Citrus Sinensis ID: 025727

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MENLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYDSSSPDGAASSAASKNIVSERNRRKKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESGKSKKNFGFDFEQELPVLLRPKKKKIDRFFDSAGSRTAPVEILELRVKTMGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEVRFLFFSLFFSTYHHQLFLFKPKKGQKFYPIS
cccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccEEEEEEEccccccHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEEEEEcccccccccccccccccccccccccccccc
cccccHcccHHHccccccHHHHcccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEEcccEEEEEEEEEccEEEEEEEcccccEEEEEccccccEEEccc
MENLGEDYQQEYQNYWETKMFLqneefdtwpldeafsgyydssspdgaassaaSKNIVSERNRRKKLNERLFALRSvvpniskmdkASIIKDAIDYIQELHEQEKRIRDEIMElesgkskknfgfdfeqelpvllrpkkkKIDRFfdsagsrtapVEILELRVKTMGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEVRFLFFSLFFSTYhhqlflfkpkkgqkfypis
MENLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYDSSSpdgaassaasknivsernrrkklnERLFalrsvvpniskmdkasIIKDAIDYIQELHEQEKRIRDEIMELesgkskknfgfdfeqelpvllrpkkKKIDrffdsagsrtapvEILELRVKTMGEKILVVSvtcskrtdTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEVRFLFFSLFFSTYHHQLflfkpkkgqkfypis
MENLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYDssspdgaassaasKNIVSERNRRKKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESGKSKKNFGFDFEQELPVLLRPKKKKIDRFFDSAGSRTAPVEILELRVKTMGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEVRFLFFSLFFSTYHHQLFLFKPKKGQKFYPIS
**********EYQNYWETKMFLQNEEFDTWPLDEAFSGYY*****************************RLFALRSVVPNISKMDKASIIKDAIDYIQELH*********************FGFDFEQELPVLLRPKKKKIDRFFDSAGSRTAPVEILELRVKTMGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEVRFLFFSLFFSTYHHQLFLFKP**********
****************************************************************KKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHE*********************************************************ELRVKTMGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEVRFLFFSLFFSTYHHQLFLFKPKKGQKFYP**
MENLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYD***************IVSERNRRKKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESGKSKKNFGFDFEQELPVLLRPKKKKIDRFFDSAGSRTAPVEILELRVKTMGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEVRFLFFSLFFSTYHHQLFLFKPKKGQKFYPIS
**NLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYD****************VSERNRRKKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELE**************************************APVEILELRVKTMGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEVRFLFFSLFFSTYHHQLFLFKPKKGQKFYPIS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYDSSSPDGAASSAASKNIVSERNRRKKLNERLFALRSVVPNISKMDKASIIKDAIDYxxxxxxxxxxxxxxxxxxxxxKSKKNFGFDFEQELPVLLRPKKKKIDRFFDSAGSRTAPVEILELRVKTMGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEVRFLFFSLFFSTYHHQLFLFKPKKGQKFYPIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
Q2HIV9248 Transcription factor bHLH yes no 0.815 0.818 0.633 2e-68
Q700E3263 Transcription factor bHLH no no 0.855 0.809 0.533 1e-59
Q9ZVX2571 Transcription factor ABOR no no 0.590 0.257 0.333 2e-18
Q9FIP9592 Transcription factor ATR2 no no 0.650 0.273 0.331 5e-16
O49687589 Transcription factor MYC4 no no 0.574 0.242 0.314 1e-15
Q0V7X4318 Transcription factor FER- no no 0.570 0.446 0.326 3e-15
Q39204623 Transcription factor MYC2 no no 0.598 0.239 0.316 4e-15
Q9LNJ5590 Transcription factor bHLH no no 0.506 0.213 0.327 5e-15
Q9LSE2494 Transcription factor ICE1 no no 0.590 0.297 0.360 1e-14
Q9LPW3450 Transcription factor SCRE no no 0.598 0.331 0.361 2e-14
>sp|Q2HIV9|BH035_ARATH Transcription factor bHLH35 OS=Arabidopsis thaliana GN=BHLH35 PE=2 SV=1 Back     alignment and function desciption
 Score =  259 bits (661), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 167/213 (78%), Gaps = 10/213 (4%)

Query: 10  QEYQNYWETKMFLQNEEFD---TWPLDEAFSGYYDSSSPDGAASSAASKNIVSERNRRKK 66
           QE  NYWE   FLQNE+F+   +WPL+EA SG YDSSSPDGAASS ASKNIVSERNRR+K
Sbjct: 7   QELSNYWEPSSFLQNEDFEYDRSWPLEEAISGSYDSSSPDGAASSPASKNIVSERNRRQK 66

Query: 67  LNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESG-KSKKNFGF 125
           LN+RLFALRSVVPNI+KMDKASIIKDAI YI+ L  +EK++  EI ELES  KS  +F  
Sbjct: 67  LNQRLFALRSVVPNITKMDKASIIKDAISYIEGLQYEEKKLEAEIRELESTPKSSLSFSK 126

Query: 126 DFEQELPVLLRPKK-KKIDRFFDSAGSRTAPVEILELRVKTMGEKILVVSVTCSKRTDTM 184
           DF+++L V +  KK K++D     +GS T+ +E+LEL+V  MGE+ +VVSVTC+KRTDTM
Sbjct: 127 DFDRDLLVPVTSKKMKQLD-----SGSSTSLIEVLELKVTFMGERTMVVSVTCNKRTDTM 181

Query: 185 VKLCEAFESLKLKIITANITAVAGRLLKTAFIE 217
           VKLCE FESL LKI+T+N+T+ +G +  T FIE
Sbjct: 182 VKLCEVFESLNLKILTSNLTSFSGMIFHTVFIE 214

Arabidopsis thaliana (taxid: 3702)
>sp|Q700E3|BH027_ARATH Transcription factor bHLH27 OS=Arabidopsis thaliana GN=BHLH27 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVX2|AMS_ARATH Transcription factor ABORTED MICROSPORES OS=Arabidopsis thaliana GN=AMS PE=1 SV=2 Back     alignment and function description
>sp|Q9FIP9|ATR2_ARATH Transcription factor ATR2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 Back     alignment and function description
>sp|O49687|BH004_ARATH Transcription factor MYC4 OS=Arabidopsis thaliana GN=BHLH4 PE=2 SV=1 Back     alignment and function description
>sp|Q0V7X4|FIT_ARATH Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR OS=Arabidopsis thaliana GN=FIT PE=1 SV=1 Back     alignment and function description
>sp|Q39204|RAP1_ARATH Transcription factor MYC2 OS=Arabidopsis thaliana GN=RAP1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LNJ5|BH013_ARATH Transcription factor bHLH13 OS=Arabidopsis thaliana GN=BHLH13 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSE2|ICE1_ARATH Transcription factor ICE1 OS=Arabidopsis thaliana GN=SCRM PE=1 SV=1 Back     alignment and function description
>sp|Q9LPW3|SCRM2_ARATH Transcription factor SCREAM2 OS=Arabidopsis thaliana GN=SCRM2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
224087273248 predicted protein [Populus trichocarpa] 0.859 0.862 0.791 5e-93
255554432213 DNA binding protein, putative [Ricinus c 0.791 0.924 0.835 1e-90
358248852244 uncharacterized protein LOC100817978 [Gl 0.855 0.872 0.761 3e-90
225445937244 PREDICTED: transcription factor bHLH35 [ 0.851 0.868 0.772 7e-90
147861941 805 hypothetical protein VITISV_044397 [Viti 0.851 0.263 0.772 1e-89
356556246243 PREDICTED: transcription factor bHLH35-l 0.855 0.876 0.761 1e-89
357449601244 Transcription factor bHLH [Medicago trun 0.855 0.872 0.721 9e-85
449457201241 PREDICTED: transcription factor bHLH35-l 0.839 0.867 0.654 1e-72
356548804233 PREDICTED: transcription factor bHLH35-l 0.867 0.927 0.653 3e-72
224142691244 predicted protein [Populus trichocarpa] 0.831 0.848 0.622 1e-67
>gi|224087273|ref|XP_002308110.1| predicted protein [Populus trichocarpa] gi|222854086|gb|EEE91633.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  346 bits (887), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 196/221 (88%), Gaps = 7/221 (3%)

Query: 1   MENLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYDSSSPDGAASSAASKNIVSE 60
           +EN+GE    EYQNYWETKMFLQNEEFD+W +DEAFSGYYDSSSPDGAASSAASKNIVSE
Sbjct: 4   IENIGE----EYQNYWETKMFLQNEEFDSWAIDEAFSGYYDSSSPDGAASSAASKNIVSE 59

Query: 61  RNRRKKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESGKSK 120
           RNRRK+LNERLFALR+VVPNISKMDKASIIKDAIDYIQELH+QE+RI+ EI+ELESGK K
Sbjct: 60  RNRRKRLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHKQERRIQAEILELESGKLK 119

Query: 121 KNFGFD-FEQELPVLLRPKKKKI-DRFFDSAGSRT-APVEILELRVKTMGEKILVVSVTC 177
           K+ GFD FEQELP LLR KKKKI DRF D  GS+  + +E+LELRV  MGEK L+VS+TC
Sbjct: 120 KDPGFDVFEQELPALLRSKKKKIDDRFCDFGGSKNFSRIELLELRVAYMGEKTLLVSLTC 179

Query: 178 SKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEV 218
           SKRTDTMVKLCE FESL++KIITANIT V+GR+LKT FIE 
Sbjct: 180 SKRTDTMVKLCEVFESLRVKIITANITTVSGRVLKTVFIEA 220

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255554432|ref|XP_002518255.1| DNA binding protein, putative [Ricinus communis] gi|223542602|gb|EEF44141.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358248852|ref|NP_001239951.1| uncharacterized protein LOC100817978 [Glycine max] gi|255641230|gb|ACU20892.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225445937|ref|XP_002263999.1| PREDICTED: transcription factor bHLH35 [Vitis vinifera] gi|297735470|emb|CBI17910.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147861941|emb|CAN78766.1| hypothetical protein VITISV_044397 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356556246|ref|XP_003546437.1| PREDICTED: transcription factor bHLH35-like [Glycine max] Back     alignment and taxonomy information
>gi|357449601|ref|XP_003595077.1| Transcription factor bHLH [Medicago truncatula] gi|355484125|gb|AES65328.1| Transcription factor bHLH [Medicago truncatula] Back     alignment and taxonomy information
>gi|449457201|ref|XP_004146337.1| PREDICTED: transcription factor bHLH35-like [Cucumis sativus] gi|449502969|ref|XP_004161793.1| PREDICTED: transcription factor bHLH35-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356548804|ref|XP_003542789.1| PREDICTED: transcription factor bHLH35-like [Glycine max] Back     alignment and taxonomy information
>gi|224142691|ref|XP_002324688.1| predicted protein [Populus trichocarpa] gi|222866122|gb|EEF03253.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
TAIR|locus:2123954263 AT4G29930 "AT4G29930" [Arabido 0.855 0.809 0.484 1.1e-48
UNIPROTKB|Q84LF9310 RERJ1 "Transcription Factor" [ 0.248 0.2 0.677 2.1e-42
UNIPROTKB|Q7XKP5293 OSJNBb0013O03.11 "OSJNBb0013O0 0.658 0.559 0.346 7.5e-18
TAIR|locus:2039445571 AMS "AT2G16910" [Arabidopsis t 0.602 0.262 0.337 3.8e-17
UNIPROTKB|Q6YUS3552 OSJNBb0088N06.15 "BHLH protein 0.228 0.103 0.614 1e-16
TAIR|locus:2178555592 MYC3 "AT5G46760" [Arabidopsis 0.630 0.265 0.335 2.3e-16
TAIR|locus:2046198318 FRU "AT2G28160" [Arabidopsis t 0.566 0.443 0.328 8.7e-16
TAIR|locus:2035237590 AT1G01260 "AT1G01260" [Arabido 0.220 0.093 0.6 1.3e-15
UNIPROTKB|Q2R3F6524 Os11g0523700 "Helix-loop-helix 0.610 0.290 0.341 4.6e-15
TAIR|locus:2035609623 MYC2 "AT1G32640" [Arabidopsis 0.630 0.252 0.335 5e-15
TAIR|locus:2123954 AT4G29930 "AT4G29930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 508 (183.9 bits), Expect = 1.1e-48, P = 1.1e-48
 Identities = 109/225 (48%), Positives = 144/225 (64%)

Query:     6 EDYQQEYQNYWETKMFLQNEE--FDTWPLDEAFSGYYDXXXXXXXXXX-XXXKNIVSERN 62
             ED   EY+NYWET MF QN+E  FD+WP++EAFSG  +              KN+VSERN
Sbjct:     2 EDLDHEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSERN 61

Query:    63 RRKKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESGKSKK- 121
             RR+KLN+RLFALRSVVPNISK+DKAS+IKD+IDY+QEL +QEK +  EI ELES  +   
Sbjct:    62 RRQKLNQRLFALRSVVPNISKLDKASVIKDSIDYMQELIDQEKTLEAEIRELESRSTLLE 121

Query:   122 --------NFGFDFEQELPVLLRPKKKKIDRFFDSAGSRTAPVEILELRVKTMGEKILVV 173
                     NF     Q+       + KK  +   S   +  P+E+LE++V  MGEK +VV
Sbjct:   122 NPVRDYDCNFAETHLQDFSDNNDMRSKKFKQMDYSTRVQHYPIEVLEMKVTWMGEKTVVV 181

Query:   174 SVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEV 218
              +TCSK+ +TMV+LC+  ESL L I+T N ++   RL  T F++V
Sbjct:   182 CITCSKKRETMVQLCKVLESLNLNILTTNFSSFTSRLSTTLFLQV 226
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
UNIPROTKB|Q84LF9 RERJ1 "Transcription Factor" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XKP5 OSJNBb0013O03.11 "OSJNBb0013O03.11 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2039445 AMS "AT2G16910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6YUS3 OSJNBb0088N06.15 "BHLH protein-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2178555 MYC3 "AT5G46760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046198 FRU "AT2G28160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035237 AT1G01260 "AT1G01260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2R3F6 Os11g0523700 "Helix-loop-helix DNA-binding domain containing protein, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2035609 MYC2 "AT1G32640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2HIV9BH035_ARATHNo assigned EC number0.63380.81520.8185yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
smart0035353 smart00353, HLH, helix loop helix domain 4e-13
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 3e-12
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 4e-10
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information 
 Score = 61.9 bits (151), Expect = 4e-13
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 58  VSERNRRKKLNERLFALRSVVP---NISKMDKASIIKDAIDYIQELHEQEK 105
             ER RR+K+NE    LRS++P      K+ KA I++ AI+YI+ L E+ +
Sbjct: 2   ARERRRRRKINEAFDELRSLLPTLPKNKKLSKAEILRLAIEYIKSLQEELQ 52

Length = 53
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.41
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.4
smart0035353 HLH helix loop helix domain. 99.34
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.93
KOG1318411 consensus Helix loop helix transcription factor EB 98.92
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.49
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.4
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.39
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.37
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 98.27
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.23
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.22
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.05
KOG0561 373 consensus bHLH transcription factor [Transcription 97.94
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 97.92
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.82
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.74
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 97.72
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.66
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 97.61
PLN0321793 transcription factor ATBS1; Provisional 97.59
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.51
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.5
KOG4029228 consensus Transcription factor HAND2/Transcription 97.48
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 97.39
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.13
PRK05007884 PII uridylyl-transferase; Provisional 97.11
PRK00275895 glnD PII uridylyl-transferase; Provisional 97.02
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 96.96
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 96.94
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 96.91
PRK0019490 hypothetical protein; Validated 96.81
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 96.8
PRK04374869 PII uridylyl-transferase; Provisional 96.59
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.47
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 96.44
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 96.41
PRK03059856 PII uridylyl-transferase; Provisional 96.4
PRK05092931 PII uridylyl-transferase; Provisional 96.36
PRK01759854 glnD PII uridylyl-transferase; Provisional 96.34
PRK03381774 PII uridylyl-transferase; Provisional 96.1
PRK03381774 PII uridylyl-transferase; Provisional 96.09
TIGR01693 850 UTase_glnD [Protein-PII] uridylyltransferase. This 95.96
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 95.85
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 95.84
PRK01759854 glnD PII uridylyl-transferase; Provisional 95.74
PRK05007 884 PII uridylyl-transferase; Provisional 95.54
PRK00275 895 glnD PII uridylyl-transferase; Provisional 95.36
PRK03059856 PII uridylyl-transferase; Provisional 95.29
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 95.22
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 95.14
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 95.05
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 94.93
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 94.86
PRK04435147 hypothetical protein; Provisional 94.68
PRK05092 931 PII uridylyl-transferase; Provisional 94.65
cd0211660 ACT ACT domains are commonly involved in specifica 94.59
PRK04374869 PII uridylyl-transferase; Provisional 94.4
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 94.18
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 94.17
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 94.07
KOG4447173 consensus Transcription factor TWIST [Transcriptio 94.05
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 94.01
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 93.89
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 93.84
PRK08577136 hypothetical protein; Provisional 93.81
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 93.78
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 93.77
KOG3910632 consensus Helix loop helix transcription factor [T 93.51
PRK11589 190 gcvR glycine cleavage system transcriptional repre 93.22
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 93.04
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 92.96
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 92.59
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 92.59
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 92.23
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 92.16
PRK07334403 threonine dehydratase; Provisional 92.1
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 92.09
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 91.93
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 91.45
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 90.91
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 90.33
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 89.3
KOG4395285 consensus Transcription factor Atonal, contains HT 88.49
COG383090 ACT domain-containing protein [Signal transduction 87.85
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 87.56
CHL00100174 ilvH acetohydroxyacid synthase small subunit 87.44
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 87.42
KOG3898254 consensus Transcription factor NeuroD and related 87.37
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 86.84
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 86.83
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 86.6
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 86.42
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 86.37
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 86.36
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 86.31
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 86.18
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 86.11
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 84.8
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 84.06
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 84.0
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 83.99
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 82.82
PRK11589190 gcvR glycine cleavage system transcriptional repre 81.71
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information 
Probab=99.41  E-value=3.9e-13  Score=93.61  Aligned_cols=54  Identities=37%  Similarity=0.647  Sum_probs=50.7

Q ss_pred             chhhhcchhHHHHHHHHHHHHHHHhccCCCC---CCCCcchHHHHHHHHHHHHHHHH
Q 025727           51 SAASKNIVSERNRRKKLNERLFALRSVVPNI---SKMDKASIIKDAIDYIQELHEQE  104 (249)
Q Consensus        51 ~~~~~h~~~ER~RR~~in~~~~~LrslvP~~---~k~dKasIl~~ai~yI~~Lq~~~  104 (249)
                      ..+..|+..||+||++||..|..|+++||..   .|+||++||..|++||+.|+.++
T Consensus         3 ~~r~~~~~~Er~RR~~~n~~~~~L~~llp~~~~~~k~~k~~iL~~a~~yI~~L~~~~   59 (60)
T cd00083           3 SRREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELL   59 (60)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence            4678999999999999999999999999997   89999999999999999999765

A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 1e-15
1hlo_A80 Protein (transcription factor MAX); transcriptiona 4e-15
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 7e-15
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 2e-13
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 1e-10
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 7e-10
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 3e-06
4f3l_A 361 Mclock, circadian locomoter output cycles protein 5e-06
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 6e-06
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 1e-05
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 8e-05
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
 Score = 69.3 bits (170), Expect = 1e-15
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 57  IVSERNRRKKLNERLFALRSVVPNI---SKMDKASIIKDAIDYIQELHEQEKRIRDEIME 113
            V ER RR +L    FALR  +P +    K  K  I+K A  YI  +  +E+++  E   
Sbjct: 11  NVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDL 70

Query: 114 LE 115
           L 
Sbjct: 71  LR 72
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Length = 76 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Length = 60 Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.68
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.61
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.61
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.6
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.59
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.54
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.52
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.51
4ati_A118 MITF, microphthalmia-associated transcription fact 99.5
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.43
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.42
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.24
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.23
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.92
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.76
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.73
4ath_A83 MITF, microphthalmia-associated transcription fact 98.67
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.15
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.55
1u8s_A 192 Glycine cleavage system transcriptional repressor, 97.21
2nyi_A 195 Unknown protein; protein structure initiative, PSI 96.99
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 96.48
2nyi_A195 Unknown protein; protein structure initiative, PSI 96.3
1u8s_A192 Glycine cleavage system transcriptional repressor, 95.76
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 95.33
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 94.88
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 94.42
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 93.94
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 93.87
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 93.69
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 92.94
2pc6_A165 Probable acetolactate synthase isozyme III (small; 92.6
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 92.33
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 91.57
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 88.34
2f06_A144 Conserved hypothetical protein; structural genomic 81.04
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.68  E-value=5.1e-17  Score=120.55  Aligned_cols=68  Identities=22%  Similarity=0.506  Sum_probs=63.7

Q ss_pred             chhhhcchhHHHHHHHHHHHHHHHhccCCCC-CCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Q 025727           51 SAASKNIVSERNRRKKLNERLFALRSVVPNI-SKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESGK  118 (249)
Q Consensus        51 ~~~~~h~~~ER~RR~~in~~~~~LrslvP~~-~k~dKasIl~~ai~yI~~Lq~~~~~L~~~~~~l~s~~  118 (249)
                      .++..|+.+||+||++||+.|.+|+++||+. .|+||++||.+||+||++||.+++.|+.+...|+...
T Consensus         5 ~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~~~   73 (82)
T 1am9_A            5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAV   73 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4688999999999999999999999999997 8999999999999999999999999999999887543
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 1e-15
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 9e-14
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 2e-13
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 4e-13
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 1e-12
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 6e-12
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 4e-11
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 2e-10
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.1 bits (164), Expect = 1e-15
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 64  RKKLNERLFALRSVVPNI-SKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESGKSKKN 122
           R  +N+++  L+ +V    +KM K+ +++ AIDYI+ L +   ++R E M L+    K  
Sbjct: 1   RSSINDKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNK 60
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.56
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.54
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.48
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.42
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 97.67
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.59
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 96.68
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 95.99
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 95.81
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 95.3
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 93.42
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 89.86
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 89.43
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 88.93
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 87.19
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 86.62
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 83.57
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.61  E-value=3.5e-16  Score=113.61  Aligned_cols=68  Identities=22%  Similarity=0.516  Sum_probs=62.4

Q ss_pred             CchhhhcchhHHHHHHHHHHHHHHHhccCCCC-CCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q 025727           50 SSAASKNIVSERNRRKKLNERLFALRSVVPNI-SKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESG  117 (249)
Q Consensus        50 ~~~~~~h~~~ER~RR~~in~~~~~LrslvP~~-~k~dKasIl~~ai~yI~~Lq~~~~~L~~~~~~l~s~  117 (249)
                      ..+|..|+.+||+||++||+.|..|+++||+. .|++|++||..||+||+.|+.+++.|..+...|+..
T Consensus         4 ~~kR~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk~~   72 (80)
T d1am9a_           4 GEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTA   72 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35688999999999999999999999999985 699999999999999999999999999998887643
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure