Citrus Sinensis ID: 025540

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGFHVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFIDIIKSAELK
ccccccEEccccccccHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHcccccEEEEEcccccccccccccccHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHcccHHHHHHHHHHHHHHccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHccccEEEccccccccHHHHHccccccccccccccccHHHHHHHHHcccc
cccccEEEEEccEcccHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHcccccEEEEccccccccEcccccccHHHHHHccccEEEEccHHHHHHccccHHHHHHHHHHHHHcccEEEEEEcccHHHHHcccHHHHHHHHHHcccccccccccEEEEEccHHHccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHccEEEccccccccHHHHHccccccEEEEcHHHHcccHHHHHHccccc
mgrkffvggnwkcngtpeEVKKIVSVLnegqvpssdvvevvvspPFVFLGLVKsslrpgfhvaaqncwvkkggaftGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGEtleqreagsTMDVVAAQTKAIADRVSSWSNIvlayepvwaigtgkvatpaqAQEVHFELRKWLLANTSPEIAAATRIIyggsvnganckelaaqpdvdgflvggaslkpeFIDIIKSAELK
mgrkffvggnwkcngtpeEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGFHVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFIDIIKSAELK
MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQvpssdvvevvvsppfvFLGLVKSSLRPGFHVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFIDIIKSAELK
****FFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGFHVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTG************FELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFIDII******
*GRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGFHVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFIDIIKSAE**
MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGFHVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFIDIIKSAELK
**RKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGFHVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFIDIIKSAE**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGFHVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFIDIIKSAELK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
P48495254 Triosephosphate isomerase N/A no 1.0 0.988 0.856 1e-125
P48491254 Triosephosphate isomerase yes no 1.0 0.988 0.848 1e-123
P12863253 Triosephosphate isomerase N/A no 1.0 0.992 0.832 1e-121
P48494253 Triosephosphate isomerase yes no 1.0 0.992 0.820 1e-120
P46226253 Triosephosphate isomerase N/A no 1.0 0.992 0.788 1e-114
P21820253 Triosephosphate isomerase N/A no 1.0 0.992 0.824 1e-110
P34937253 Triosephosphate isomerase N/A no 1.0 0.992 0.784 1e-104
P48493195 Triosephosphate isomerase N/A no 0.764 0.984 0.828 3e-91
P48497257 Triosephosphate isomerase N/A no 1.0 0.976 0.671 1e-90
P48496322 Triosephosphate isomerase N/A no 0.980 0.763 0.638 3e-88
>sp|P48495|TPIS_PETHY Triosephosphate isomerase, cytosolic OS=Petunia hybrida GN=TPIP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  447 bits (1151), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/251 (85%), Positives = 231/251 (92%)

Query: 1   MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGF 60
           MGRKFFVGGNWKCNGT EEVKKI++ LN   VPS DVVEVVVSPP+VFL LVK+ LRP F
Sbjct: 1   MGRKFFVGGNWKCNGTAEEVKKILATLNAADVPSQDVVEVVVSPPYVFLPLVKNELRPDF 60

Query: 61  HVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQ 120
           HVAAQNCWVKKGGAFTGE+SAEMLVNL IPWVILGHSERR +L E NEFVGDKVAYALSQ
Sbjct: 61  HVAAQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRALLGESNEFVGDKVAYALSQ 120

Query: 121 GLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPA 180
           GLKVIACVGETLE+RE+GSTMDVVAAQTKAIADRV  W+N+V+AYEPVWAIGTGKVA+PA
Sbjct: 121 GLKVIACVGETLEERESGSTMDVVAAQTKAIADRVKDWTNVVVAYEPVWAIGTGKVASPA 180

Query: 181 QAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPE 240
           QAQEVH ELRKWL AN SPE+AA+TRIIYGGSVNGANCKEL  QPDVDGFLVGGASLKPE
Sbjct: 181 QAQEVHAELRKWLAANVSPEVAASTRIIYGGSVNGANCKELGGQPDVDGFLVGGASLKPE 240

Query: 241 FIDIIKSAELK 251
           FIDIIK+AE+K
Sbjct: 241 FIDIIKAAEVK 251

Petunia hybrida (taxid: 4102)
EC: 5EC: .EC: 3EC: .EC: 1EC: .EC: 1
>sp|P48491|TPIS_ARATH Triosephosphate isomerase, cytosolic OS=Arabidopsis thaliana GN=CTIMC PE=1 SV=2 Back     alignment and function description
>sp|P12863|TPIS_MAIZE Triosephosphate isomerase, cytosolic OS=Zea mays PE=3 SV=3 Back     alignment and function description
>sp|P48494|TPIS_ORYSJ Triosephosphate isomerase, cytosolic OS=Oryza sativa subsp. japonica GN=TPI PE=1 SV=3 Back     alignment and function description
>sp|P46226|TPIS_SECCE Triosephosphate isomerase, cytosolic OS=Secale cereale PE=2 SV=3 Back     alignment and function description
>sp|P21820|TPIS_COPJA Triosephosphate isomerase, cytosolic OS=Coptis japonica PE=2 SV=1 Back     alignment and function description
>sp|P34937|TPIS_HORVU Triosephosphate isomerase, cytosolic OS=Hordeum vulgare PE=1 SV=3 Back     alignment and function description
>sp|P48493|TPIS_LACSA Triosephosphate isomerase, cytosolic (Fragment) OS=Lactuca sativa PE=2 SV=1 Back     alignment and function description
>sp|P48497|TPIS_STELP Triosephosphate isomerase, cytosolic OS=Stellaria longipes GN=TPI PE=2 SV=1 Back     alignment and function description
>sp|P48496|TPIC_SPIOL Triosephosphate isomerase, chloroplastic OS=Spinacia oleracea GN=TPIP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
255584863254 triosephosphate isomerase, putative [Ric 1.0 0.988 0.876 1e-126
147784332254 hypothetical protein VITISV_041523 [Viti 1.0 0.988 0.876 1e-125
225449541254 PREDICTED: triosephosphate isomerase, cy 1.0 0.988 0.876 1e-124
390098824254 triose phosphate isomerase cytosolic iso 1.0 0.988 0.864 1e-124
192910674254 triose phosphate isomerase cytosolic iso 1.0 0.988 0.852 1e-124
1351279254 RecName: Full=Triosephosphate isomerase, 1.0 0.988 0.856 1e-123
211906460254 triosephosphate isomerase [Gossypium hir 1.0 0.988 0.860 1e-123
77745458254 triose phosphate isomerase cytosolic iso 1.0 0.988 0.860 1e-123
297816838254 predicted protein [Arabidopsis lyrata su 1.0 0.988 0.852 1e-122
38112662254 triose phosphate isomerase cytosolic iso 1.0 0.988 0.856 1e-122
>gi|255584863|ref|XP_002533147.1| triosephosphate isomerase, putative [Ricinus communis] gi|223527042|gb|EEF29228.1| triosephosphate isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 220/251 (87%), Positives = 233/251 (92%)

Query: 1   MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGF 60
           M RKFFVGGNWKCNGT EEVKKIVS LNEG VPSSDVVEVV+SPPFVFL LVK SL+P F
Sbjct: 1   MARKFFVGGNWKCNGTSEEVKKIVSTLNEGHVPSSDVVEVVISPPFVFLPLVKDSLKPDF 60

Query: 61  HVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQ 120
           HVAAQNCWVKKGGAFTGE+SAEMLVNL IPWVILGHSERRL+L+E NEFVGDKVAYALSQ
Sbjct: 61  HVAAQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRLLLSESNEFVGDKVAYALSQ 120

Query: 121 GLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPA 180
           GLKVIACVGETLEQREAGSTMDVVAAQTKAIA+RV  W+++VLAYEPVWAIGTGKVATPA
Sbjct: 121 GLKVIACVGETLEQREAGSTMDVVAAQTKAIAERVKDWADVVLAYEPVWAIGTGKVATPA 180

Query: 181 QAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPE 240
           QAQEVHFELRKWL  NTS ++AA TRIIYGGSV   NCKELAAQPDVDGFLVGGASLKPE
Sbjct: 181 QAQEVHFELRKWLKENTSSQVAATTRIIYGGSVTATNCKELAAQPDVDGFLVGGASLKPE 240

Query: 241 FIDIIKSAELK 251
           FI+IIKSAE+K
Sbjct: 241 FIEIIKSAEVK 251

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147784332|emb|CAN70587.1| hypothetical protein VITISV_041523 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449541|ref|XP_002283693.1| PREDICTED: triosephosphate isomerase, cytosolic [Vitis vinifera] gi|296086243|emb|CBI31684.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|390098824|gb|AFL48185.1| triose phosphate isomerase cytosolic isoform-like protein [Capsicum annuum] Back     alignment and taxonomy information
>gi|192910674|gb|ACF06445.1| triose phosphate isomerase cytosolic isoform [Elaeis guineensis] Back     alignment and taxonomy information
>gi|1351279|sp|P48495.1|TPIS_PETHY RecName: Full=Triosephosphate isomerase, cytosolic; Short=TIM; Short=Triose-phosphate isomerase gi|602590|emb|CAA58230.1| triosephosphate isomerase [Petunia x hybrida] Back     alignment and taxonomy information
>gi|211906460|gb|ACJ11723.1| triosephosphate isomerase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|77745458|gb|ABB02628.1| triose phosphate isomerase cytosolic isoform-like [Solanum tuberosum] Back     alignment and taxonomy information
>gi|297816838|ref|XP_002876302.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322140|gb|EFH52561.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|38112662|gb|AAR11379.1| triose phosphate isomerase cytosolic isoform [Solanum chacoense] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2099906254 TPI "triosephosphate isomerase 1.0 0.988 0.792 2.3e-103
TAIR|locus:2047072315 TIM "triosephosphate isomerase 0.980 0.780 0.598 6.5e-74
UNIPROTKB|P60174286 TPI1 "Triosephosphate isomeras 0.976 0.856 0.566 6.1e-71
UNIPROTKB|Q5E956249 TPI1 "Triosephosphate isomeras 0.976 0.983 0.566 7.7e-71
ZFIN|ZDB-GENE-020416-4248 tpi1b "triosephosphate isomera 0.972 0.983 0.573 1.3e-70
UNIPROTKB|D0G7F6248 TPI1 "Triosephosphate isomeras 0.968 0.979 0.567 2.6e-70
RGD|3896249 Tpi1 "triosephosphate isomeras 0.976 0.983 0.574 3.3e-70
UNIPROTKB|P54714249 TPI1 "Triosephosphate isomeras 0.976 0.983 0.562 4.3e-70
MGI|MGI:98797299 Tpi1 "triosephosphate isomeras 0.976 0.819 0.562 5.5e-70
ZFIN|ZDB-GENE-020416-3248 tpi1a "triosephosphate isomera 0.968 0.979 0.579 1.1e-69
TAIR|locus:2099906 TPI "triosephosphate isomerase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1024 (365.5 bits), Expect = 2.3e-103, P = 2.3e-103
 Identities = 199/251 (79%), Positives = 215/251 (85%)

Query:     1 MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQXXXXXXXXXXXXXXXXFLGLVKSSLRPGF 60
             M RKFFVGGNWKCNGT EEVKKIV+ LNE Q                FL LVKS+LR  F
Sbjct:     1 MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDF 60

Query:    61 HVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQ 120
              VAAQNCWVKKGGAFTGE+SAEMLVNL+IPWVILGHSERR ILNE +EFVGDKVAYAL+Q
Sbjct:    61 FVAAQNCWVKKGGAFTGEVSAEMLVNLDIPWVILGHSERRAILNESSEFVGDKVAYALAQ 120

Query:   121 GLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPA 180
             GLKVIACVGETLE+REAGSTMDVVAAQTKAIADRV++WSN+V+AYEPVWAIGTGKVA+PA
Sbjct:   121 GLKVIACVGETLEEREAGSTMDVVAAQTKAIADRVTNWSNVVIAYEPVWAIGTGKVASPA 180

Query:   181 QAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPE 240
             QAQEVH ELRKWL  N S ++AA TRIIYGGSVNG NCKEL  Q DVDGFLVGGASLKPE
Sbjct:   181 QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE 240

Query:   241 FIDIIKSAELK 251
             FIDIIK+AE+K
Sbjct:   241 FIDIIKAAEVK 251
GO:0003824 "catalytic activity" evidence=IEA
GO:0004807 "triose-phosphate isomerase activity" evidence=IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005829 "cytosol" evidence=ISS;IDA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0006096 "glycolysis" evidence=IC;RCA
GO:0044262 "cellular carbohydrate metabolic process" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0009507 "chloroplast" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0010043 "response to zinc ion" evidence=IEP
GO:0005507 "copper ion binding" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009060 "aerobic respiration" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
TAIR|locus:2047072 TIM "triosephosphate isomerase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P60174 TPI1 "Triosephosphate isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E956 TPI1 "Triosephosphate isomerase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020416-4 tpi1b "triosephosphate isomerase 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D0G7F6 TPI1 "Triosephosphate isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|3896 Tpi1 "triosephosphate isomerase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P54714 TPI1 "Triosephosphate isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:98797 Tpi1 "triosephosphate isomerase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020416-3 tpi1a "triosephosphate isomerase 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2QD07TPIS_GORGO5, ., 3, ., 1, ., 10.58700.97600.9839N/Ano
Q12574TPIS_COPC75, ., 3, ., 1, ., 10.5440.97600.9760N/Ano
Q6BMB8TPIS_DEBHA5, ., 3, ., 1, ., 10.55240.97600.9879yesno
Q29371TPIS_PIG5, ., 3, ., 1, ., 10.57550.96810.9798yesno
P82204TPIS_BOMMO5, ., 3, ., 1, ., 10.5760.98400.9959N/Ano
Q27775TPIS_SCHJA5, ., 3, ., 1, ., 10.5680.97600.9722N/Ano
P07669TPIS_SCHPO5, ., 3, ., 1, ., 10.540.99201.0yesno
P48501TPIS_SCHMA5, ., 3, ., 1, ., 10.5640.97600.9683N/Ano
P21820TPIS_COPJA5, ., 3, ., 1, ., 10.82471.00.9920N/Ano
P00941TPIS_LATCH5, ., 3, ., 1, ., 10.57260.95210.9676N/Ano
P00940TPIS_CHICK5, ., 3, ., 1, ., 10.58770.96810.9798yesno
Q7ZWN5TPIS_XENLA5, ., 3, ., 1, ., 10.57550.96810.9798N/Ano
P60174TPIS_HUMAN5, ., 3, ., 1, ., 10.59510.97600.8566yesno
P60175TPIS_PANTR5, ., 3, ., 1, ., 10.59510.97600.9839yesno
Q589R5TPIS_ORYLA5, ., 3, ., 1, ., 10.58360.96810.9798N/Ano
Q60HC9TPIS_MACFA5, ., 3, ., 1, ., 10.59510.97600.9839N/Ano
B0BM40TPIS_XENTR5, ., 3, ., 1, ., 10.58290.97600.9879yesno
Q5E956TPIS_BOVIN5, ., 3, ., 1, ., 10.59510.97600.9839yesno
Q5R928TPIS_PONAB5, ., 3, ., 1, ., 10.59510.97600.9839yesno
Q9HGY8TPIS_ASPOR5, ., 3, ., 1, ., 10.54980.97600.9760yesno
P46225TPIC_SECCE5, ., 3, ., 1, ., 10.62240.98000.8255N/Ano
P46226TPIS_SECCE5, ., 3, ., 1, ., 10.78881.00.9920N/Ano
P29613TPIS_DROME5, ., 3, ., 1, ., 10.53810.98401.0yesno
O77458TPIS_DROYA5, ., 3, ., 1, ., 10.54210.98401.0N/Ano
Q70JN8TPIS_KLUMA5, ., 3, ., 1, ., 10.51200.97600.9879N/Ano
P12863TPIS_MAIZE5, ., 3, ., 1, ., 10.83261.00.9920N/Ano
Q9P940TPIS_CANAL5, ., 3, ., 1, ., 10.52410.97600.9879N/Ano
P30741TPIS_CULTA5, ., 3, ., 1, ., 10.61040.98401.0N/Ano
P54714TPIS_CANFA5, ., 3, ., 1, ., 10.59100.97600.9839yesno
Q7S2Z9TPIS_NEUCR5, ., 3, ., 1, ., 10.55640.97600.9879N/Ano
P15426TPIS_MACMU5, ., 3, ., 1, ., 10.59510.97600.9839yesno
Q7JNS1TPIS_DROSI5, ., 3, ., 1, ., 10.54210.98401.0N/Ano
P04828TPIS_EMENI5, ., 3, ., 1, ., 10.55820.97600.9839yesno
Q90XG0TPISB_DANRE5, ., 3, ., 1, ., 10.58940.97210.9838yesno
Q10657TPIS_CAEEL5, ., 3, ., 1, ., 10.56270.97600.9919yesno
P17751TPIS_MOUSE5, ., 3, ., 1, ., 10.59100.97600.8193yesno
P48495TPIS_PETHY5, ., 3, ., 1, ., 10.85651.00.9881N/Ano
P48494TPIS_ORYSJ5, ., 3, ., 1, ., 10.82071.00.9920yesno
P48497TPIS_STELP5, ., 3, ., 1, ., 10.67191.00.9766N/Ano
P48491TPIS_ARATH5, ., 3, ., 1, ., 10.84861.00.9881yesno
P48493TPIS_LACSA5, ., 3, ., 1, ., 10.82810.76490.9846N/Ano
P34937TPIS_HORVU5, ., 3, ., 1, ., 10.78481.00.9920N/Ano
P48499TPIS_LEIME5, ., 3, ., 1, ., 10.55550.94420.9442N/Ano
Q96VN5TPIS_PARBA5, ., 3, ., 1, ., 10.54610.97600.9839N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.1.10.994
3rd Layer5.3.10.998

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018496001
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (254 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00035677001
RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (401 aa)
•••• •• 0.998
GSVIVG00035675001
RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (405 aa)
•••• •• 0.998
GSVIVG00035097001
SubName- Full=Chromosome chr1 scaffold_75, whole genome shotgun sequence; (342 aa)
•• • •• 0.975
GSVIVG00020570001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (337 aa)
•• • •• 0.975
GAPDH
SubName- Full=Chromosome chr17 scaffold_246, whole genome shotgun sequence; (317 aa)
•• • •• 0.972
GSVIVG00002074001
SubName- Full=Chromosome chr19 scaffold_126, whole genome shotgun sequence; (429 aa)
•• • •• 0.965
GSVIVG00014624001
RecName- Full=Glucose-6-phosphate isomerase; EC=5.3.1.9; (340 aa)
   • •• 0.962
GSVIVG00002909001
SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (453 aa)
•    •• 0.957
GSVIVG00038435001
SubName- Full=Chromosome chr16 scaffold_94, whole genome shotgun sequence; (620 aa)
•    •• 0.951
GSVIVG00026404001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (620 aa)
•    •• 0.950

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
PLN02561253 PLN02561, PLN02561, triosephosphate isomerase 0.0
PTZ00333255 PTZ00333, PTZ00333, triosephosphate isomerase; Pro 1e-136
cd00311242 cd00311, TIM, Triosephosphate isomerase (TIM) is a 1e-122
PRK00042250 PRK00042, tpiA, triosephosphate isomerase; Provisi 1e-114
pfam00121242 pfam00121, TIM, Triosephosphate isomerase 1e-109
COG0149251 COG0149, TpiA, Triosephosphate isomerase [Carbohyd 1e-101
PLN02429315 PLN02429, PLN02429, triosephosphate isomerase 3e-95
PRK13962645 PRK13962, PRK13962, bifunctional phosphoglycerate 2e-75
TIGR00419205 TIGR00419, tim, triosephosphate isomerase 1e-71
PRK14566260 PRK14566, PRK14566, triosephosphate isomerase; Pro 4e-68
PRK14565237 PRK14565, PRK14565, triosephosphate isomerase; Pro 7e-53
PRK14567253 PRK14567, PRK14567, triosephosphate isomerase; Pro 2e-51
PRK14905355 PRK14905, PRK14905, triosephosphate isomerase/PTS 4e-37
PRK15492260 PRK15492, PRK15492, triosephosphate isomerase; Pro 4e-31
PRK04302223 PRK04302, PRK04302, triosephosphate isomerase; Pro 1e-08
>gnl|CDD|178175 PLN02561, PLN02561, triosephosphate isomerase Back     alignment and domain information 
 Score =  508 bits (1311), Expect = 0.0
 Identities = 221/251 (88%), Positives = 230/251 (91%)

Query: 1   MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGF 60
           M RKFFVGGNWKCNGT EEVKKIV+ LNE +VPS DVVEVVVSPPFVFL LVKS LRP F
Sbjct: 1   MARKFFVGGNWKCNGTVEEVKKIVTTLNEAEVPSEDVVEVVVSPPFVFLPLVKSLLRPDF 60

Query: 61  HVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQ 120
            VAAQNCWVKKGGAFTGEISAEMLVNL IPWVILGHSERR +L E NEFVGDKVAYALSQ
Sbjct: 61  QVAAQNCWVKKGGAFTGEISAEMLVNLGIPWVILGHSERRALLGESNEFVGDKVAYALSQ 120

Query: 121 GLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPA 180
           GLKVIACVGETLEQRE+GSTMDVVAAQTKAIAD+VS W+N+VLAYEPVWAIGTGKVATPA
Sbjct: 121 GLKVIACVGETLEQRESGSTMDVVAAQTKAIADKVSDWANVVLAYEPVWAIGTGKVATPA 180

Query: 181 QAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPE 240
           QAQEVH ELRKWL  N SPE+AA TRIIYGGSV GANCKELAAQPDVDGFLVGGASLKPE
Sbjct: 181 QAQEVHDELRKWLHKNVSPEVAATTRIIYGGSVTGANCKELAAQPDVDGFLVGGASLKPE 240

Query: 241 FIDIIKSAELK 251
           FIDIIKSA +K
Sbjct: 241 FIDIIKSATVK 251

Length = 253
>gnl|CDD|240365 PTZ00333, PTZ00333, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|238190 cd00311, TIM, Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>gnl|CDD|234589 PRK00042, tpiA, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|215732 pfam00121, TIM, Triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|223227 COG0149, TpiA, Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|166070 PLN02429, PLN02429, triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|237572 PRK13962, PRK13962, bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|129513 TIGR00419, tim, triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|184749 PRK14566, PRK14566, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|237758 PRK14565, PRK14565, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|173031 PRK14567, PRK14567, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|184898 PRK14905, PRK14905, triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>gnl|CDD|185389 PRK15492, PRK15492, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|235274 PRK04302, PRK04302, triosephosphate isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
KOG1643247 consensus Triosephosphate isomerase [Carbohydrate 100.0
PLN02561253 triosephosphate isomerase 100.0
PRK14567253 triosephosphate isomerase; Provisional 100.0
PRK14566260 triosephosphate isomerase; Provisional 100.0
PRK15492260 triosephosphate isomerase; Provisional 100.0
PTZ00333255 triosephosphate isomerase; Provisional 100.0
PF00121244 TIM: Triosephosphate isomerase; InterPro: IPR00065 100.0
PRK00042250 tpiA triosephosphate isomerase; Provisional 100.0
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate trans 100.0
PLN02429315 triosephosphate isomerase 100.0
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 100.0
PRK14905355 triosephosphate isomerase/PTS system glucose/sucro 100.0
PRK14565237 triosephosphate isomerase; Provisional 100.0
PRK13962645 bifunctional phosphoglycerate kinase/triosephospha 100.0
TIGR00419205 tim triosephosphate isomerase. Triosephosphate iso 100.0
PRK04302223 triosephosphate isomerase; Provisional 100.0
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 98.47
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 98.44
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 98.14
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 98.11
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 97.99
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 97.99
PRK00208250 thiG thiazole synthase; Reviewed 97.99
PLN02591250 tryptophan synthase 97.94
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 97.94
PRK05581220 ribulose-phosphate 3-epimerase; Validated 97.7
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 97.63
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 97.62
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 97.57
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 97.53
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 97.42
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 97.37
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 97.23
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 97.13
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 97.01
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 96.75
PLN02334229 ribulose-phosphate 3-epimerase 96.57
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 96.53
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 96.37
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 96.32
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 96.27
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 96.14
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 95.95
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 95.94
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 95.91
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 95.86
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 95.71
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.65
PRK08091228 ribulose-phosphate 3-epimerase; Validated 95.53
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 95.27
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 95.13
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 95.12
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 94.82
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 94.81
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 94.77
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 94.77
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 94.68
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 94.68
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 94.51
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 94.39
cd02812219 PcrB_like PcrB_like proteins. One member of this f 94.26
PRK14057254 epimerase; Provisional 94.16
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.88
CHL00162267 thiG thiamin biosynthesis protein G; Validated 93.79
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 93.76
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 93.71
PRK14024241 phosphoribosyl isomerase A; Provisional 93.45
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 93.34
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 93.34
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 93.26
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 92.74
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 92.71
PRK04128 228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 92.66
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 92.63
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 92.5
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 92.36
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 92.34
PRK08508279 biotin synthase; Provisional 92.31
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 92.26
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 92.26
TIGR03572 232 WbuZ glycosyl amidation-associated protein WbuZ. T 92.15
PRK06256336 biotin synthase; Validated 91.91
cd04731 243 HisF The cyclase subunit of imidazoleglycerol phos 91.88
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 91.76
COG1411229 Uncharacterized protein related to proFAR isomeras 91.39
PRK08005210 epimerase; Validated 91.25
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 91.22
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 91.09
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 91.08
TIGR00007 230 phosphoribosylformimino-5-aminoimidazole carboxami 90.98
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 90.92
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 90.77
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 90.55
PRK00748 233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 90.39
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 90.38
TIGR00735 254 hisF imidazoleglycerol phosphate synthase, cyclase 89.85
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 89.24
TIGR02129 253 hisA_euk phosphoribosylformimino-5-aminoimidazole 89.18
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 88.88
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 88.73
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 87.86
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 87.31
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 87.31
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 87.23
PRK01033 258 imidazole glycerol phosphate synthase subunit HisF 87.17
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 87.01
PLN02389379 biotin synthase 86.8
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 86.75
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 86.7
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 86.64
PRK07226267 fructose-bisphosphate aldolase; Provisional 85.95
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 85.88
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 85.48
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 85.35
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 85.32
PRK02083 253 imidazole glycerol phosphate synthase subunit HisF 85.26
cd02068127 radical_SAM_B12_BD B12 binding domain_like associa 85.25
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 85.09
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 84.52
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 84.27
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 84.07
PRK13585 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 84.06
COG2069 403 CdhD CO dehydrogenase/acetyl-CoA synthase delta su 83.34
cd04732 234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 83.2
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 83.18
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 82.26
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 82.1
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 82.03
PF01183181 Glyco_hydro_25: Glycosyl hydrolases family 25; Int 81.98
COG1908132 FrhD Coenzyme F420-reducing hydrogenase, delta sub 81.97
TIGR01334277 modD putative molybdenum utilization protein ModD. 81.96
PRK09997258 hydroxypyruvate isomerase; Provisional 81.94
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 81.87
COG3142241 CutC Uncharacterized protein involved in copper re 81.7
TIGR02026 497 BchE magnesium-protoporphyrin IX monomethyl ester 81.59
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 81.33
cd06412199 GH25_CH-type CH-type (Chalaropsis-type) lysozymes 81.31
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 81.17
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 81.0
cd06525184 GH25_Lyc-like Lyc muramidase is an autolytic lysoz 80.9
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 80.05
>KOG1643 consensus Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-94  Score=615.98  Aligned_cols=246  Identities=67%  Similarity=1.097  Sum_probs=238.8

Q ss_pred             CCCceEEEEecccCCCHHHHHHHHHHhhccCCCCCCceeEEEcCccccHHHHHhhcCCCceEeeecccccCCcccccccc
Q 025540            1 MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGFHVAAQNCWVKKGGAFTGEIS   80 (251)
Q Consensus         1 m~r~~~i~~NwKmn~~~~~~~~~~~~l~~~~~~~~~~~~v~i~Pp~~~L~~~~~~~~~~i~vgAQn~~~~~~Ga~TGeiS   80 (251)
                      |.|+.+++||||||++.++..++++.|+....+  .++|++|+||++||..+++.++..+.++||||+....||||||+|
T Consensus         1 MarkffvgGNwKmngs~~s~~eii~~ln~a~~~--~~vevvi~pP~~Yl~~ak~~l~~~i~v~aQn~~~~k~GafTGEiS   78 (247)
T KOG1643|consen    1 MARKFFVGGNWKMNGSKQSIKEIIKTLNAAKLP--ANVEVVIAPPAPYLDYAKSKLKPDIGVAAQNCYKVKSGAFTGEIS   78 (247)
T ss_pred             CCcceEecccccccCcHHHHHHHHHHhhhccCC--CCCcEEEeCChhHHHHHHHhCCccceeecceeeeccCccccCccC
Confidence            789999999999999999999999999886543  569999999999999999999889999999999999999999999


Q ss_pred             HHHHHhCCCCEEEeCchhhccccccChHHHHHHHHHHHHCCCeEEEEeCCcHHHHhcCCcHHHHHHHHHHHHhccCCCCC
Q 025540           81 AEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSN  160 (251)
Q Consensus        81 ~~mLkd~G~~~viiGHSERR~~f~Etd~~i~~Kv~~al~~gl~pIlCiGE~~~~r~~g~~~~~~~~Ql~~~l~~i~~~~~  160 (251)
                      ++||+|+|++|||+||||||++|+|+|+.|++|++.||+.||++|+||||++++||+|+|.+|+.+||.++.+.+.+|++
T Consensus        79 ~~mlkd~G~~wVIlGHSERR~~fgEsd~~i~~K~~~Al~eGl~ViaCIGE~leeREaG~t~dVv~~Ql~aiad~v~~w~n  158 (247)
T KOG1643|consen   79 AEMLKDLGAEWVILGHSERRHVFGESDEFIADKTAHALAEGLKVIACIGETLEEREAGKTLDVVFRQLKAIADKVKDWSN  158 (247)
T ss_pred             HHHHHhCCCCEEEecchhhhhhhCCchHHHHHHHHHHHHcCCeEEEEecccHHhhhcCchHHHHHHHHHHHHHhcCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEcccCccCCCCCCCHHHHHHHHHHHHHHHHhcCCccccCcceEEEccCCCcccHHHHhcCCCCCEEEEcCccCchH
Q 025540          161 IVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPE  240 (251)
Q Consensus       161 ~iIAYEPvWAIGtG~~a~~e~i~~~~~~IR~~l~~~~~~~~~~~i~ilYGGSV~~~n~~~l~~~~~vDG~LVG~asl~~~  240 (251)
                      ++||||||||||||++|||+|+||+|..||.|+.++.+..++..+||+||||||..|+++|+.++||||||||||||||+
T Consensus       159 iviAYEPVWAIGTGk~atp~QaqEVh~~iR~wl~~~vs~~Va~~~RIiYGGSV~g~N~~el~~~~diDGFLVGGaSLKpe  238 (247)
T KOG1643|consen  159 IVIAYEPVWAIGTGKTATPEQAQEVHAEIRKWLKSNVSDAVASSTRIIYGGSVNGGNCKELAKKPDIDGFLVGGASLKPE  238 (247)
T ss_pred             eEEEeeceeeecCCCCCCHHHHHHHHHHHHHHHhhcchhhhhhceEEEeccccccccHHHhcccccccceEEcCcccChH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHH
Q 025540          241 FIDIIKSA  248 (251)
Q Consensus       241 F~~Ii~~~  248 (251)
                      |.+|++..
T Consensus       239 F~~Iin~~  246 (247)
T KOG1643|consen  239 FVDIINAR  246 (247)
T ss_pred             HHHhhhcc
Confidence            99999864

>PLN02561 triosephosphate isomerase Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK14566 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK15492 triosephosphate isomerase; Provisional Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>PF00121 TIM: Triosephosphate isomerase; InterPro: IPR000652 Triosephosphate isomerase (5 Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02429 triosephosphate isomerase Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK13962 bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG2069 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) [Energy production and conversion] Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PF01183 Glyco_hydro_25: Glycosyl hydrolases family 25; InterPro: IPR002053 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PRK09997 hydroxypyruvate isomerase; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd06412 GH25_CH-type CH-type (Chalaropsis-type) lysozymes represent one of four functionally-defined classes of peptidoglycan hydrolases (also referred to as endo-N-acetylmuramidases) that cleave bacterial cell wall peptidoglycans Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06525 GH25_Lyc-like Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1r2r_A248 Crystal Structure Of Rabbit Muscle Triosephosphate 2e-77
1wyi_A250 Human Triosephosphate Isomerase Of New Crystal Form 5e-77
1hti_A248 Crystal Structure Of Recombinant Human Triosephosph 6e-77
2vom_A250 Structural Basis Of Human Triosephosphate Isomerase 1e-76
2i9e_A259 Structure Of Triosephosphate Isomerase Of Tenebrio 4e-76
1sw3_A248 Triosephosphate Isomerase From Gallus Gallus, Loop 7e-76
1tph_1247 1.8 Angstroms Crystal Structure Of Wild Type Chicke 2e-75
1tpb_1247 Offset Of A Catalytic Lesion By A Bound Water Solub 5e-75
1spq_A247 Understanding Protein Lids: Structural Analysis Of 6e-75
1tpw_A247 Triosephosphate Isomerase Drinks Water To Keep Heal 1e-74
1tpu_A247 S96p Change Is A Second-Site Suppressor For H95n Sl 2e-74
1sw7_A248 Triosephosphate Isomerase From Gallus Gallus, Loop 2e-74
1tpc_1247 Offset Of A Catalytic Lesion By A Bound Water Solub 3e-74
1sw0_A248 Triosephosphate Isomerase From Gallus Gallus, Loop 6e-74
1ssd_A247 Understanding Protein Lids: Structural Analysis Of 7e-74
1sq7_A247 Understanding Protein Lids: Structural Analysis Of 7e-74
1su5_A247 Understanding Protein Lids: Structural Analysis Of 8e-74
1tim_A247 Structure Of Triose Phosphate Isomerase From Chicke 8e-74
1tpv_A247 S96p Change Is A Second-Site Suppressor For H95n Sl 1e-73
3th6_A249 Crystal Structure Of Triosephosphate Isomerase From 1e-67
1mo0_A275 Structural Genomics Of Caenorhabditis Elegans: Trio 2e-67
1qds_A251 Superstable E65q Mutant Of Leishmania Mexicana Trio 2e-66
1amk_A251 Leishmania Mexicana Triose Phosphate Isomerase Leng 6e-66
1ypi_A247 Structure Of Yeast Triosephosphate Isomerase At 1.9 1e-62
1m6j_A261 Crystal Structure Of Triosephosphate Isomerase From 2e-62
4ff7_A248 Structure Of C126s Mutant Of Saccharomyces Cerevisi 2e-62
3ypi_A247 Electrophilic Catalysis In Triosephosphase Isomeras 9e-62
1i45_A248 Yeast Triosephosphate Isomerase (Mutant) Length = 2 4e-61
1nf0_A247 Triosephosphate Isomerase In Complex With Dhap Leng 2e-60
3krs_A271 Structure Of Triosephosphate Isomerase From Cryptos 2e-60
2oma_A250 Crystallographic Analysis Of A Chemically Modified 4e-60
1ci1_A251 Crystal Structure Of Triosephosphate Isomerase From 5e-60
1tcd_A249 Trypanosoma Cruzi Triosephosphate Isomerase Length 5e-60
2vfd_A248 Crystal Structure Of The F96s Mutant Of Plasmodium 5e-59
2vff_A248 Crystal Structure Of The F96h Mutant Of Plasmodium 2e-58
1ydv_A248 Triosephosphate Isomerase (Tim) Length = 248 3e-58
3psv_A248 Structure Of E97d Mutant Of Tim From Plasmodium Fal 6e-58
3psw_A248 Structure Of E97q Mutant Of Tim From Plasmodium Fal 7e-58
3qsr_A255 Crystal Structure Of Trichomonas Vaginalis Trioseph 8e-58
2vfh_A248 Crystal Structure Of The F96w Mutant Of Plasmodium 9e-58
1vga_A248 Structures Of Unligated And Inhibitor Complexes Of 2e-57
3pwa_A248 Structure Of C126a Mutant Of Plasmodium Falciparum 4e-57
3pvf_A248 Structure Of C126s Mutant Of Plasmodium Falciparum 4e-57
3q37_A251 Identification Of Amino Acids That Account For Long 7e-57
3qst_A255 Crystal Structure Of Trichomonas Vaginalis Trioseph 2e-56
2dp3_A257 Crystal Structure Of A Double Mutant (C202aA198V) O 5e-56
2yc7_A257 Crystal Structure Of A Mutant (C202a) Of Triosephos 1e-55
4tim_A250 Crystallographic And Molecular Modeling Studies On 4e-55
2yc6_A257 Crystal Structure Of A Triple Mutant (A198v, C202a 1e-54
2v0t_A250 The A178l Mutation In The C-Terminal Hinge Of The F 2e-54
3tim_A250 The Crystal Structure Of The "open" And The "closed 2e-54
2yc8_A255 Crystal Structure Of A Double Mutant (C202a And C22 3e-54
1kv5_A250 Structure Of Trypanosoma Brucei Brucei Tim With The 3e-54
2j24_A250 The Functional Role Of The Conserved Active Site Pr 4e-54
3pf3_A257 Crystal Structure Of A Mutant (C202a) Of Triosephos 2e-53
2v5b_A244 The Monomerization Of Triosephosphate Isomerase Fro 3e-53
2y70_A245 Crystallographic Structure Of Gm23, Mutant G89d, An 4e-50
2y6z_A256 Crystallographic Structure Of Gm23 An Example Of Ca 4e-50
1mss_A243 Large Scale Structural Rearrangements Of The Front 9e-49
1tti_A243 Three New Crystal Structures Of Point Mutation Vari 1e-48
2wsq_A242 Monotim Mutant Rmm0-1, Dimeric Form. Length = 242 1e-48
1ml1_A243 Protein Engineering With Monomeric Triosephosphate 1e-48
1tri_A243 The Crystal Structure Of An Engineered Monomeric Tr 2e-48
1tmh_A254 Modular Mutagenesis Of A Tim-barrel Enzyme: The Cry 2e-48
2wsr_A242 Monotim Mutant Rmm0-1, Monomeric Form Length = 242 2e-48
1b9b_A255 Triosephosphate Isomerase Of Thermotoga Maritima Le 5e-46
2v2d_A242 The A178l Mutation In The C-Terminal Hinge Of The F 2e-45
4iot_A255 High-resolution Structure Of Triosephosphate Isomer 2e-44
1tre_A255 The Structure Of Triosephosphate Isomerase From Esc 2e-44
1dkw_A238 Crystal Structure Of Triose-Phosphate Isomerase Wit 1e-43
2vei_A238 Structure-Based Enzyme Engineering Efforts With An 6e-43
2vek_A238 Structure-Based Enzyme Engineering Efforts With An 2e-42
3uwu_A261 Crystal Structure Of Staphylococcus Aureus Trioseph 2e-42
3m9y_A254 Crystal Structure Of Triosephosphate Isomerase From 2e-42
2btm_A252 Does The His12-Lys13 Pair Play A Role In The Adapta 3e-41
1btm_A252 Triosephosphate Isomerase (Tim) Complexed With 2- P 1e-39
4g1k_A272 Crystal Structure Of Triosephosphate Isomerase From 3e-38
1aw1_A256 Triosephosphate Isomerase Of Vibrio Marinus Complex 3e-37
1yya_A250 Crystal Structure Of Tt0473, Putative Triosephospha 9e-37
3ta6_A267 Structure Of Mycobacterium Tuberculosis Triosephosp 2e-35
3gvg_A283 Crystal Structure Of Triosephosphate Isomerase From 9e-35
3kxq_A275 Crystal Structure Of Triosephosphate Isomerase From 8e-34
2jgq_A233 Kinetics And Structural Properties Of Triosephospha 8e-29
3s6d_A310 Crystal Structure Of A Putative Triosephosphate Iso 3e-16
1w0m_A226 Triosephosphate Isomerase From Thermoproteus Tenax 3e-04
>pdb|1R2R|A Chain A, Crystal Structure Of Rabbit Muscle Triosephosphate Isomerase Length = 248 Back     alignment and structure 
Iteration: 1

 Score =  285 bits (728), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 172/247 (69%), Gaps = 2/247 (0%)
Query: 3   RKFFVGGNWKCNGTPEEVKKIVSVLNEGQXXXXXXXXXXXXXXXXFLGLVKSSLRPGFHV 62
           RKFFVGGNWK NG  + + ++++ LN  +                ++   +  L P   V
Sbjct: 4   RKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTA--YIDFARQKLDPKIAV 61
Query: 63  AAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGL 122
           AAQNC+    GAFTGEIS  M+ +    WV+LGHSERR +  E +E +G KVA+ALS+GL
Sbjct: 62  AAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALSEGL 121
Query: 123 KVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPAQA 182
            VIAC+GE L++REAG T  VV  QTK IAD V  WS +VLAYEPVWAIGTGK ATP QA
Sbjct: 122 GVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQA 181
Query: 183 QEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFI 242
           QEVH +LR WL +N S  +A +TRIIYGGSV GA CKELA+QPDVDGFLVGGASLKPEF+
Sbjct: 182 QEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFV 241
Query: 243 DIIKSAE 249
           DII + +
Sbjct: 242 DIINAKQ 248
>pdb|1WYI|A Chain A, Human Triosephosphate Isomerase Of New Crystal Form Length = 250 Back     alignment and structure
>pdb|1HTI|A Chain A, Crystal Structure Of Recombinant Human Triosephosphate Isomerase At 2.8 Angstroms Resolution. Triosephosphate Isomerase Related Human Genetic Disorders And Comparison With The Trypanosomal Enzyme Length = 248 Back     alignment and structure
>pdb|2VOM|A Chain A, Structural Basis Of Human Triosephosphate Isomerase Deficiency. Mutation E104d And Correlation To Solvent Perturbation. Length = 250 Back     alignment and structure
>pdb|2I9E|A Chain A, Structure Of Triosephosphate Isomerase Of Tenebrio Molitor Length = 259 Back     alignment and structure
>pdb|1SW3|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Mutant T175v Length = 248 Back     alignment and structure
>pdb|1TPH|1 Chain 1, 1.8 Angstroms Crystal Structure Of Wild Type Chicken Triosephosphate Isomerase-Phosphoglycolohydroxamate Complex Length = 247 Back     alignment and structure
>pdb|1TPB|1 Chain 1, Offset Of A Catalytic Lesion By A Bound Water Soluble Length = 247 Back     alignment and structure
>pdb|1SPQ|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TPW|A Chain A, Triosephosphate Isomerase Drinks Water To Keep Healthy Length = 247 Back     alignment and structure
>pdb|1TPU|A Chain A, S96p Change Is A Second-Site Suppressor For H95n Sluggish Mutant Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1SW7|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Mutant K174n, T175s, A176s Length = 248 Back     alignment and structure
>pdb|1TPC|1 Chain 1, Offset Of A Catalytic Lesion By A Bound Water Soluble Length = 247 Back     alignment and structure
>pdb|1SW0|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Hinge Mutant K174l, T175w Length = 248 Back     alignment and structure
>pdb|1SSD|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1SQ7|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1SU5|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TIM|A Chain A, Structure Of Triose Phosphate Isomerase From Chicken Muscle Length = 247 Back     alignment and structure
>pdb|1TPV|A Chain A, S96p Change Is A Second-Site Suppressor For H95n Sluggish Mutant Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|3TH6|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Rhipicephalus (Boophilus) Microplus. Length = 249 Back     alignment and structure
>pdb|1MO0|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Triose Phosphate Isomerase Length = 275 Back     alignment and structure
>pdb|1QDS|A Chain A, Superstable E65q Mutant Of Leishmania Mexicana Triosephosphate Isomerase (Tim) Length = 251 Back     alignment and structure
>pdb|1AMK|A Chain A, Leishmania Mexicana Triose Phosphate Isomerase Length = 251 Back     alignment and structure
>pdb|1YPI|A Chain A, Structure Of Yeast Triosephosphate Isomerase At 1.9- Angstroms Resolution Length = 247 Back     alignment and structure
>pdb|1M6J|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Entamoeba Histolytica Length = 261 Back     alignment and structure
>pdb|4FF7|A Chain A, Structure Of C126s Mutant Of Saccharomyces Cerevisiae Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|3YPI|A Chain A, Electrophilic Catalysis In Triosephosphase Isomerase: The Role Of Histidine-95 Length = 247 Back     alignment and structure
>pdb|1I45|A Chain A, Yeast Triosephosphate Isomerase (Mutant) Length = 248 Back     alignment and structure
>pdb|1NF0|A Chain A, Triosephosphate Isomerase In Complex With Dhap Length = 247 Back     alignment and structure
>pdb|3KRS|A Chain A, Structure Of Triosephosphate Isomerase From Cryptosporidium Parvum At 1.55a Resolution Length = 271 Back     alignment and structure
>pdb|2OMA|A Chain A, Crystallographic Analysis Of A Chemically Modified Triosephosphate Isomerase From Trypanosoma Cruzi With Dithiobenzylamine (dtba) Length = 250 Back     alignment and structure
>pdb|1CI1|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Trypanosoma Cruzi In Hexane Length = 251 Back     alignment and structure
>pdb|1TCD|A Chain A, Trypanosoma Cruzi Triosephosphate Isomerase Length = 249 Back     alignment and structure
>pdb|2VFD|A Chain A, Crystal Structure Of The F96s Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|2VFF|A Chain A, Crystal Structure Of The F96h Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|1YDV|A Chain A, Triosephosphate Isomerase (Tim) Length = 248 Back     alignment and structure
>pdb|3PSV|A Chain A, Structure Of E97d Mutant Of Tim From Plasmodium Falciparum Length = 248 Back     alignment and structure
>pdb|3PSW|A Chain A, Structure Of E97q Mutant Of Tim From Plasmodium Falciparum Length = 248 Back     alignment and structure
>pdb|3QSR|A Chain A, Crystal Structure Of Trichomonas Vaginalis Triosephosphate Isomerase Tvag_497370 Gene (Ile-45 Variant) Length = 255 Back     alignment and structure
>pdb|2VFH|A Chain A, Crystal Structure Of The F96w Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Complexed With 3- Phosphoglycerate Length = 248 Back     alignment and structure
>pdb|1VGA|A Chain A, Structures Of Unligated And Inhibitor Complexes Of W168f Mutant Of Triosephosphate Isomerase From Plasmodium Falciparum Length = 248 Back     alignment and structure
>pdb|3PWA|A Chain A, Structure Of C126a Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|3PVF|A Chain A, Structure Of C126s Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Complexed With Pga Length = 248 Back     alignment and structure
>pdb|3Q37|A Chain A, Identification Of Amino Acids That Account For Long-Range Interactions In Proteins Using Two Triosephosphate Isomerases From Pathogenic Trypanosomes. Length = 251 Back     alignment and structure
>pdb|3QST|A Chain A, Crystal Structure Of Trichomonas Vaginalis Triosephosphate Isomerase Tvag_096350 Gene (Val-45 Variant) Length = 255 Back     alignment and structure
>pdb|2DP3|A Chain A, Crystal Structure Of A Double Mutant (C202aA198V) OF TRIOSEPHOSPHATE Isomerase From Giardia Lamblia Length = 257 Back     alignment and structure
>pdb|2YC7|A Chain A, Crystal Structure Of A Mutant (C202a) Of Triosephosphate Isomerase From Giardia Lamblia Complexed With 2-Phosphoglycolic Acid Length = 257 Back     alignment and structure
>pdb|4TIM|A Chain A, Crystallographic And Molecular Modeling Studies On Trypanosomal Triosephosphate Isomerase: A Critical Assessment Of The Predicted And Observed Structures Of The Complex With 2-Phosphoglycerate Length = 250 Back     alignment and structure
>pdb|2YC6|A Chain A, Crystal Structure Of A Triple Mutant (A198v, C202a And C222n) Of Triosephosphate Isomerase From Giardia Lamblia Complexed With 2-Phosphoglycolic Acid Length = 257 Back     alignment and structure
>pdb|2V0T|A Chain A, The A178l Mutation In The C-Terminal Hinge Of The Flexible Loop-6 Of Triosephosphate Isomerase (Tim) Induces A More Closed Conformation Of This Hinge Region In Dimeric And Monomeric Tim Length = 250 Back     alignment and structure
>pdb|3TIM|A Chain A, The Crystal Structure Of The "open" And The "closed" Conformation Of The Flexible Loop Of Trypanosomal Triosephosphate Isomerase Length = 250 Back     alignment and structure
>pdb|2YC8|A Chain A, Crystal Structure Of A Double Mutant (C202a And C222n) Of Triosephosphate Isomerase From Giardia Lamblia. Length = 255 Back     alignment and structure
>pdb|1KV5|A Chain A, Structure Of Trypanosoma Brucei Brucei Tim With The Salt-Bridge- Forming Residue Arg191 Mutated To Ser Length = 250 Back     alignment and structure
>pdb|2J24|A Chain A, The Functional Role Of The Conserved Active Site Proline Of Triosephosphate Isomerase Length = 250 Back     alignment and structure
>pdb|3PF3|A Chain A, Crystal Structure Of A Mutant (C202a) Of Triosephosphate Isomerase From Giardia Lamblia Derivatized With Mmts Length = 257 Back     alignment and structure
>pdb|2V5B|A Chain A, The Monomerization Of Triosephosphate Isomerase From Trypanosoma Cruzi Length = 244 Back     alignment and structure
>pdb|2Y70|A Chain A, Crystallographic Structure Of Gm23, Mutant G89d, An Example Of Catalytic Migration From Tim To Thiamin Phosphate Synthase. Length = 245 Back     alignment and structure
>pdb|2Y6Z|A Chain A, Crystallographic Structure Of Gm23 An Example Of Catalytic Migration From Tim To Thiamin Phosphate Synthase Length = 256 Back     alignment and structure
>pdb|1MSS|A Chain A, Large Scale Structural Rearrangements Of The Front Loops In Monomerised Triosephosphate Isomerase, As Deduced From The Comparison Of The Structural Properties Of Monotim And Its Point Mutation Variant Monoss Length = 243 Back     alignment and structure
>pdb|1TTI|A Chain A, Three New Crystal Structures Of Point Mutation Variants Of Monotim: Conformational Flexibility Of Loop-1,Loop-4 And Loop-8 Length = 243 Back     alignment and structure
>pdb|2WSQ|A Chain A, Monotim Mutant Rmm0-1, Dimeric Form. Length = 242 Back     alignment and structure
>pdb|1ML1|A Chain A, Protein Engineering With Monomeric Triosephosphate Isomerase: The Modelling And Structure Verification Of A Seven Residue Loop Length = 243 Back     alignment and structure
>pdb|1TRI|A Chain A, The Crystal Structure Of An Engineered Monomeric Triosephosphate Isomerase, Monotim: The Correct Modelling Of An Eight-Residue Loop Length = 243 Back     alignment and structure
>pdb|1TMH|A Chain A, Modular Mutagenesis Of A Tim-barrel Enzyme: The Crystal Structure Of A Chimeric E. Coli Tim Having The Eighth (beta-alpha)-unit Replaced By The Equivalent Unit Of Chicken Tim Length = 254 Back     alignment and structure
>pdb|2WSR|A Chain A, Monotim Mutant Rmm0-1, Monomeric Form Length = 242 Back     alignment and structure
>pdb|1B9B|A Chain A, Triosephosphate Isomerase Of Thermotoga Maritima Length = 255 Back     alignment and structure
>pdb|2V2D|A Chain A, The A178l Mutation In The C-Terminal Hinge Of The Flexible Loop-6 Of Triosephosphate Isomerase (Tim) Induces A More Closed Conformation Of This Hinge Region In Dimeric And Monomeric Tim Length = 242 Back     alignment and structure
>pdb|4IOT|A Chain A, High-resolution Structure Of Triosephosphate Isomerase From E. Coli Length = 255 Back     alignment and structure
>pdb|1TRE|A Chain A, The Structure Of Triosephosphate Isomerase From Escherichia Coli Determined At 2.6 Angstrom Resolution Length = 255 Back     alignment and structure
>pdb|1DKW|A Chain A, Crystal Structure Of Triose-Phosphate Isomerase With Modified Substrate Binding Site Length = 238 Back     alignment and structure
>pdb|2VEI|A Chain A, Structure-Based Enzyme Engineering Efforts With An Inactive Monomeric Tim Variant: The Importance Of A Single Point Mutation For Generating An Active Site With Suitable Binding Properties Length = 238 Back     alignment and structure
>pdb|2VEK|A Chain A, Structure-Based Enzyme Engineering Efforts With An Inactive Monomeric Tim Variant: The Importance Of A Single Point Mutation For Generating An Active Site With Suitable Binding Properties Length = 238 Back     alignment and structure
>pdb|3UWU|A Chain A, Crystal Structure Of Staphylococcus Aureus Triosephosphate Isomerase Complexed With Glycerol-3-Phosphate Length = 261 Back     alignment and structure
>pdb|3M9Y|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Methicillin Resistant Staphylococcus Aureus At 1.9 Angstrom Resolution Length = 254 Back     alignment and structure
>pdb|2BTM|A Chain A, Does The His12-Lys13 Pair Play A Role In The Adaptation Of Thermophilic Tims To High Temperatures? Length = 252 Back     alignment and structure
>pdb|1BTM|A Chain A, Triosephosphate Isomerase (Tim) Complexed With 2- Phosphoglycolic Acid Length = 252 Back     alignment and structure
>pdb|4G1K|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Burkholderia Thailandensis Length = 272 Back     alignment and structure
>pdb|1AW1|A Chain A, Triosephosphate Isomerase Of Vibrio Marinus Complexed With 2-Phosphoglycolate Length = 256 Back     alignment and structure
>pdb|1YYA|A Chain A, Crystal Structure Of Tt0473, Putative Triosephosphate Isomerase From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>pdb|3TA6|A Chain A, Structure Of Mycobacterium Tuberculosis Triosephosphate Isomerase Length = 267 Back     alignment and structure
>pdb|3GVG|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Mycobacterium Tuberculosis Length = 283 Back     alignment and structure
>pdb|3KXQ|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Bartonella Henselae At 1.6a Resolution Length = 275 Back     alignment and structure
>pdb|2JGQ|A Chain A, Kinetics And Structural Properties Of Triosephosphate Isomerase From Helicobacter Pylori Length = 233 Back     alignment and structure
>pdb|3S6D|A Chain A, Crystal Structure Of A Putative Triosephosphate Isomerase From Coccidioides Immitis Length = 310 Back     alignment and structure
>pdb|1W0M|A Chain A, Triosephosphate Isomerase From Thermoproteus Tenax Length = 226 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 1e-159
1mo0_A275 TIM, triosephosphate isomerase; structural genomic 1e-158
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerat 1e-157
3th6_A249 Triosephosphate isomerase; alpha/beta barrel, embr 1e-156
1r2r_A248 TIM, triosephosphate isomerase; closed loop confor 1e-156
3krs_A271 Triosephosphate isomerase; ssgcid, SBRI, emerald b 1e-155
2yc6_A257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 1e-154
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis 1e-153
3qst_A255 Triosephosphate isomerase, putative; TIM barrel; 1 1e-153
2j27_A250 Triosephosphate isomerase glycosomal; TIM, 2PG, LO 1e-151
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 1e-148
2v5b_A244 Triosephosphate isomerase; TIM, unfolding, monotct 1e-142
1tre_A255 Triosephosphate isomerase; intramolecular oxidored 1e-141
1ney_A247 TIM, triosephosphate isomerase; yeast, DHAP, dihyd 1e-141
1b9b_A255 TIM, protein (triosephosphate isomerase); thermoph 1e-140
1aw2_A256 Triosephosphate isomerase; psychrophilic, vibrio m 1e-128
3m9y_A254 Triosephosphate isomerase; TIM barrel, glycolysis, 1e-128
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shu 1e-127
3kxq_A275 Triosephosphate isomerase; ssgcid, NIH, niaid, SBR 1e-121
2btm_A252 TIM, protein (triosephosphate isomerase); thermoph 1e-120
3ta6_A267 Triosephosphate isomerase; HET: FLC; 1.41A {Mycoba 1e-118
1yya_A250 Triosephosphate isomerase; riken structural genomi 1e-118
4g1k_A272 Triosephosphate isomerase; structural genomics, se 1e-117
3s6d_A310 Putative triosephosphate isomerase; seattle struct 1e-113
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 4e-94
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 6e-89
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 6e-85
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Length = 259 Back     alignment and structure
 Score =  440 bits (1134), Expect = e-159
 Identities = 144/251 (57%), Positives = 181/251 (72%), Gaps = 2/251 (0%)

Query: 1   MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGF 60
           M RKF VGGNWK NG  +++ +I+  L  G +      EVVV  P ++L LV++ +    
Sbjct: 1   MARKFVVGGNWKMNGDKKQINEIIGFLKSGPLNQD--TEVVVGVPAIYLELVRTCVPASI 58

Query: 61  HVAAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQ 120
            VAAQNC+    GAFTGEIS  M+ ++   WVILGHSERR I  E +E + +KV +AL  
Sbjct: 59  GVAAQNCYKVPKGAFTGEISPAMIKDVGADWVILGHSERRQIFGESDELIAEKVCHALES 118

Query: 121 GLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPA 180
           GLKVIAC+GETLE+REAG T +VV  QTKAIA +V+ WSN+V+AYEPVWAIGTGK ATP 
Sbjct: 119 GLKVIACIGETLEEREAGKTEEVVFRQTKAIAAKVNDWSNVVIAYEPVWAIGTGKTATPQ 178

Query: 181 QAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPE 240
           QAQ+VH  LR+W+  N   ++  + RI YGGSV  ANCKELA+QPD+DGFLVGGASLKPE
Sbjct: 179 QAQDVHKALRQWICENIDAKVGNSIRIQYGGSVTAANCKELASQPDIDGFLVGGASLKPE 238

Query: 241 FIDIIKSAELK 251
           F+DII + +L 
Sbjct: 239 FVDIINARQLV 249
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Length = 275 Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Length = 248 Back     alignment and structure
>3th6_A Triosephosphate isomerase; alpha/beta barrel, embryogenesis, glycolysis; 2.40A {Rhipicephalus microplus} Length = 249 Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Length = 248 Back     alignment and structure
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} Length = 271 Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Length = 257 Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Length = 251 Back     alignment and structure
>3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A Length = 255 Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... Length = 250 Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Length = 261 Back     alignment and structure
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Length = 244 Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Length = 255 Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Length = 247 Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Length = 255 Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Length = 256 Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} Length = 254 Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Length = 233 Back     alignment and structure
>3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, gluconeogenesis, glycolysis, pentose shunt; 1.60A {Bartonella henselae} Length = 275 Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Length = 252 Back     alignment and structure
>3ta6_A Triosephosphate isomerase; HET: FLC; 1.41A {Mycobacterium tuberculosis} PDB: 3tao_A* 3gvg_A Length = 267 Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Length = 250 Back     alignment and structure
>4g1k_A Triosephosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel, TPIA; 2.35A {Burkholderia thailandensis} Length = 272 Back     alignment and structure
>3s6d_A Putative triosephosphate isomerase; seattle structural genomics center for infectious disease, S pathogenic fungus, eukaryote; 2.20A {Coccidioides immitis RS} Length = 310 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Length = 226 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Length = 219 Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Length = 225 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
3ta6_A267 Triosephosphate isomerase; HET: FLC; 1.41A {Mycoba 100.0
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerat 100.0
4g1k_A272 Triosephosphate isomerase; structural genomics, se 100.0
3th6_A249 Triosephosphate isomerase; alpha/beta barrel, embr 100.0
3krs_A271 Triosephosphate isomerase; ssgcid, SBRI, emerald b 100.0
3qst_A255 Triosephosphate isomerase, putative; TIM barrel; 1 100.0
3kxq_A275 Triosephosphate isomerase; ssgcid, NIH, niaid, SBR 100.0
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 100.0
3m9y_A254 Triosephosphate isomerase; TIM barrel, glycolysis, 100.0
1r2r_A248 TIM, triosephosphate isomerase; closed loop confor 100.0
1ney_A247 TIM, triosephosphate isomerase; yeast, DHAP, dihyd 100.0
1b9b_A255 TIM, protein (triosephosphate isomerase); thermoph 100.0
1yya_A250 Triosephosphate isomerase; riken structural genomi 100.0
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis 100.0
2j27_A250 Triosephosphate isomerase glycosomal; TIM, 2PG, LO 100.0
2yc6_A257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 100.0
1tre_A255 Triosephosphate isomerase; intramolecular oxidored 100.0
1mo0_A275 TIM, triosephosphate isomerase; structural genomic 100.0
2btm_A252 TIM, protein (triosephosphate isomerase); thermoph 100.0
1aw2_A256 Triosephosphate isomerase; psychrophilic, vibrio m 100.0
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 100.0
3s6d_A310 Putative triosephosphate isomerase; seattle struct 100.0
2v5b_A244 Triosephosphate isomerase; TIM, unfolding, monotct 100.0
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shu 100.0
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 100.0
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 100.0
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 100.0
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 99.49
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.34
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 98.09
3tha_A252 Tryptophan synthase alpha chain; structural genomi 97.89
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 97.86
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 97.78
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 97.63
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 97.62
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 97.6
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 97.6
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.53
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 97.51
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 97.5
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 97.48
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.48
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 97.38
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.24
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 97.24
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 97.15
1ujp_A271 Tryptophan synthase alpha chain; riken structural 97.1
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 97.08
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 96.95
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 96.87
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 96.79
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 96.77
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 96.76
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.74
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 96.68
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 96.65
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 96.6
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.48
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 96.28
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 95.83
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 95.8
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 95.3
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 95.04
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 94.95
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 94.75
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 94.66
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 94.38
1viz_A240 PCRB protein homolog; structural genomics, unknown 94.21
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 93.98
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 93.81
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 93.78
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 93.61
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 93.51
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 93.48
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 93.42
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 93.35
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 93.29
3bo9_A 326 Putative nitroalkan dioxygenase; TM0800, structura 93.17
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 93.09
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 92.74
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 92.71
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 92.41
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 91.69
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 91.65
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 91.32
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 91.05
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 91.0
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 90.99
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 90.91
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 90.84
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 90.61
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 90.58
3b0p_A 350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 90.5
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 89.7
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 88.37
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 88.12
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 87.78
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 87.47
1ece_A 358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 87.4
3tdn_A 247 FLR symmetric alpha-beta TIM barrel; symmetric sup 87.1
4gj1_A 243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 86.94
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 86.27
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 86.12
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 85.58
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 85.19
2w6r_A 266 Imidazole glycerol phosphate synthase subunit HISF 84.52
2agk_A 260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 83.62
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 83.32
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 82.51
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 82.37
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 82.21
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 81.93
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 81.91
1ka9_F 252 Imidazole glycerol phosphtate synthase; riken stru 81.88
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 81.65
3jug_A 345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 81.59
2v5j_A287 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; l 81.38
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 80.94
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 80.81
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 80.62
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 80.44
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 80.23
>3ta6_A Triosephosphate isomerase; HET: FLC; 1.41A {Mycobacterium tuberculosis} SCOP: c.1.1.0 PDB: 3tao_A* 3gvg_A Back     alignment and structure
Probab=100.00  E-value=4.5e-99  Score=676.75  Aligned_cols=250  Identities=41%  Similarity=0.603  Sum_probs=233.6

Q ss_pred             CCCceEEEEecccCCCHHHHHHHHHHhhccCCCC-CCceeEEEcCccccHHHHHhhcC-C--CceEeeecccccCCcccc
Q 025540            1 MGRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPS-SDVVEVVVSPPFVFLGLVKSSLR-P--GFHVAAQNCWVKKGGAFT   76 (251)
Q Consensus         1 m~r~~~i~~NwKmn~~~~~~~~~~~~l~~~~~~~-~~~~~v~i~Pp~~~L~~~~~~~~-~--~i~vgAQn~~~~~~Ga~T   76 (251)
                      |+|||||+||||||++.+++.+|++.+.....+. ..+++|+|||||++|..+++.+. +  +|.+||||||+.++||||
T Consensus         1 m~rk~~i~gNWKMn~~~~~~~~l~~~l~~~~~~~~~~~vev~v~Pp~~~L~~v~~~~~~~~~~i~vgAQn~~~~~~GAfT   80 (267)
T 3ta6_A            1 MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYT   80 (267)
T ss_dssp             --CCCEEEEECCBCCCHHHHHHHHHHHHHHSCGGGGGTCEEEEECCGGGHHHHHHHHHHTTCSCEEEESCCCSSSSBSCT
T ss_pred             CCCCcEEEEEhhhccCHHHHHHHHHHHHHhccccccCCceEEEECCHHHHHHHHHHhcCCCCceEEEecccCCCCCCCcc
Confidence            7899999999999999999999999887642211 12689999999999999998876 3  499999999999999999


Q ss_pred             ccccHHHHHhCCCCEEEeCchhhccccccChHHHHHHHHHHHHCCCeEEEEeCCcHHHHhcCCcHHHHHHHHHHHHhccC
Q 025540           77 GEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVS  156 (251)
Q Consensus        77 GeiS~~mLkd~G~~~viiGHSERR~~f~Etd~~i~~Kv~~al~~gl~pIlCiGE~~~~r~~g~~~~~~~~Ql~~~l~~i~  156 (251)
                      ||||++||+|+||+||||||||||++|+|||+.|++|+++|+++||+||+||||++++|++|+|.++|.+||+.+|++++
T Consensus        81 GEIS~~mLkd~G~~~ViiGHSERR~~f~Etde~V~~Kv~~Al~~GL~pIlCvGEtleeReag~t~~vv~~Ql~~~l~~l~  160 (267)
T 3ta6_A           81 GDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLL  160 (267)
T ss_dssp             TCCCHHHHHHTTCCEEEESCHHHHHHTTCCHHHHHHHHHHHHHTTCEEEEEECCCHHHHHTTCHHHHHHHHHHHHTTTCC
T ss_pred             CcccHHHHHHcCCCEEEEcchhhccccCCCHHHHHHHHHHHHHCCCeEEEEeCCCHHHHhCCCHHHHHHHHHHHHHhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999886


Q ss_pred             --CCCCeEEEEcccCccCCCCCCCHHHHHHHHHHHHHHHHhcCCccccCcceEEEccCCCcccHHHHhcCCCCCEEEEcC
Q 025540          157 --SWSNIVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGG  234 (251)
Q Consensus       157 --~~~~~iIAYEPvWAIGtG~~a~~e~i~~~~~~IR~~l~~~~~~~~~~~i~ilYGGSV~~~n~~~l~~~~~vDG~LVG~  234 (251)
                        ++++++||||||||||||++||||++|++|++||++|.++|+.+.++++||||||||||+|+.+|++++||||+||||
T Consensus       161 ~~~~~~vvIAYEPVWAIGTG~tAtpe~aqevh~~IR~~l~~~~~~~~a~~~rIlYGGSV~~~N~~el~~~~diDG~LVGg  240 (267)
T 3ta6_A          161 AEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG  240 (267)
T ss_dssp             HHHHTTCEEEECCGGGSSSSCCCCHHHHHHHHHHHHHHHHHHSCHHHHTTSCEEECSCCCTTTHHHHHTSTTCCEEEECG
T ss_pred             HHHhCCEEEEECChhhhcCCcCCCHHHHHHHHHHHHHHHHHhhChhhhccceEEEcCCcCHhHHHHHhcCCCCCEEEech
Confidence              478999999999999999999999999999999999999999888999999999999999999999999999999999


Q ss_pred             ccCc-hHHHHHHHHHhc
Q 025540          235 ASLK-PEFIDIIKSAEL  250 (251)
Q Consensus       235 asl~-~~F~~Ii~~~~~  250 (251)
                      |||+ ++|.+||+.+.+
T Consensus       241 ASL~~~~F~~Ii~~~~~  257 (267)
T 3ta6_A          241 ASLDGEHFATLAAIAAG  257 (267)
T ss_dssp             GGGSHHHHHHHHHHHHC
T ss_pred             HhcCHHHHHHHHHHHhc
Confidence            9999 789999997653
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Back     alignment and structure
>4g1k_A Triosephosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel, TPIA; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3th6_A Triosephosphate isomerase; alpha/beta barrel, embryogenesis, glycolysis; 2.40A {Rhipicephalus microplus} Back     alignment and structure
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A Back     alignment and structure
>3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, gluconeogenesis, glycolysis, pentose shunt; 1.60A {Bartonella henselae} Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} SCOP: c.1.1.1 PDB: 3uwv_A* 3uwu_A* 3uww_A* 3uwy_A 3uwz_A* Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Back     alignment and structure
>3s6d_A Putative triosephosphate isomerase; seattle structural genomics center for infectious disease, S pathogenic fungus, eukaryote; 2.20A {Coccidioides immitis RS} Back     alignment and structure
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic DEGR aromatic hydrocarbons catabolism; 1.60A {Escherichia coli} PDB: 2v5k_A Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1r2ra_246 c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Or 2e-75
d1b9ba_252 c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga 2e-72
d1mo0a_257 c.1.1.1 (A:) Triosephosphate isomerase {Nematode ( 6e-72
d1neya_247 c.1.1.1 (A:) Triosephosphate isomerase {Baker's ye 1e-70
d1o5xa_246 c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium 2e-70
d2btma_251 c.1.1.1 (A:) Triosephosphate isomerase {Bacillus s 3e-68
d1n55a_249 c.1.1.1 (A:) Triosephosphate isomerase {Leishmania 5e-68
d1kv5a_249 c.1.1.1 (A:) Triosephosphate isomerase {Trypanosom 2e-65
d1m6ja_260 c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba 9e-65
d1aw1a_255 c.1.1.1 (A:) Triosephosphate isomerase {Vibrio mar 1e-63
d1trea_255 c.1.1.1 (A:) Triosephosphate isomerase {Escherichi 3e-62
d1w0ma_226 c.1.1.1 (A:) Triosephosphate isomerase {Thermoprot 1e-39
d1hg3a_224 c.1.1.1 (A:) Triosephosphate isomerase {Archaeon P 7e-33
>d1r2ra_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 246 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Triosephosphate isomerase (TIM)
family: Triosephosphate isomerase (TIM)
domain: Triosephosphate isomerase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  227 bits (578), Expect = 2e-75
 Identities = 148/247 (59%), Positives = 181/247 (73%), Gaps = 2/247 (0%)

Query: 3   RKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLRPGFHV 62
           RKFFVGGNWK NG  + + ++++ LN  +VP+    EVV +PP  ++   +  L P   V
Sbjct: 2   RKFFVGGNWKMNGRKKNLGELITTLNAAKVPAD--TEVVCAPPTAYIDFARQKLDPKIAV 59

Query: 63  AAQNCWVKKGGAFTGEISAEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGL 122
           AAQNC+    GAFTGEIS  M+ +    WV+LGHSERR +  E +E +G KVA+ALS+GL
Sbjct: 60  AAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALSEGL 119

Query: 123 KVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSNIVLAYEPVWAIGTGKVATPAQA 182
            VIAC+GE L++REAG T  VV  QTK IAD V  WS +VLAYEPVWAIGTGK ATP QA
Sbjct: 120 GVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQA 179

Query: 183 QEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPEFI 242
           QEVH +LR WL +N S  +A +TRIIYGGSV GA CKELA+QPDVDGFLVGGASLKPEF+
Sbjct: 180 QEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFV 239

Query: 243 DIIKSAE 249
           DII + +
Sbjct: 240 DIINAKQ 246
>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]} Length = 252 Back     information, alignment and structure
>d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 257 Back     information, alignment and structure
>d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 247 Back     information, alignment and structure
>d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} Length = 246 Back     information, alignment and structure
>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]} Length = 251 Back     information, alignment and structure
>d1n55a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana [TaxId: 5665]} Length = 249 Back     information, alignment and structure
>d1kv5a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]} Length = 249 Back     information, alignment and structure
>d1m6ja_ c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba histolytica [TaxId: 5759]} Length = 260 Back     information, alignment and structure
>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} Length = 255 Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Length = 226 Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 224 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1neya_247 Triosephosphate isomerase {Baker's yeast (Saccharo 100.0
d1r2ra_246 Triosephosphate isomerase {Rabbit (Oryctolagus cun 100.0
d1b9ba_252 Triosephosphate isomerase {Thermotoga maritima [Ta 100.0
d1mo0a_257 Triosephosphate isomerase {Nematode (Caenorhabditi 100.0
d1o5xa_246 Triosephosphate isomerase {Plasmodium falciparum [ 100.0
d2btma_251 Triosephosphate isomerase {Bacillus stearothermoph 100.0
d1trea_255 Triosephosphate isomerase {Escherichia coli [TaxId 100.0
d1n55a_249 Triosephosphate isomerase {Leishmania mexicana [Ta 100.0
d1aw1a_255 Triosephosphate isomerase {Vibrio marinus [TaxId: 100.0
d1kv5a_249 Triosephosphate isomerase {Trypanosoma brucei [Tax 100.0
d1m6ja_260 Triosephosphate isomerase {Entamoeba histolytica [ 100.0
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 100.0
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 100.0
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 96.51
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 96.46
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 95.47
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 95.25
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 95.16
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 95.0
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 94.82
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 94.73
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 94.2
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 93.85
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 93.51
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 92.26
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 92.1
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 91.91
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 91.37
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 91.1
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 90.79
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 90.64
d1vjza_ 325 Endoglucanase homologue TM1752 {Thermotoga maritim 89.39
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 89.18
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 88.92
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 87.89
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 87.35
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 87.13
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 86.96
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 86.69
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 86.48
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 84.88
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 84.39
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 84.06
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 83.84
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 83.83
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 81.33
d1jfxa_217 Streptomyces lysozyme {Streptomyces coelicolor, "m 80.33
>d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Triosephosphate isomerase (TIM)
family: Triosephosphate isomerase (TIM)
domain: Triosephosphate isomerase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=7.9e-97  Score=655.53  Aligned_cols=245  Identities=50%  Similarity=0.850  Sum_probs=234.2

Q ss_pred             CCceEEEEecccCCCHHHHHHHHHHhhccCCCCCCceeEEEcCccccHHHHHhhcC-CCceEeeecccccCCcccccccc
Q 025540            2 GRKFFVGGNWKCNGTPEEVKKIVSVLNEGQVPSSDVVEVVVSPPFVFLGLVKSSLR-PGFHVAAQNCWVKKGGAFTGEIS   80 (251)
Q Consensus         2 ~r~~~i~~NwKmn~~~~~~~~~~~~l~~~~~~~~~~~~v~i~Pp~~~L~~~~~~~~-~~i~vgAQn~~~~~~Ga~TGeiS   80 (251)
                      .||+||+||||||++.+++.+|++.+....  ...+++++|||||++|..+.+.+. +++.+||||||+.+.||||||||
T Consensus         1 sRk~~IagNWKMN~~~~~~~~~~~~l~~~~--~~~~~~v~i~Pp~~~L~~~~~~~~~~~i~iGAQn~~~~~~GA~TGeiS   78 (247)
T d1neya_           1 ARTFFVGGNFKLNGSKQSIKEIVERLNTAS--IPENVEVVICPPATYLDYSVSLVKKPQVTVGAQNAYLKASGAFTGENS   78 (247)
T ss_dssp             CCCEEEEEECCBCCCHHHHHHHHHHHHHSC--CCTTEEEEEECCGGGHHHHHHHCCCTTEEEEESCCCSSSSBSCTTCCC
T ss_pred             CCCcEEEEeccccCCHHHHHHHHHHHHccC--CCCCceEEEECCHHHHHHHHHHHhhccccccccccccccccchhhhhh
Confidence            489999999999999999999999987643  235799999999999999999887 78999999999999999999999


Q ss_pred             HHHHHhCCCCEEEeCchhhccccccChHHHHHHHHHHHHCCCeEEEEeCCcHHHHhcCCcHHHHHHHHHHHHhccCCCCC
Q 025540           81 AEMLVNLEIPWVILGHSERRLILNELNEFVGDKVAYALSQGLKVIACVGETLEQREAGSTMDVVAAQTKAIADRVSSWSN  160 (251)
Q Consensus        81 ~~mLkd~G~~~viiGHSERR~~f~Etd~~i~~Kv~~al~~gl~pIlCiGE~~~~r~~g~~~~~~~~Ql~~~l~~i~~~~~  160 (251)
                      ++||+|+||+||||||||||++|+|||++|++|+++|+++||+||+||||++++|++|++.+++.+|+...|+++...++
T Consensus        79 a~mLkd~G~~yviIGHSERR~~f~Etd~~i~~K~~~al~~gl~pIlCVGEtle~r~~~~~~~~~~~Ql~~~l~~~~~~~~  158 (247)
T d1neya_          79 VDQIKDVGAKYVILGHSERRSYFHEDDKFIADKTKFALGQGVGVILCIGETLEEKKAGKTLDVVERQLNAVLEEVKDFTN  158 (247)
T ss_dssp             HHHHHHTTCCEEEESCHHHHHTTCCCHHHHHHHHHHHHHTTCEEEEEECCCHHHHHTTCHHHHHHHHHHHHHHHCCCCTT
T ss_pred             HHHHHhhccchhhhcchhhhhhccchHHHHHHHHHHHhhcCceEEEEecchhhhhccccchhhhHHHHHhhhcccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999887889


Q ss_pred             eEEEEcccCccCCCCCCCHHHHHHHHHHHHHHHHhcCCccccCcceEEEccCCCcccHHHHhcCCCCCEEEEcCccCchH
Q 025540          161 IVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLLANTSPEIAAATRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKPE  240 (251)
Q Consensus       161 ~iIAYEPvWAIGtG~~a~~e~i~~~~~~IR~~l~~~~~~~~~~~i~ilYGGSV~~~n~~~l~~~~~vDG~LVG~asl~~~  240 (251)
                      ++|||||+||||||++|+|++++++|++||+.+.+.|+...++++|||||||||++|+.+|+++++|||+|||||||+++
T Consensus       159 iiIAYEPvWAIGtG~~a~~~~i~~~~~~Ir~~l~~~~~~~~~~~i~iLYGGSV~~~N~~~i~~~~~iDG~LVGgASL~~e  238 (247)
T d1neya_         159 VVVAYEPVWAIGTGLAATPEDAQDIHASIRKFLASKLGDKAASELRILYGGSANGSNAVTFKDKADVDGFLVGGASLKPE  238 (247)
T ss_dssp             EEEEECCGGGTTTSCCCCHHHHHHHHHHHHHHHHHHHCHHHHHHCCEEEESSCCTTTGGGGTTCTTCCEEEESGGGGSTH
T ss_pred             eEEEecchhcccCCcccChhhhhhhhHHHHHHHHHhhhhhhcccCcEEEeCCCCHHHHHHHhcCCCCCeEEeehHhCChH
Confidence            99999999999999999999999999999999999998888899999999999999999999999999999999999967


Q ss_pred             HHHHHHHH
Q 025540          241 FIDIIKSA  248 (251)
Q Consensus       241 F~~Ii~~~  248 (251)
                      |.+||++.
T Consensus       239 F~~Ii~~~  246 (247)
T d1neya_         239 FVDIINSR  246 (247)
T ss_dssp             HHHHHTTT
T ss_pred             HHHHHhcc
Confidence            99999864
>d1r2ra_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n55a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} Back     information, alignment and structure
>d1kv5a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1m6ja_ c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba histolytica [TaxId: 5759]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1jfxa_ c.1.8.8 (A:) Streptomyces lysozyme {Streptomyces coelicolor, "mueller" dsm3030 [TaxId: 1902]} Back     information, alignment and structure