITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLP LNGKLTGM+FRVPTV
Sbjct: 181 HAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTV 240
Query: 230 DVSVVDLTVRLEKDASYDEIKAAIK 254
           DVSVVDLTVR+EK ASYD IK+AIK
Sbjct: 241 DVSVVDLTVRIEKAASYDAIKSAIK 265
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 0.0
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 0.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 0.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 0.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 0.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 0.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 0.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 1e-175
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 1e-160
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1e-158
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 1e-154
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 1e-154
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 1e-153
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 1e-151
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 1e-150
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 1e-149
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 1e-149
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 1e-147
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 1e-141
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 1e-134
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 1e-133
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 1e-104
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 1e-100
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 5e-97
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 7e-66
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 1e-07
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 5e-07
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 1e-05
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 3e-04
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 3e-04
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 7e-04
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
 Score =  523 bits (1349), Expect = 0.0
 Identities = 221/265 (83%), Positives = 241/265 (90%), Gaps = 11/265 (4%)

Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVA-----------TYMFKYDSVHGQWKHHE 49
           MGK+KIGINGFGRIGRLVARV LQ +DVELVA           TYMFKYD+VHGQWKH +
Sbjct: 1   MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD 60

Query: 50  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK 109
           +K+KD KTLL GEKPVTVFG+RNP+EIPWAE GAEYVVESTGVFTDK+KAAAHLKGGAKK
Sbjct: 61  IKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKK 120

Query: 110 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 169
           V+ISAPSKDAPMFV GVNE++Y  +++IVSNASCTTNCLAPLAKVIHD FGI+EGLMTTV
Sbjct: 121 VVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTV 180

Query: 170 HSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 229
           H+ITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLP LNGKLTGM+FRVPTV
Sbjct: 181 HAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTV 240

Query: 230 DVSVVDLTVRLEKDASYDEIKAAIK 254
           DVSVVDLTVR+EK ASYD IK+AIK
Sbjct: 241 DVSVVDLTVRIEKAASYDAIKSAIK 265
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Length = 320 Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Length = 304 Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Length = 350 Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Length = 288 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Length = 308 Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Length = 354 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 100.0
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 100.0
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 100.0
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 100.0
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 100.0
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 100.0
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 100.0
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 100.0
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 100.0
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 100.0
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 100.0
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 100.0
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 100.0
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 100.0
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 100.0
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 100.0
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 100.0
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 100.0
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 100.0
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 100.0
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 99.14
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 99.07
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 98.9
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.75
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 98.67
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 98.51
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 98.44
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.43
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 98.26
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 98.24
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 98.23
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 98.22
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.22
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 98.19
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 98.18
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.14
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 98.12
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 98.12
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.11
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 98.1
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 98.09
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 98.07
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 98.05
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 98.05
4had_A350 Probable oxidoreductase protein; structural genomi 98.03
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 98.03
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 98.02
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 98.01
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 98.0
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.0
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.99
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.96
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.96
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.96
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.9
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.9
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 97.89
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 97.88
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.85
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 97.84
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.83
1ydw_A 362 AX110P-like protein; structural genomics, protein 97.82
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 97.82
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 97.81
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.81
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 97.8
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.78
4h3v_A 390 Oxidoreductase domain protein; structural genomics 97.78
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 97.76
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.73
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.72
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.72
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 97.65
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.61
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 97.59
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 97.58
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 97.54
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 97.51
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 97.51
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 97.45
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 97.44
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 97.44
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 97.37
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 97.36
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.34
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 97.34
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 97.33
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.32
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 97.31
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 97.3
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 97.3
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 97.24
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.15
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.15
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.09
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.05
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 97.03
3ius_A286 Uncharacterized conserved protein; APC63810, silic 97.02
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 97.0
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.96
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 96.95
3slg_A372 PBGP3 protein; structural genomics, seattle struct 96.95
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.91
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 96.89
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 96.86
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 96.85
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.82
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 96.81
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.8
2duw_A145 Putative COA-binding protein; ligand binding prote 96.79
2d59_A144 Hypothetical protein PH1109; COA binding, structur 96.78
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.75
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 96.75
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 96.7
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.69
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 96.68
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 96.67
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 96.62
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.62
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.59
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.4
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.39
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.36
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 96.29
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.24
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.16
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.16
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.13
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.13
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 96.1
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.08
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 96.05
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.99
2wm3_A299 NMRA-like family domain containing protein 1; unkn 95.98
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 95.94
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.92
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 95.87
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 95.71
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.58
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 95.54
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 95.52
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 95.51
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 95.22
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 95.18
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 95.16
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 95.16
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 95.12
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 95.03
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 95.02
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.0
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 94.95
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 94.93
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 94.89
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 94.87
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 94.85
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 94.84
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 94.84
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 94.82
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 94.69
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 94.68
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 94.68
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 94.62
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 94.62
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 94.57
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 94.56
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 94.5
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 94.38
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 94.38
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.33
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 94.29
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 94.19
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 94.04
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 93.98
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 93.95
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 93.92
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 93.78
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.64
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 93.63
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 93.53
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 93.52
2csu_A 457 457AA long hypothetical protein; structural genomi 93.39
4f6c_A 427 AUSA reductase domain protein; thioester reductase 93.38
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 93.33
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 93.29
1xq6_A253 Unknown protein; structural genomics, protein stru 93.18
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 93.15
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 93.08
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.9
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 92.7
2y1e_A 398 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 92.55
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 92.54
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 92.45
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 92.41
1lss_A140 TRK system potassium uptake protein TRKA homolog; 92.41
1q0q_A 406 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 92.34
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 92.29
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 92.26
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 92.12
2rir_A300 Dipicolinate synthase, A chain; structural genomic 91.93
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 91.87
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 91.85
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 91.78
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 91.77
3au8_A 488 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 91.71
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 91.69
3mwd_B334 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 91.51
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 91.48
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 91.45
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.43
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 91.35
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 91.35
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 91.07
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 90.92
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 90.9
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 90.84
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 90.83
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 90.82
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 90.77
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 90.76
4ezb_A317 Uncharacterized conserved protein; structural geno 90.76
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 90.66
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 90.54
1vpd_A299 Tartronate semialdehyde reductase; structural geno 90.44
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 90.39
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 90.28
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 90.28
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 90.27
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.23
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 90.2
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 89.95
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 89.89
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 89.88
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 89.59
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 89.55
3qha_A296 Putative oxidoreductase; seattle structural genomi 89.54
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 89.49
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 89.43
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 89.36
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 89.35
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 89.29
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 89.27
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 89.26
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 89.13
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 89.08
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 89.03
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 88.92
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 88.92
1yb4_A295 Tartronic semialdehyde reductase; structural genom 88.83
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 88.66
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 88.58
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 88.54
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 88.25
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 88.17
3l6d_A306 Putative oxidoreductase; structural genomics, prot 87.95
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 87.92
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 87.83
3tl2_A315 Malate dehydrogenase; center for structural genomi 87.81
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 87.78
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 87.75
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 87.66
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 87.66
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 87.64
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 87.63
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 87.55
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 87.34
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 87.33
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 87.15
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 87.07
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 87.06
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 86.9
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 86.77
3c85_A183 Putative glutathione-regulated potassium-efflux S 86.73
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 86.62
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 86.48
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 86.41
4hb9_A 412 Similarities with probable monooxygenase; flavin, 86.34
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 86.13
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 86.0
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 85.99
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 85.96
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 85.75
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 85.75
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 85.73
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 85.67
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 85.6
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 85.51
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 85.51
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 85.51
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 85.41
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 85.35
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 85.31
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 85.15
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 85.1
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 85.09
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 85.08
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 85.01
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 85.0
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 84.97
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 84.93
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 84.88
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 84.82
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 84.76
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 84.54
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 84.52
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 84.44
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 84.36
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 84.29
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 84.2
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 84.16
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 84.13
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 83.96
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 83.89
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 83.86
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 83.8
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 83.7
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 83.7
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 83.69
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 83.62
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 83.57
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 83.54
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 83.54
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 83.49
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 83.32
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 83.3
2ywl_A180 Thioredoxin reductase related protein; uncharacter 83.21
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 83.19
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 83.1
2cul_A232 Glucose-inhibited division protein A-related PROT 83.07
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 83.05
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 83.03
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 82.96
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 82.94
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 82.89
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 82.81
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 82.74
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 82.6
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 82.56
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 82.52
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 82.46
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 82.46
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 82.38
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 82.36
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 82.94
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 82.18
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 82.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 81.96
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 81.94
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 81.82
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 81.64
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 81.63
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 81.38
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 81.38
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 81.37
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 81.35
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 81.3
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 80.93
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 80.92
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 80.81
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 80.78
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 80.71
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 80.63
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 80.51
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 80.45
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 80.44
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 80.41
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 80.41
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 80.33
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 80.11
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 80.08
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 80.02
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
Probab=100.00  E-value=6.5e-56  Score=389.28  Aligned_cols=249  Identities=56%  Similarity=0.888  Sum_probs=225.6

Q ss_pred             CcEEEEEccCHHHHHHHHHHHcCCCceeEEeeee----------eeccccccccccceeecCCeeEEECCEEEEEeecCC
Q 025368            3 KVKIGINGFGRIGRLVARVILQRDDVELVATYMF----------KYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRN   72 (254)
Q Consensus         3 ~~~V~IvG~G~~G~~l~~~L~~~p~~~v~~~~~~----------~~~s~~g~~~~~~v~~~~g~~l~~~~~~~~~~~~~~   72 (254)
                      |+||||+|+||+|++++|+|.+||+++++++..+          +||+.+|++. +.+....+ .+.++|+.+.++++.+
T Consensus         1 mikVgI~G~G~iGr~l~R~l~~~~~veivain~~~~~~~~~~ll~~ds~~G~~~-~~v~~~~~-~l~v~g~~i~v~~~~d   78 (334)
T 3cmc_O            1 AVKVGINGFGRIGRNVFRAALKNPDIEVVAVNDLTDANTLAHLLKYDSVHGRLD-AEVSVNGN-NLVVNGKEIIVKAERD   78 (334)
T ss_dssp             CEEEEEESCSHHHHHHHHHHTTCTTEEEEEEECSSCHHHHHHHHHEETTTEECS-SCEEEETT-EEEETTEEEEEECCSS
T ss_pred             CeEEEEECCCHHHHHHHHHHhCCCCeEEEEEeCCCCHHHHHHHhccCCcCCCcC-ceEEEccC-cEEECCEEEEEEecCC
Confidence            3799999999999999999999999999988654          5688999987 66665444 7878888888876668


Q ss_pred             CCCCCcccCCCcEEEEecCCccCHHHHHHHHHCCCCeEEecCCCCC-CCeEEeeeCcccccC-CCCeEEcCChhhHhHHH
Q 025368           73 PEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKD-APMFVVGVNENEYKP-ELNIVSNASCTTNCLAP  150 (254)
Q Consensus        73 ~~~~~~~~~~~Dvv~~a~~~~~s~~~~~~~~~~G~~~~viS~~~~~-~~~~v~~vn~~~i~~-~~~iVa~p~C~~t~~~l  150 (254)
                      +++++|...++|+||+|+|++.+++.++.++++|+|++|||+..++ .|++|||+|+++|++ ..++|+||||++|++++
T Consensus        79 p~~i~w~~~~vDvV~~atg~~~s~e~a~~~l~~Gak~vVId~pa~d~~p~~V~eVN~~~i~~~~~~IIsNpsCttn~lap  158 (334)
T 3cmc_O           79 PENLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKNEDITIVMGVNQDKYDPKAHHVISNASCTTNCLAP  158 (334)
T ss_dssp             GGGCCTGGGTCCEEEECSSSCCBHHHHTHHHHTTCSEEEESSCCBSCSEECCTTTSGGGCCTTTCCEEECCCHHHHHHHH
T ss_pred             hhhcCcccCccCEEEECCCchhhHHHHHHHHHCCCCEEEEeCCCccCCCEeccccCHHHhCccCCeEEECCChHHHHHHH
Confidence            8889996558999999999999999999999999999999776444 689999999999984 37899999999999999


Q ss_pred             HHHHHhhhcCeeEEEEEeeeeccccccccCCCCCCCccccccccceeeccCCChhhhhhhhcccCCCceeEEEEEceeCc
Q 025368          151 LAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVD  230 (254)
Q Consensus       151 ~l~pL~~~~~i~~~~v~~~~~~sg~~~~~d~~~~~~~~~~~~~~~n~~p~~~~~~~e~~~~l~~~~~~v~~~~~~vP~~r  230 (254)
                      +|+||+++++|+++.++|+|++||+++..|++ +.+++++|++++|++|+.+||++|+.++||+++++++++|+|||++|
T Consensus       159 ~lkpL~~~~gI~~~~mtTvha~Sg~q~~~d~~-~~~~r~~r~~a~NiiP~~tg~a~ei~kvlp~l~gkl~~~a~rVP~~~  237 (334)
T 3cmc_O          159 FAKVLHEQFGIVRGMMTTVHSYTNDQRILDLP-HKDLRRARAAAESIIPTTTGAAKAVALVLPELKGKLNGMAMRVPTPN  237 (334)
T ss_dssp             HHHHHHHHHCEEEEEEEEEEECCTTSBSSSCC-CSSTTTTSBTTTCCEEEECSHHHHHHHHCGGGTTTEEEEEEEESCSS
T ss_pred             HHHHHHHhcCceeeeEEEEEeccchhhhcccc-ccccccchhhhhCEEeeccCcccchhhhChhhcCcEEEEEEEECCCC
Confidence            99999999999999999999999999999987 47899999999999999999999999999999999999999999999


Q ss_pred             eeEEEEEEEecCCCCHHHHHHHhC
Q 025368          231 VSVVDLTVRLEKDASYDEIKAAIK  254 (254)
Q Consensus       231 G~~~~~~~~~~~~~~~~~v~~~~~  254 (254)
                      ||+.++|++++++++.||++++|+
T Consensus       238 gs~~~l~~~l~k~~t~eei~~~lk  261 (334)
T 3cmc_O          238 VSVVDLVAELEKEVTVEEVNAALK  261 (334)
T ss_dssp             CEEEEEEEEESSCCCHHHHHHHHH
T ss_pred             EEEEEEEEEECCCCCHHHHHHHHH
Confidence            999999999999999999999874
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 254
d1u8fo2164 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de 3e-63
d1u8fo1169 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp 6e-63
d1dssg1169 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp 2e-60
d3cmco2163 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de 9e-60
d1rm4a1172 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp 4e-59
d1rm4a2163 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de 5e-58
d1gado1166 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp 8e-57
d1hdgo1169 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp 2e-56
d3cmco1171 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp 4e-55
d2b4ro1166 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp 3e-53
d1obfo2162 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de 9e-53
d2g82a2162 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de 4e-52
d1k3ta1190 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp 5e-52
d1cf2o1171 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp 7e-52
d1k3ta2169 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de 2e-50
d2czca2172 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp 2e-46
d2g82a1168 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp 8e-46
d1obfo1173 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp 3e-45
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 8e-41
d1cf2o2165 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de 9e-36
d1b7go2162 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de 2e-35
d2czca1162 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate de 3e-07
d1f06a1170 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid de 2e-06
d1ydwa1184 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductas 2e-04
d1nvmb1157 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydroge 3e-04
d1tlta1164 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM 5e-04
d1lc0a1172 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase { 5e-04
d1vkna1176 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamy 8e-04
d2cvoa1183 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde 0.002
d2g17a1179 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamy 0.002
d1diha1162 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate re 0.003
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Human(Homo sapiens), liver isoform [TaxId: 9606]

 Score =  193 bits (491), Expect = 3e-63
 Identities = 92/112 (82%), Positives = 98/112 (87%)

Query: 143 CTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSST 202
           CTTNCLAPLAKVIHD FGIVEGLMTTVH+ITATQKTVDGPS K WR GR A  NIIP+ST
Sbjct: 1   CTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPAST 60

Query: 203 GAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK 254
           GAAKAVGKV+P LNGKLTGMAFRVPT +VSVVDLT RLEK A YD+IK  +K
Sbjct: 61  GAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVK 112
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 Back     information, alignment and structure
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 162 Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Length = 170 Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 184 Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Length = 157 Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 172 Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Length = 176 Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Length = 183 Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Length = 179 Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.96
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.96
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.96
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.95
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.95
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.95
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.94
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.94
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.94
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.94
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.94
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.88
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.87
d1u8fo2164 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.85
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.85
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.84
d3cmco2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.84
d1mb4a2222 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.84
d1k3ta2169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.84
d1t4ba2221 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.84
d2g82a2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.84
d1obfo2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.84
d1rm4a2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.84
d2hjsa2190 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.84
d2gz1a2202 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.77
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.77
d2g17a2155 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.76
d1cf2o2165 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.73
d2cvoa2165 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.73
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 99.72
d1vkna2163 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.71
d1b7go2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.68
d2czca1162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.55
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.98
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 98.81
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 98.39
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 98.34
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 98.31
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 98.14
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 98.11
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 98.01
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.91
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.84
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.68
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 97.64
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 97.61
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 97.57
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 97.1
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.04
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.99
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.83
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 96.82
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.71
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 96.58
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.55
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.54
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.41
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 96.25
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.17
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.07
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 95.99
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 95.93
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.75
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 95.72
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.72
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.64
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.63
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 95.62
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 95.45
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.37
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.36
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.1
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.0
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.79
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.75
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 94.6
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 94.25
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.14
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.1
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.99
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.97
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.46
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.19
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.02
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 93.0
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.86
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 92.84
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 92.79
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 92.66
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 92.6
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 92.27
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 92.04
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 91.87
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 91.82
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.8
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 91.73
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 91.73
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.71
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 91.59
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.53
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 91.52
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 91.47
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.45
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.33
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.21
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.19
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 91.1
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 91.04
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 90.79
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 90.68
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 90.56
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 90.29
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 90.16
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.13
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 90.1
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.07
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 90.04
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 89.98
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 89.91
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 89.44
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 89.42
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 89.01
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 88.91
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.9
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.89
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 88.87
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 88.8
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 88.79
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 88.79
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 88.63
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 88.54
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 88.38
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.25
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 87.54
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 87.44
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 87.42
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 87.34
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 87.26
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.04
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 86.96
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 86.72
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 86.59
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 86.5
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 86.21
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 86.1
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 86.05
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 85.93
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 85.83
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 85.73
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 85.73
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 85.64
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 85.58
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 85.3
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 85.3
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 85.21
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 85.15
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 85.09
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 84.99
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 84.94
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 84.21
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 84.16
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 83.99
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 83.82
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 83.63
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 83.41
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 83.14
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 82.81
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 82.65
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 82.62
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 82.47
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 82.43
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 81.62
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 81.6
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 81.58
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 81.58
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 81.11
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 80.74
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 80.73
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 80.15
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 80.1
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=1.9e-31  Score=208.44  Aligned_cols=152  Identities=45%  Similarity=0.783  Sum_probs=138.7

Q ss_pred             CcEEEEEccCHHHHHHHHHHHcCCCceeEEe----------eeeeeccccccccccceeecCCeeEEECCEEEEEeecCC
Q 025368            3 KVKIGINGFGRIGRLVARVILQRDDVELVAT----------YMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRN   72 (254)
Q Consensus         3 ~~~V~IvG~G~~G~~l~~~L~~~p~~~v~~~----------~~~~~~s~~g~~~~~~v~~~~g~~l~~~~~~~~~~~~~~   72 (254)
                      ++||||+|+|++|+.++|++.++|+++++++          ++++|||.||+|. ..+..+.+ .+.++|+.+.++...+
T Consensus         1 tikigINGFGRIGR~v~R~~~~~~~i~ivaINd~~~~~~~ayLl~yDSvhG~~~-~~v~~~~~-~l~ing~~I~i~~~~~   78 (166)
T d1gado1           1 TIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTHGRFD-GTVEVKDG-HLIVNGKKIRVTAERD   78 (166)
T ss_dssp             CEEEEEECCSHHHHHHHHHHHTCSSEEEEEEECSSCHHHHHHHHHCCTTTCSCS-SCEEEETT-EEEETTEEEEEECCSS
T ss_pred             CeEEEEECCcHHHHHHHHHHhhCCCeEEEEEeCCCCHHHHhhhheecCCCCCcC-CeEEEeCC-EEEECCEEEEEEeCCC
Confidence            3799999999999999999999999999984          6678899999998 88877665 7889999999998888


Q ss_pred             CCCCCcccCCCcEEEEecCCccCHHHHHHHHHCCCCeEEecCCCCC-CCeEEeeeCcccccCCCCeEEcCChhhHhHHHH
Q 025368           73 PEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKD-APMFVVGVNENEYKPELNIVSNASCTTNCLAPL  151 (254)
Q Consensus        73 ~~~~~~~~~~~Dvv~~a~~~~~s~~~~~~~~~~G~~~~viS~~~~~-~~~~v~~vn~~~i~~~~~iVa~p~C~~t~~~l~  151 (254)
                      |++++|...++|+|++|||.+.+++.++.++++|+|+|++|++.+| .+++|||+|++.+++ .++|++++|+++|+++.
T Consensus        79 p~~i~W~~~gvDiViEcTG~f~t~~~~~~hl~~gakkViiSaP~~d~~~~iV~GvN~~~~~~-~~iiS~aSCTTnclaPv  157 (166)
T d1gado1          79 PANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAG-QDIVSNASNETGYSNKV  157 (166)
T ss_dssp             GGGGCHHHHTCSEEEECSSSCCSHHHHTHHHHTTCSEEEESSCCSSSCCBCCTTTTGGGCCS-CSEEECCCTTHHHHHHH
T ss_pred             hHHCCccccCCCEEEEccccccCHHHHHHHhcCCCceEEeeccccccCCEEEeCccccccCC-CCEEEeccHHHhHHHHH
Confidence            9999998779999999999999999999999999999999999655 789999999999986 78999999999999999


Q ss_pred             HHHHhh
Q 025368          152 AKVIHD  157 (254)
Q Consensus       152 l~pL~~  157 (254)
                      ++.|.+
T Consensus       158 ~kvl~~  163 (166)
T d1gado1         158 LDLIAH  163 (166)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            998864
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2cvoa2 d.81.1.1 (A:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure