Citrus Sinensis ID: 025983

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEAVQKSEEFDIRYS
ccccccccccccccEEEEcccccEEcccccEEEcccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccc
ccccccccccccccEEEEcccccEEcHHccEEEcccEccccccHEEccccccccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccc
mtdafcsdckkhtevvfdhsagdtvcsecglvleshsidetsewrtfanesgdndpvrvggptnplladgglstviakpngasgeflSSSLGrwqnrgsnpdrGLILAFKTIATMSDRLGLVATIKDRANEIYKKVedqkssrgrnQDALLAACLYIACrqedkprtvKEICSVANGATKKEIGRAKEYIVKQLgletgqsvemgtihAGDFMRRFCSNLGMNNQAVKAAQEAVQKSeefdirys
mtdafcsdcKKHTevvfdhsagdtVCSECGLVLESHSIDETSEWRTFanesgdndpvrVGGPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYkkvedqkssrgrnQDALLAACLYIAcrqedkprtvKEICSvangatkkeigrAKEYIVKqlgletgqsvEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEavqkseefdirys
MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNqavkaaqeavqkSEEFDIRYS
****FCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDE***W**********************************************************RGLILAFKTIATMSDRLGLVATIKDRANEIYK*************DALLAACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGM***********************
**DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEW*************************GGLSTVIA**************************GLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEAVQKSEEF*****
********CKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKK*********RNQDALLAACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQ********************
****FCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANE*******RVGGPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEAVQKSEEF*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEAVQKSEEFDIRYS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query245 2.2.26 [Sep-21-2011]
Q9SS44312 Transcription initiation yes no 1.0 0.785 0.942 1e-138
P48513313 Transcription initiation yes no 1.0 0.782 0.930 1e-133
Q8W0W3312 Transcription initiation yes no 1.0 0.785 0.885 1e-130
P48512312 Transcription initiation no no 1.0 0.785 0.853 1e-125
P29052315 Transcription initiation yes no 0.922 0.717 0.5 3e-54
Q5R886316 Transcription initiation yes no 0.914 0.708 0.491 2e-53
Q4R3J5316 Transcription initiation N/A no 0.914 0.708 0.491 2e-53
Q00403316 Transcription initiation yes no 0.914 0.708 0.491 2e-53
Q2KIN8316 Transcription initiation yes no 0.914 0.708 0.491 2e-53
P62916316 Transcription initiation yes no 0.914 0.708 0.491 2e-53
>sp|Q9SS44|TF2B2_ARATH Transcription initiation factor IIB-2 OS=Arabidopsis thaliana GN=TFIIB2 PE=2 SV=1 Back     alignment and function desciption
 Score =  490 bits (1262), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 231/245 (94%), Positives = 241/245 (98%)

Query: 1   MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG 60
           M+DAFCSDCK+HTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG
Sbjct: 1   MSDAFCSDCKRHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG 60

Query: 61  GPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLG 120
           GPTNPLLADGGL+TVI+KPNG+SG+FLSSSLGRWQNRGSNPDRGLI+AFKTIATM+DRLG
Sbjct: 61  GPTNPLLADGGLTTVISKPNGSSGDFLSSSLGRWQNRGSNPDRGLIVAFKTIATMADRLG 120

Query: 121 LVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK 180
           LVATIKDRANEIYK+VEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK
Sbjct: 121 LVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK 180

Query: 181 KEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEAVQKSEEF 240
           KEIGRAKEYIVKQLGLETGQ VEMGTIHAGDFMRRFCSNLGM NQ VKAAQE+VQKSEEF
Sbjct: 181 KEIGRAKEYIVKQLGLETGQLVEMGTIHAGDFMRRFCSNLGMTNQTVKAAQESVQKSEEF 240

Query: 241 DIRYS 245
           DIR S
Sbjct: 241 DIRRS 245
General factor that plays a major role in the activation of eukaryotic genes transcribed by RNA polymerase II.
Arabidopsis thaliana (taxid: 3702)
>sp|P48513|TF2B_SOYBN Transcription initiation factor IIB OS=Glycine max GN=TFIIB1 PE=2 SV=1 Back     alignment and function description
>sp|Q8W0W3|TF2B_ORYSJ Transcription initiation factor IIB OS=Oryza sativa subsp. japonica GN=TFIIB PE=1 SV=1 Back     alignment and function description
>sp|P48512|TF2B1_ARATH Transcription initiation factor IIB-1 OS=Arabidopsis thaliana GN=TFIIB1 PE=1 SV=1 Back     alignment and function description
>sp|P29052|TF2B_DROME Transcription initiation factor IIB OS=Drosophila melanogaster GN=TfIIB PE=2 SV=1 Back     alignment and function description
>sp|Q5R886|TF2B_PONAB Transcription initiation factor IIB OS=Pongo abelii GN=GTF2B PE=2 SV=1 Back     alignment and function description
>sp|Q4R3J5|TF2B_MACFA Transcription initiation factor IIB OS=Macaca fascicularis GN=GTF2B PE=2 SV=1 Back     alignment and function description
>sp|Q00403|TF2B_HUMAN Transcription initiation factor IIB OS=Homo sapiens GN=GTF2B PE=1 SV=1 Back     alignment and function description
>sp|Q2KIN8|TF2B_BOVIN Transcription initiation factor IIB OS=Bos taurus GN=GTF2B PE=2 SV=1 Back     alignment and function description
>sp|P62916|TF2B_RAT Transcription initiation factor IIB OS=Rattus norvegicus GN=Gtf2b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
317106705312 JHL06B08.6 [Jatropha curcas] 1.0 0.785 0.979 1e-139
255588003312 transcription initiation factor iib, put 1.0 0.785 0.975 1e-139
449465789312 PREDICTED: transcription initiation fact 1.0 0.785 0.971 1e-139
297829558312 transcription initiation factor IIB-2 [A 1.0 0.785 0.946 1e-137
15228267312 transcription initiation factor IIB-2 [A 1.0 0.785 0.942 1e-136
224138070312 predicted protein [Populus trichocarpa] 1.0 0.785 0.951 1e-135
225441886312 PREDICTED: transcription initiation fact 1.0 0.785 0.942 1e-134
225464249312 PREDICTED: transcription initiation fact 1.0 0.785 0.942 1e-134
224090077312 predicted protein [Populus trichocarpa] 1.0 0.785 0.938 1e-133
357509669313 Transcription initiation factor IIB [Med 1.0 0.782 0.926 1e-132
>gi|317106705|dbj|BAJ53205.1| JHL06B08.6 [Jatropha curcas] Back     alignment and taxonomy information
 Score =  499 bits (1285), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 240/245 (97%), Positives = 242/245 (98%)

Query: 1   MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG 60
           M DAFCSDCK+ TEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG
Sbjct: 1   MGDAFCSDCKRQTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG 60

Query: 61  GPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLG 120
           GPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLG
Sbjct: 61  GPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLG 120

Query: 121 LVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK 180
           LVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK
Sbjct: 121 LVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK 180

Query: 181 KEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEAVQKSEEF 240
           KEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQA+KAAQEAVQKSEEF
Sbjct: 181 KEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAMKAAQEAVQKSEEF 240

Query: 241 DIRYS 245
           DIR S
Sbjct: 241 DIRRS 245

Source: Jatropha curcas

Species: Jatropha curcas

Genus: Jatropha

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255588003|ref|XP_002534470.1| transcription initiation factor iib, putative [Ricinus communis] gi|223525233|gb|EEF27913.1| transcription initiation factor iib, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449465789|ref|XP_004150610.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis sativus] gi|449529834|ref|XP_004171903.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297829558|ref|XP_002882661.1| transcription initiation factor IIB-2 [Arabidopsis lyrata subsp. lyrata] gi|297328501|gb|EFH58920.1| transcription initiation factor IIB-2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228267|ref|NP_187644.1| transcription initiation factor IIB-2 [Arabidopsis thaliana] gi|21363045|sp|Q9SS44.1|TF2B2_ARATH RecName: Full=Transcription initiation factor IIB-2; AltName: Full=General transcription factor TFIIB-2; Short=AtTFIIB2 gi|6056193|gb|AAF02810.1|AC009400_6 transcription initiation factor IIB (TFIIB) [Arabidopsis thaliana] gi|15215784|gb|AAK91437.1| AT3g10330/F14P13_7 [Arabidopsis thaliana] gi|16974427|gb|AAL31139.1| AT3g10330/F14P13_7 [Arabidopsis thaliana] gi|21593436|gb|AAM65403.1| transcription initiation factor IIB (TFIIB) [Arabidopsis thaliana] gi|39545880|gb|AAR28003.1| TFIIB2 [Arabidopsis thaliana] gi|332641371|gb|AEE74892.1| transcription initiation factor IIB-2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224138070|ref|XP_002322722.1| predicted protein [Populus trichocarpa] gi|222867352|gb|EEF04483.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225441886|ref|XP_002284342.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera] gi|297739630|emb|CBI29812.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225464249|ref|XP_002269045.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera] gi|296088031|emb|CBI35314.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224090077|ref|XP_002308933.1| predicted protein [Populus trichocarpa] gi|222854909|gb|EEE92456.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357509669|ref|XP_003625123.1| Transcription initiation factor IIB [Medicago truncatula] gi|355500138|gb|AES81341.1| Transcription initiation factor IIB [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
TAIR|locus:2076259312 AT3G10330 [Arabidopsis thalian 1.0 0.785 0.902 8.8e-118
TAIR|locus:2062703312 TFIIB "transcription factor II 1.0 0.785 0.808 6.5e-106
FB|FBgn0004915315 TfIIB "Transcription factor II 0.922 0.717 0.487 1.5e-49
UNIPROTKB|F1NXP2306 GTF2B "Uncharacterized protein 0.922 0.738 0.478 1.5e-49
ZFIN|ZDB-GENE-030131-3544316 gtf2b "general transcription f 0.922 0.715 0.474 8.5e-49
UNIPROTKB|F2Z4J6316 LOC786656 "Uncharacterized pro 0.922 0.715 0.470 2.3e-48
UNIPROTKB|Q2KIN8316 GTF2B "Transcription initiatio 0.922 0.715 0.470 2.3e-48
UNIPROTKB|E2RPG1316 GTF2B "Uncharacterized protein 0.922 0.715 0.470 2.3e-48
UNIPROTKB|Q00403316 GTF2B "Transcription initiatio 0.922 0.715 0.470 2.3e-48
UNIPROTKB|F2Z5J6316 GTF2B "Uncharacterized protein 0.922 0.715 0.470 2.3e-48
TAIR|locus:2076259 AT3G10330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1160 (413.4 bits), Expect = 8.8e-118, P = 8.8e-118
 Identities = 221/245 (90%), Positives = 230/245 (93%)

Query:     1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG 60
             M+DAFCSDCK+HTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG
Sbjct:     1 MSDAFCSDCKRHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG 60

Query:    61 GPTNPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLG 120
             GPTNPLLADGGL+TVI+KPNG+SG+FLSSSLGRWQNRGSNPDRGLI+AFKTIATM+DRLG
Sbjct:    61 GPTNPLLADGGLTTVISKPNGSSGDFLSSSLGRWQNRGSNPDRGLIVAFKTIATMADRLG 120

Query:   121 LVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK 180
             LVATIKDRANEIYK+VEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK
Sbjct:   121 LVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK 180

Query:   181 KEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNXXXXXXXXXXXXSEEF 240
             KEIGRAKEYIVKQLGLETGQ VEMGTIHAGDFMRRFCSNLGM N            SEEF
Sbjct:   181 KEIGRAKEYIVKQLGLETGQLVEMGTIHAGDFMRRFCSNLGMTNQTVKAAQESVQKSEEF 240

Query:   241 DIRYS 245
             DIR S
Sbjct:   241 DIRRS 245
GO:0003743 "translation initiation factor activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006352 "DNA-dependent transcription, initiation" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0006413 "translational initiation" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=RCA
TAIR|locus:2062703 TFIIB "transcription factor IIB" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0004915 TfIIB "Transcription factor IIB" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXP2 GTF2B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3544 gtf2b "general transcription factor IIB" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4J6 LOC786656 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIN8 GTF2B "Transcription initiation factor IIB" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPG1 GTF2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q00403 GTF2B "Transcription initiation factor IIB" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5J6 GTF2B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8W0W3TF2B_ORYSJNo assigned EC number0.88571.00.7852yesno
Q9SS44TF2B2_ARATHNo assigned EC number0.94281.00.7852yesno
P48513TF2B_SOYBNNo assigned EC number0.93081.00.7827yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
COG1405285 COG1405, SUA7, Transcription initiation factor TFI 7e-57
PRK00423310 PRK00423, tfb, transcription initiation factor IIB 4e-45
pfam0038271 pfam00382, TFIIB, Transcription factor TFIIB repea 9e-18
cd0004388 cd00043, CYCLIN, Cyclin box fold 2e-12
pfam0827140 pfam08271, TF_Zn_Ribbon, TFIIB zinc-binding 8e-11
smart0038583 smart00385, CYCLIN, domain present in cyclins, TFI 2e-10
COG1405285 COG1405, SUA7, Transcription initiation factor TFI 2e-09
PRK00423310 PRK00423, tfb, transcription initiation factor IIB 6e-07
COG5333 297 COG5333, CCL1, Cdk activating kinase (CAK)/RNA pol 6e-04
pfam00134127 pfam00134, Cyclin_N, Cyclin, N-terminal domain 0.001
>gnl|CDD|224323 COG1405, SUA7, Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information 
 Score =  182 bits (464), Expect = 7e-57
 Identities = 81/237 (34%), Positives = 126/237 (53%), Gaps = 19/237 (8%)

Query: 6   CSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNP 65
           C +C   T ++ D+  G+ VC++CGLVLE   ID   EWR F     +    RVG P  P
Sbjct: 4   CPECGS-TNIITDYERGEIVCADCGLVLEDSLIDPGPEWRAF----DERHERRVGAPLTP 58

Query: 66  LLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNP---DRGLILAFKTIATMSDRLGLV 122
            + D GLST+I   +          L +WQ R       +R LI A + +  ++  LGL 
Sbjct: 59  SIHDKGLSTIIGWGDKD----KMYRLRKWQIRIRVSSAKERNLITALEELERIASALGLP 114

Query: 123 ATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATKKE 182
            ++++ A  IY+K  D+   RGR+ +++ AAC+Y ACR    PRT+ EI     G +KKE
Sbjct: 115 ESVRETAARIYRKAVDKGLLRGRSIESVAAACIYAACRINGVPRTLDEIAKAL-GVSKKE 173

Query: 183 IGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEAVQKSEE 239
           IGR    +V++L L+         +   D++ RF S LG++++  + A E V+K++ 
Sbjct: 174 IGRTYRLLVRELKLKI------PPVDPSDYIPRFASKLGLSDEVRRKAIEIVKKAKR 224

Length = 285
>gnl|CDD|234758 PRK00423, tfb, transcription initiation factor IIB; Reviewed Back     alignment and domain information
>gnl|CDD|109440 pfam00382, TFIIB, Transcription factor TFIIB repeat Back     alignment and domain information
>gnl|CDD|238003 cd00043, CYCLIN, Cyclin box fold Back     alignment and domain information
>gnl|CDD|203895 pfam08271, TF_Zn_Ribbon, TFIIB zinc-binding Back     alignment and domain information
>gnl|CDD|214641 smart00385, CYCLIN, domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>gnl|CDD|224323 COG1405, SUA7, Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>gnl|CDD|234758 PRK00423, tfb, transcription initiation factor IIB; Reviewed Back     alignment and domain information
>gnl|CDD|227640 COG5333, CCL1, Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215740 pfam00134, Cyclin_N, Cyclin, N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 245
PRK00423310 tfb transcription initiation factor IIB; Reviewed 100.0
KOG1597308 consensus Transcription initiation factor TFIIB [T 100.0
COG1405285 SUA7 Transcription initiation factor TFIIIB, Brf1 100.0
KOG1598 521 consensus Transcription initiation factor TFIIIB, 99.98
PF0038271 TFIIB: Transcription factor TFIIB repeat; InterPro 99.83
PRK00423310 tfb transcription initiation factor IIB; Reviewed 99.67
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 99.67
COG1405285 SUA7 Transcription initiation factor TFIIIB, Brf1 99.55
KOG1597308 consensus Transcription initiation factor TFIIB [T 99.49
cd0004388 CYCLIN Cyclin box fold. Protein binding domain fun 99.26
smart0038583 CYCLIN domain present in cyclins, TFIIB and Retino 99.15
KOG0834 323 consensus CDK9 kinase-activating protein cyclin T 98.99
TIGR00569 305 ccl1 cyclin ccl1. University). 98.94
KOG1598 521 consensus Transcription initiation factor TFIIIB, 98.76
KOG0835 367 consensus Cyclin L [General function prediction on 98.61
COG5333 297 CCL1 Cdk activating kinase (CAK)/RNA polymerase II 98.51
PF00134127 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR 98.12
KOG0794264 consensus CDK8 kinase-activating protein cyclin C 97.95
KOG0656 335 consensus G1/S-specific cyclin D [Cell cycle contr 97.92
PF01857135 RB_B: Retinoblastoma-associated protein B domain; 97.9
PF1178136 RRN7: RNA polymerase I-specific transcription init 97.46
KOG2496 325 consensus Cdk activating kinase (CAK)/RNA polymera 97.41
KOG0835367 consensus Cyclin L [General function prediction on 97.16
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 97.14
PHA0062659 hypothetical protein 97.05
PF02984118 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR 97.03
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 96.84
PF0038271 TFIIB: Transcription factor TFIIB repeat; InterPro 96.83
COG205167 RPS27A Ribosomal protein S27E [Translation, riboso 96.77
PF0166755 Ribosomal_S27e: Ribosomal protein S27; InterPro: I 96.73
PRK00420112 hypothetical protein; Validated 96.7
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 96.62
PF1324826 zf-ribbon_3: zinc-ribbon domain 96.6
KOG0653391 consensus Cyclin B and related kinase-activating p 96.52
COG5024440 Cyclin [Cell division and chromosome partitioning] 96.34
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 96.33
PF1324023 zinc_ribbon_2: zinc-ribbon domain 96.32
PLN0020986 ribosomal protein S27; Provisional 96.27
PTZ0008385 40S ribosomal protein S27; Provisional 96.2
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 96.19
COG1645131 Uncharacterized Zn-finger containing protein [Gene 96.16
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 95.78
smart0077837 Prim_Zn_Ribbon Zinc-binding domain of primase-heli 95.78
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 95.59
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 95.51
PRK0043250 30S ribosomal protein S27ae; Validated 95.51
PF1435461 Lar_restr_allev: Restriction alleviation protein L 95.34
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 95.34
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 95.15
PRK00464154 nrdR transcriptional regulator NrdR; Validated 95.13
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 95.1
PRK1182760 hypothetical protein; Provisional 94.98
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 94.82
smart0066152 RPOL9 RNA polymerase subunit 9. 94.66
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 94.59
TIGR00244147 transcriptional regulator NrdR. Members of this al 94.46
PRK10220111 hypothetical protein; Provisional 94.45
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 94.32
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 94.31
COG283560 Uncharacterized conserved protein [Function unknow 94.17
PF0827340 Prim_Zn_Ribbon: Zinc-binding domain of primase-hel 94.15
PF0396668 Trm112p: Trm112p-like protein; InterPro: IPR005651 94.11
PRK12495226 hypothetical protein; Provisional 94.01
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 93.99
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 93.91
PF08613149 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eu 93.82
COG2824112 PhnA Uncharacterized Zn-ribbon-containing protein 93.38
KOG4164497 consensus Cyclin ik3-1/CABLES [Cell cycle control, 92.74
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 92.68
KOG177984 consensus 40s ribosomal protein S27 [Translation, 92.55
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 92.44
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 92.41
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 92.27
PRK1489299 putative transcription elongation factor Elf1; Pro 92.06
TIGR00686109 phnA alkylphosphonate utilization operon protein P 91.92
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 91.74
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 91.69
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transc 91.56
COG1327156 Predicted transcriptional regulator, consists of a 91.56
PF0109639 TFIIS_C: Transcription factor S-II (TFIIS); InterP 91.54
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 91.44
KOG0655 408 consensus G1/S-specific cyclin E [Cell cycle contr 90.99
KOG4557 262 consensus Origin recognition complex, subunit 6 [R 90.96
PF1371937 zinc_ribbon_5: zinc-ribbon domain 90.95
PTZ0025590 60S ribosomal protein L37a; Provisional 90.91
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 90.9
COG4640 465 Predicted membrane protein [Function unknown] 90.77
KOG4557262 consensus Origin recognition complex, subunit 6 [R 90.77
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 90.69
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 90.45
PRK0971064 lar restriction alleviation and modification prote 90.45
PF05460 353 ORC6: Origin recognition complex subunit 6 (ORC6); 90.35
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 90.22
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 90.08
PRK1228657 rpmF 50S ribosomal protein L32; Reviewed 90.05
KOG1010 920 consensus Rb (Retinoblastoma tumor suppressor)-rel 90.03
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 89.72
COG347868 Predicted nucleic-acid-binding protein containing 89.7
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 89.66
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 89.58
PF1425552 Cys_rich_CPXG: Cysteine-rich CPXCG 89.48
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 89.37
PRK0967872 DNA-binding transcriptional regulator; Provisional 89.14
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 88.98
TIGR0244359 conserved hypothetical metal-binding protein. Memb 88.83
PF1277350 DZR: Double zinc ribbon 88.81
PRK05978148 hypothetical protein; Provisional 88.59
COG406864 Uncharacterized protein containing a Zn-ribbon [Fu 88.53
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 88.51
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 87.92
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 87.87
PRK06266178 transcription initiation factor E subunit alpha; V 87.76
PF0178356 Ribosomal_L32p: Ribosomal L32p protein family; Int 87.59
PF15616131 TerY-C: TerY-C metal binding domain 87.4
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 87.33
PF0985564 DUF2082: Nucleic-acid-binding protein containing Z 87.32
KOG0794264 consensus CDK8 kinase-activating protein cyclin C 86.88
COG5349126 Uncharacterized protein conserved in bacteria [Fun 86.76
TIGR0103155 rpmF_bact ribosomal protein L32. This protein desc 86.58
PRK02935110 hypothetical protein; Provisional 86.38
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 86.36
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 86.07
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 86.07
PF0311928 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f 86.05
TIGR00569305 ccl1 cyclin ccl1. University). 85.83
COG3877122 Uncharacterized protein conserved in bacteria [Fun 85.45
PF1495244 zf-tcix: Putative treble-clef, zinc-finger, Zn-bin 85.34
PF0952671 DUF2387: Probable metal-binding protein (DUF2387); 85.07
PF11672102 DUF3268: Protein of unknown function (DUF3268); In 84.99
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 84.98
PF0016542 HTH_AraC: Bacterial regulatory helix-turn-helix pr 84.81
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 84.68
COG1326201 Uncharacterized archaeal Zn-finger protein [Genera 84.29
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 84.08
KOG1010 920 consensus Rb (Retinoblastoma tumor suppressor)-rel 84.06
KOG2906105 consensus RNA polymerase III subunit C11 [Transcri 84.03
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 83.89
PRK12336201 translation initiation factor IF-2 subunit beta; P 83.64
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 83.62
PF04161208 Arv1: Arv1-like family ; InterPro: IPR007290 Arv1 83.6
TIGR03826137 YvyF flagellar operon protein TIGR03826. This gene 83.58
cd0004388 CYCLIN Cyclin box fold. Protein binding domain fun 83.29
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 83.13
PF1371736 zinc_ribbon_4: zinc-ribbon domain 83.09
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 82.57
PF11023114 DUF2614: Protein of unknown function (DUF2614); In 81.84
PHA02942383 putative transposase; Provisional 81.67
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 81.49
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 81.36
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 81.17
PRK10857164 DNA-binding transcriptional regulator IscR; Provis 81.13
PRK14559 645 putative protein serine/threonine phosphatase; Pro 81.1
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA pro 81.05
PRK08402355 replication factor A; Reviewed 80.15
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 80.14
PF1412287 YokU: YokU-like protein 80.01
KOG0834323 consensus CDK9 kinase-activating protein cyclin T 80.01
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information 
Probab=100.00  E-value=6.2e-59  Score=405.58  Aligned_cols=233  Identities=34%  Similarity=0.655  Sum_probs=214.7

Q ss_pred             CCCCCCCCCCceeeeCCCCceEccCCcccccccccccCcccccccCCCCCCCCCcccCCCCccccCCCceeEEecCC-CC
Q 025983            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPN-GA   82 (245)
Q Consensus         4 ~~Cp~Cg~~~~iv~d~~~G~~vC~~CG~V~~e~~id~~~ewr~f~~~~~~~~~~r~G~~~~~~~~~~~l~t~i~~~~-~~   82 (245)
                      ..||+||+ +++++|+.+|++||.+||+|++|++||+|||||+|++++ .++++|+|+|.++++||.|++|.|+++. +.
T Consensus        12 ~~Cp~Cg~-~~iv~d~~~Ge~vC~~CG~Vl~e~~iD~g~EWR~f~~~~-~~~~~RvG~~~~~~~~~~gl~T~I~~~~~~~   89 (310)
T PRK00423         12 LVCPECGS-DKLIYDYERGEIVCADCGLVIEENIIDQGPEWRAFDPEQ-REKRSRVGAPMTYTIHDKGLSTDIDWRNKDS   89 (310)
T ss_pred             CcCcCCCC-CCeeEECCCCeEeecccCCcccccccccCCCccCCCccc-cCCccccCCCCCccccCCCCceEeecCCccc
Confidence            57999998 789999999999999999999999999999999999754 4689999999999999999999999655 34


Q ss_pred             Cccccc-------hhhhhcccCC---CCCchhHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhCCCCCCCCHHHHHH
Q 025983           83 SGEFLS-------SSLGRWQNRG---SNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLA  152 (245)
Q Consensus        83 ~~~~l~-------~~l~~~~~~~---~~~e~~l~~~~~~I~~~~~~L~Lp~~v~~~A~~i~~~~~~~~~~~gr~~~~iaA  152 (245)
                      .|..++       .+|++||++.   ++.||+|.+++.+|+++|+.|+||+.++++|..||+++++.++++|++.++++|
T Consensus        90 ~g~~l~~~~~~~~~rl~~~~~~~~~~~~~er~l~~a~~~I~~~~~~L~Lp~~v~e~A~~iyk~~~~~~~~rgrs~~~i~A  169 (310)
T PRK00423         90 YGKSISGKNRAQLYRLRKWQRRIRVSNAAERNLAFALSELDRIASQLGLPRSVREEAAVIYRKAVEKGLIRGRSIEGVVA  169 (310)
T ss_pred             ccccccHHHHHHHHHHHHHhhhcccCChHhHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCcccCCCHHHHHH
Confidence            455554       2478898865   567999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCcCHHHHHHHHhCCCHHHHHHHHHHHHHHhCCccCCccccCCCCHHhHHHHHhhhcCCCHHHHHHHHH
Q 025983          153 ACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQE  232 (245)
Q Consensus       153 A~lY~acR~~~~~~tl~dia~~~~~v~~~~i~~~~~~l~~~l~~~~~~~~~~~~~~p~~~i~r~~~~L~l~~~v~~~A~~  232 (245)
                      ||||+|||+++.|+|++||+++ +++++++|+++|+.|.+.|+++      +|+.+|++||+|||+.|+|++++.+.|.+
T Consensus       170 AclYiACR~~~~prtl~eI~~~-~~v~~k~i~~~~~~l~k~L~~~------~~~~~p~~~i~r~~~~L~L~~~v~~~A~~  242 (310)
T PRK00423        170 AALYAACRRCKVPRTLDEIAEV-SRVSRKEIGRCYRFLLRELNLK------LPPTDPIDYVPRFASELGLSGEVQKKAIE  242 (310)
T ss_pred             HHHHHHHHHcCCCcCHHHHHHH-hCCCHHHHHHHHHHHHHHhCCC------CCCCCHHHHHHHHHHHcCCCHHHHHHHHH
Confidence            9999999999999999999995 8999999999999999999987      78899999999999999999999999999


Q ss_pred             HHHHhhhccc--CCC
Q 025983          233 AVQKSEEFDI--RYS  245 (245)
Q Consensus       233 i~~~~~~~~~--~~~  245 (245)
                      |++.+.+.++  ||+
T Consensus       243 i~~~a~~~~l~~Gr~  257 (310)
T PRK00423        243 ILQKAKEKGLTSGKG  257 (310)
T ss_pred             HHHHHHhcCcccCCC
Confidence            9999999887  553

>KOG1597 consensus Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription] Back     alignment and domain information
>PF00382 TFIIB: Transcription factor TFIIB repeat; InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>KOG1597 consensus Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>cd00043 CYCLIN Cyclin box fold Back     alignment and domain information
>smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>KOG0834 consensus CDK9 kinase-activating protein cyclin T [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00569 ccl1 cyclin ccl1 Back     alignment and domain information
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription] Back     alignment and domain information
>KOG0835 consensus Cyclin L [General function prediction only] Back     alignment and domain information
>COG5333 CCL1 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00134 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>KOG0794 consensus CDK8 kinase-activating protein cyclin C [Transcription] Back     alignment and domain information
>KOG0656 consensus G1/S-specific cyclin D [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01857 RB_B: Retinoblastoma-associated protein B domain; InterPro: IPR002719 Retinoblastoma-like and retinoblastoma-associated proteins may have a function in cell cycle regulation Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>KOG2496 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0835 consensus Cyclin L [General function prediction only] Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF02984 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR004367 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information
>PF00382 TFIIB: Transcription factor TFIIB repeat; InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>KOG0653 consensus Cyclin B and related kinase-activating proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5024 Cyclin [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PLN00209 ribosomal protein S27; Provisional Back     alignment and domain information
>PTZ00083 40S ribosomal protein S27; Provisional Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PRK11827 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>TIGR00244 transcriptional regulator NrdR Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2835 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 Back     alignment and domain information
>PF03966 Trm112p: Trm112p-like protein; InterPro: IPR005651 This family of short proteins have no known function Back     alignment and domain information
>PRK12495 hypothetical protein; Provisional Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>PF08613 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4164 consensus Cyclin ik3-1/CABLES [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>KOG1779 consensus 40s ribosomal protein S27 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] Back     alignment and domain information
>PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>KOG0655 consensus G1/S-specific cyclin E [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4557 consensus Origin recognition complex, subunit 6 [Replication, recombination and repair] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4640 Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG4557 consensus Origin recognition complex, subunit 6 [Replication, recombination and repair] Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>PF05460 ORC6: Origin recognition complex subunit 6 (ORC6); InterPro: IPR008721 The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 [] Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>KOG1010 consensus Rb (Retinoblastoma tumor suppressor)-related protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG Back     alignment and domain information
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>TIGR02443 conserved hypothetical metal-binding protein Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown] Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF01783 Ribosomal_L32p: Ribosomal L32p protein family; InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF15616 TerY-C: TerY-C metal binding domain Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins Back     alignment and domain information
>KOG0794 consensus CDK8 kinase-activating protein cyclin C [Transcription] Back     alignment and domain information
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01031 rpmF_bact ribosomal protein L32 Back     alignment and domain information
>PRK02935 hypothetical protein; Provisional Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00569 ccl1 cyclin ccl1 Back     alignment and domain information
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14952 zf-tcix: Putative treble-clef, zinc-finger, Zn-binding Back     alignment and domain information
>PF09526 DUF2387: Probable metal-binding protein (DUF2387); InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC Back     alignment and domain information
>PF11672 DUF3268: Protein of unknown function (DUF3268); InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150 Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only] Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>KOG1010 consensus Rb (Retinoblastoma tumor suppressor)-related protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription] Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>PF04161 Arv1: Arv1-like family ; InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis Back     alignment and domain information
>TIGR03826 YvyF flagellar operon protein TIGR03826 Back     alignment and domain information
>cd00043 CYCLIN Cyclin box fold Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins Back     alignment and domain information
>PHA02942 putative transposase; Provisional Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>PRK08402 replication factor A; Reviewed Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF14122 YokU: YokU-like protein Back     alignment and domain information
>KOG0834 consensus CDK9 kinase-activating protein cyclin T [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
1c9b_A207 Crystal Structure Of A Human Tbp Core Domain-Human 4e-28
1tfb_A208 Nmr Studies Of Human General Transcription Factor T 2e-27
2phg_A206 Model For Vp16 Binding To Tfiib Length = 206 2e-27
3k7a_M345 Crystal Structure Of An Rna Polymerase Ii-Tfiib Com 2e-26
1vol_A204 Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEME 6e-25
1d3u_B201 Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BBRE+T 1e-10
1ais_B200 Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BTATA- 1e-10
1rly_A60 Rdc-Derived Models Of The Zinc Ribbon Domain Of Hum 1e-06
1dl6_A58 Solution Structure Of Human Tfiib N-Terminal Domain 1e-06
3k1f_M197 Crystal Structure Of Rna Polymerase Ii In Complex W 4e-06
1zp2_A235 Structure Of The Mediator Subunit Cyclin C Length = 2e-04
1pft_A50 N-Terminal Domain Of Tfiib, Nmr Length = 50 4e-04
>pdb|1C9B|A Chain A, Crystal Structure Of A Human Tbp Core Domain-Human Tfiib Core Domain Complex Bound To An Extended, Modified Adenoviral Major Late Promoter (Admlp) Length = 207 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (303), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 89/141 (63%), Gaps = 7/141 (4%)
Query: 102 DRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQ 161
           DR ++ AFK I TM+DR+ L   I DR N ++K+V +QKS +GR  DA+ +ACLYIACRQ
Sbjct: 2   DRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQ 61
Query: 162 EDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLG 221
           E  PRT KEIC+V+   +KKEIGR  + I+K   LET  SV++  I  GDFM RFCSNL 
Sbjct: 62  EGVPRTFKEICAVSR-ISKKEIGRCFKLILK--ALET--SVDL--ITTGDFMSRFCSNLC 114
Query: 222 MNNXXXXXXXXXXXXSEEFDI 242
           +              + E D+
Sbjct: 115 LPKQVQMAATHIARKAVELDL 135
>pdb|1TFB|A Chain A, Nmr Studies Of Human General Transcription Factor Tfiib: Dynamics And Interaction With Vp16 Activation Domain, 20 Structures Length = 208 Back     alignment and structure
>pdb|2PHG|A Chain A, Model For Vp16 Binding To Tfiib Length = 206 Back     alignment and structure
>pdb|3K7A|M Chain M, Crystal Structure Of An Rna Polymerase Ii-Tfiib Complex Length = 345 Back     alignment and structure
>pdb|1VOL|A Chain A, Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEMENT Ternary Complex Length = 204 Back     alignment and structure
>pdb|1D3U|B Chain B, Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BBRE+TATA- Box Complex From Pyrococcus Woesei Length = 201 Back     alignment and structure
>pdb|1AIS|B Chain B, Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BTATA-Box Complex From Pyrococcus Woesei Length = 200 Back     alignment and structure
>pdb|1RLY|A Chain A, Rdc-Derived Models Of The Zinc Ribbon Domain Of Human General Transcription Tfiib (Zinc Bound Structures) Length = 60 Back     alignment and structure
>pdb|1DL6|A Chain A, Solution Structure Of Human Tfiib N-Terminal Domain Length = 58 Back     alignment and structure
>pdb|3K1F|M Chain M, Crystal Structure Of Rna Polymerase Ii In Complex With Tfiib Length = 197 Back     alignment and structure
>pdb|1ZP2|A Chain A, Structure Of The Mediator Subunit Cyclin C Length = 235 Back     alignment and structure
>pdb|1PFT|A Chain A, N-Terminal Domain Of Tfiib, Nmr Length = 50 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 6e-54
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 1e-09
1ais_B200 TFB TFIIB, protein (transcription initiation facto 3e-34
1ais_B200 TFB TFIIB, protein (transcription initiation facto 5e-10
1c9b_A207 General transcription factor IIB; protein-DNA comp 7e-33
1c9b_A207 General transcription factor IIB; protein-DNA comp 1e-08
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 4e-27
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 8e-15
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 4e-14
2cch_B260 Cyclin A2, cyclin-A; complex(transferase/cell divi 2e-05
2f2c_A254 Cyclin homolog, V-cyclin; small molecule inhibitor 3e-05
3g33_B306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 1e-04
1w98_B283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 1e-04
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Length = 345 Back     alignment and structure
 Score =  176 bits (446), Expect = 6e-54
 Identities = 80/247 (32%), Positives = 123/247 (49%), Gaps = 12/247 (4%)

Query: 6   CSDCKKH-TEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANE-SGDNDPVRVGGPT 63
           C +CK +  ++V   S GD VC+ CGLVL    +D  SEWRTF+N+    +DP RVG  +
Sbjct: 24  CPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEAS 83

Query: 64  NPLLADGGLSTVIAKPNGASGEFLSSSLGRWQNRGSNP--DRGLILAFKTIATMSDRLGL 121
           NPLL    LST I K       F +  L + Q +      D  +  AF  I  + D   L
Sbjct: 84  NPLLDGNNLSTRIGKGETTDMRF-TKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAEL 142

Query: 122 VATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATKK 181
              +KD A E YK   D+K+ +G++ ++++AA + I CR+ +  RT KEI S+ +    K
Sbjct: 143 PKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIH-VKTK 201

Query: 182 EIGRAKEYIVKQLGLETG------QSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEAVQ 235
           E G+    +   L  ++        +  M       ++ RFCS+LG+  Q   +A+   +
Sbjct: 202 EFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAK 261

Query: 236 KSEEFDI 242
           K +E   
Sbjct: 262 KCKEIKE 268
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Length = 345 Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Length = 207 Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Length = 207 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Length = 58 Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Length = 50 Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Length = 260 Back     alignment and structure
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Length = 254 Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 306 Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Length = 283 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
4bbr_M345 Transcription initiation factor IIB; RNA polymeras 100.0
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 100.0
1ais_B200 TFB TFIIB, protein (transcription initiation facto 99.97
1c9b_A207 General transcription factor IIB; protein-DNA comp 99.94
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 99.8
1zp2_A235 RNA polymerase II holoenzyme cyclin-like subunit; 99.75
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 99.75
1ais_B200 TFB TFIIB, protein (transcription initiation facto 99.66
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 99.62
2ivx_A257 Cyclin-T2; transcription regulation, cell division 99.6
2i53_A258 Cyclin K; cell cycle, transcription, cyclin BOX, C 99.59
3rgf_B285 Cyclin-C; protein kinase complex, transferase,tran 99.57
2pk2_A 358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 99.51
1c9b_A207 General transcription factor IIB; protein-DNA comp 99.5
1jkw_A 323 Cyclin H; cell cycle, cell division, nuclear prote 99.49
2b9r_A269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 99.49
2cch_B260 Cyclin A2, cyclin-A; complex(transferase/cell divi 99.42
4bbr_M345 Transcription initiation factor IIB; RNA polymeras 99.38
2w96_A271 G1/S-specific cyclin-D1; serine/threonine-protein 99.37
1g3n_C257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 99.28
2f2c_A254 Cyclin homolog, V-cyclin; small molecule inhibitor 99.21
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 99.2
1w98_B283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 99.13
3g33_B306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 99.07
1f5q_B252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 98.73
3h4c_A 260 Transcription factor TFIIB-like; cyclin, transcrip 98.15
1zp2_A235 RNA polymerase II holoenzyme cyclin-like subunit; 98.04
2cch_B260 Cyclin A2, cyclin-A; complex(transferase/cell divi 98.0
2b9r_A269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 97.96
2w96_A271 G1/S-specific cyclin-D1; serine/threonine-protein 97.79
3rgf_B285 Cyclin-C; protein kinase complex, transferase,tran 97.76
2i53_A258 Cyclin K; cell cycle, transcription, cyclin BOX, C 97.75
2ivx_A257 Cyclin-T2; transcription regulation, cell division 97.67
2f2c_A254 Cyclin homolog, V-cyclin; small molecule inhibitor 97.62
1g3n_C257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 97.51
3m03_A95 ORC6, origin recognition complex subunit 6; helix 97.23
2pk2_A358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 97.05
3g33_B306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 97.02
1qxf_A66 GR2, 30S ribosomal protein S27E; structural genomi 96.86
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 96.82
3j20_W63 30S ribosomal protein S27E; archaea, archaeal, KIN 96.78
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 96.73
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 96.72
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 96.69
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 96.56
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 96.51
2xzm_681 RPS27E; ribosome, translation; 3.93A {Tetrahymena 96.49
2r7g_A347 PP110, retinoblastoma-associated protein, P105-RB, 96.47
3u5c_b82 RP61, YS20, 40S ribosomal protein S27-A; translati 96.43
4ell_A411 Retinoblastoma-associated protein; cyclin fold, tu 96.4
1w98_B283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 96.38
3iz6_X86 40S ribosomal protein S27 (S27E); eukaryotic ribos 96.23
4elj_A656 Retinoblastoma-associated protein; cyclin fold, tu 96.04
2qdj_A 304 Retinoblastoma-associated protein; cyclin fold, cy 96.02
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 95.84
1jkw_A323 Cyclin H; cell cycle, cell division, nuclear prote 95.34
2akl_A138 PHNA-like protein PA0128; two domains, Zn binding 95.29
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 94.94
4elj_A 656 Retinoblastoma-associated protein; cyclin fold, tu 94.22
2kpi_A56 Uncharacterized protein SCO3027; zinc finger, PSI- 94.03
1k81_A36 EIF-2-beta, probable translation initiation factor 93.38
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 93.33
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 92.76
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 92.63
1nui_A255 DNA primase/helicase; zinc-biding domain, toprim f 92.49
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 92.42
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 92.31
2k5r_A97 Uncharacterized protein XF2673; solution structure 92.25
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 91.87
1qyp_A57 RNA polymerase II; transcription, RPB9, Zn ribbon, 91.76
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 91.71
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 91.26
2lnb_A80 Z-DNA-binding protein 1; structural genomics, nort 91.21
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 90.97
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 90.96
1f5q_B252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 90.86
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 90.63
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 90.45
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 90.2
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 89.86
2pmi_B293 PHO85 cyclin PHO80, aminoglycoside anti; cyclin-de 89.7
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 89.59
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 89.14
1tfi_A50 Transcriptional elongation factor SII; transcripti 88.18
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 88.18
1dxg_A36 Desulforedoxin; non-heme iron protein, rubredoxin 88.1
3ga8_A78 HTH-type transcriptional regulator MQSA (YGIT/B30; 88.01
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 87.81
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 87.26
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 87.12
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 87.11
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 86.26
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 84.83
3lwf_A159 LIN1550 protein, putative transcriptional regulato 84.75
1s24_A87 Rubredoxin 2; electron transport; NMR {Pseudomonas 84.03
3u50_C172 Telomerase-associated protein 82; TEB1, processivi 83.84
2jt1_A77 PEFI protein; solution structure, winged helix-tur 83.67
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 83.54
3t8r_A143 Staphylococcus aureus CYMR; transcriptional regula 82.24
2k9s_A107 Arabinose operon regulatory protein; activator, ar 82.21
2aus_D60 NOP10, ribosome biogenesis protein NOP10; isomeras 82.2
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 81.94
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 81.92
3lsg_A103 Two-component response regulator YESN; structural 81.89
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 81.84
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 80.59
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 80.21
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
Probab=100.00  E-value=8.6e-60  Score=415.27  Aligned_cols=241  Identities=33%  Similarity=0.551  Sum_probs=173.7

Q ss_pred             CCCCCCCCC-CCceeeeCCCCceEccCCcccccccccccCcccccccCCC-CCCCCCcccCCCCccccCCCceeEEecCC
Q 025983            3 DAFCSDCKK-HTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANES-GDNDPVRVGGPTNPLLADGGLSTVIAKPN   80 (245)
Q Consensus         3 ~~~Cp~Cg~-~~~iv~d~~~G~~vC~~CG~V~~e~~id~~~ewr~f~~~~-~~~~~~r~G~~~~~~~~~~~l~t~i~~~~   80 (245)
                      ...||+||+ ++++++|+.+|++||.+||+||+|++||+|||||+|++++ ++.|++|+|+|.++++||+||+|.|+++.
T Consensus        21 ~~~Cp~C~~~~~~lv~D~~~G~~vC~~CGlVl~e~~iD~g~EWR~f~~d~~~~~d~sRvG~~~~~~~~~~glsT~I~~~~  100 (345)
T 4bbr_M           21 VLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE  100 (345)
T ss_dssp             -CCCSSCCCSSCCEEEEGGGTEEEETTTCBEEESCCBCHHHHHTTTSCSCSSSCCSSCCEEEECHHHHCSCCCCEEECCS
T ss_pred             CCcCCCCCCCCCceeEECCCCcEEeCCCCCCccCcccccCccccCCCcccccCCCcCCCCCCCCccccCCCcceeecCCC
Confidence            457999996 4689999999999999999999999999999999999654 47899999999999999999999999765


Q ss_pred             CCCccccchhhhhcccCC--CCCchhHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhCCCCCCCCHHHHHHHHHHHH
Q 025983           81 GASGEFLSSSLGRWQNRG--SNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIA  158 (245)
Q Consensus        81 ~~~~~~l~~~l~~~~~~~--~~~e~~l~~~~~~I~~~~~~L~Lp~~v~~~A~~i~~~~~~~~~~~gr~~~~iaAA~lY~a  158 (245)
                      ++.+ ...++|++||++.  +++|++|.+|+..|.++|.+|+||+.+.++|..||+++++.++++||+.+.++|||||+|
T Consensus       101 ~~~~-~~~~~L~r~q~r~~~~~~er~L~~a~~~I~~~~~~L~Lp~~v~d~A~~lyk~a~~~~~~rGrs~e~vaAAclYiA  179 (345)
T 4bbr_M          101 TTDM-RFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIG  179 (345)
T ss_dssp             SCCH-HHHHHHHHHHHHTCCCCSSSSTTHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHTTCTTTTTCCHHHHHHHHHHHH
T ss_pred             Ccch-hhHHHHHHHHHhhhcChHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCCccCCCHHHHHHHHHHHH
Confidence            4331 1235688888764  789999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhCCCCcCHHHHHHHHhCCCHHHHHHHHHHHHHHhCCccCCcc------ccCCCCHHhHHHHHhhhcCCCHHHHHHHHH
Q 025983          159 CRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSV------EMGTIHAGDFMRRFCSNLGMNNQAVKAAQE  232 (245)
Q Consensus       159 cR~~~~~~tl~dia~~~~~v~~~~i~~~~~~l~~~l~~~~~~~~------~~~~~~p~~~i~r~~~~L~l~~~v~~~A~~  232 (245)
                      ||+++.|+||+||+++ +++++++|+++|+.|.+.|++...+++      .+|+++|++||+|||++|+|++++.+.|.+
T Consensus       180 CR~~~~prtl~eI~~~-~~v~~keigr~~k~l~~~L~l~~~~~~~~~~~~~~~~~~p~~~i~Rf~s~L~l~~~v~~~A~~  258 (345)
T 4bbr_M          180 CRRAEVARTFKEIQSL-IHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEY  258 (345)
T ss_dssp             HHHTCCBCCHHHHHHH-HTCCTTHHHHHHHHHHHCC--------------------------------------------
T ss_pred             HHhcCCCccHHHHHHH-hCCCHHHHHHHHHHHHHHhCccccccccccccccCCCCCHHHHHHHHHHHcCCcHHHHHHHHH
Confidence            9999999999999995 899999999999999999997532211      268889999999999999999999999999


Q ss_pred             HHHHhhhccc--CCC
Q 025983          233 AVQKSEEFDI--RYS  245 (245)
Q Consensus       233 i~~~~~~~~~--~~~  245 (245)
                      |++.+++.|+  ||+
T Consensus       259 i~~~~~~~~i~~GR~  273 (345)
T 4bbr_M          259 TAKKCKEIKEIAGKS  273 (345)
T ss_dssp             ---------------
T ss_pred             HHHHHHhcccccCCC
Confidence            9999999987  553
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Back     alignment and structure
>1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Back     alignment and structure
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3h4c_A Transcription factor TFIIB-like; cyclin, transcription factor TFIIB repeat; 2.30A {Trypanosoma brucei brucei} Back     alignment and structure
>1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Back     alignment and structure
>3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Back     alignment and structure
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3m03_A ORC6, origin recognition complex subunit 6; helix turn helix, DNA binding protein, origin recognition CO DNA replication; HET: MES; 2.50A {Homo sapiens} Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 Back     alignment and structure
>2r7g_A PP110, retinoblastoma-associated protein, P105-RB, RB; retinoblastoma protein, E2F displacement, transcription repressor; 1.67A {Homo sapiens} SCOP: a.74.1.3 a.74.1.3 PDB: 1n4m_A 3pom_A 1gh6_B 1gux_A 1o9k_A 1ad6_A 1gux_B 1o9k_B Back     alignment and structure
>3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b Back     alignment and structure
>4ell_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor, cell cycle; 1.98A {Homo sapiens} Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4elj_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor protein, phosphorylation, cell; HET: TPO; 2.70A {Homo sapiens} Back     alignment and structure
>2qdj_A Retinoblastoma-associated protein; cyclin fold, cyclin wedge, antitumor protein; 2.00A {Homo sapiens} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A Back     alignment and structure
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>4elj_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor protein, phosphorylation, cell; HET: TPO; 2.70A {Homo sapiens} Back     alignment and structure
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>2pmi_B PHO85 cyclin PHO80, aminoglycoside anti; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_B* Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>1dxg_A Desulforedoxin; non-heme iron protein, rubredoxin type metal center, electron transport; 1.80A {Desulfovibrio gigas} SCOP: g.41.5.2 PDB: 1dcd_A 1dhg_A 1cfw_A 2lk5_A 2lk6_A Back     alignment and structure
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A Back     alignment and structure
>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} Back     alignment and structure
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B 3mqk_B Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure
>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 245
d1aisb198 a.74.1.2 (B:1108-1205) Transcription factor IIB (T 1e-24
d1vola195 a.74.1.2 (A:113-207) Transcription factor IIB (TFI 6e-23
d1vola2109 a.74.1.2 (A:208-316) Transcription factor IIB (TFI 8e-20
d1vola2109 a.74.1.2 (A:208-316) Transcription factor IIB (TFI 3e-07
d1aisb295 a.74.1.2 (B:1206-1300) Transcription factor IIB (T 1e-19
d1aisb295 a.74.1.2 (B:1206-1300) Transcription factor IIB (T 2e-04
d1dl6a_58 g.41.3.1 (A:) Transcription initiation factor TFII 6e-15
d1pfta_50 g.41.3.1 (A:) Transcription initiation factor TFII 1e-13
d2i53a1144 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) 3e-04
d2ivxa1143 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) 4e-04
d1g3nc1132 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma 0.001
d1jkwa1151 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo s 0.001
d1w98b2140 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human 0.003
d2r7ga2142 a.74.1.3 (A:644-785) Retinoblastoma tumor suppress 0.004
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Cyclin-like
superfamily: Cyclin-like
family: Transcription factor IIB (TFIIB), core domain
domain: Transcription factor IIB (TFIIB), core domain
species: Archaeon Pyrococcus woesei [TaxId: 2262]

 Score = 91.5 bits (227), Expect = 1e-24
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 1/96 (1%)

Query: 105 LILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDK 164
           L  A   +  ++ +L L   +++ A  +Y++   +   RGR+ ++++AAC+Y ACR    
Sbjct: 2   LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKV 61

Query: 165 PRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQ 200
           PRT+ EI  +A    KKEIGR+  +I + L L   +
Sbjct: 62  PRTLDEIADIAR-VDKKEIGRSYRFIARNLNLTPKK 96
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 95 Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 95 Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 50 Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Length = 132 Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d2r7ga2 a.74.1.3 (A:644-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d1aisb198 Transcription factor IIB (TFIIB), core domain {Arc 99.91
d1vola195 Transcription factor IIB (TFIIB), core domain {Hum 99.9
d1aisb295 Transcription factor IIB (TFIIB), core domain {Arc 99.88
d1vola2109 Transcription factor IIB (TFIIB), core domain {Hum 99.86
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 99.81
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 99.8
d2i53a1144 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 98.75
d2ivxa1143 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1jkwa1151 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 98.52
d1aisb295 Transcription factor IIB (TFIIB), core domain {Arc 97.98
d1vola2109 Transcription factor IIB (TFIIB), core domain {Hum 97.96
d2cchb1128 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 97.85
d1bu2a1127 Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} 97.82
d1g3nc1132 Viral cyclin {Kaposi's sarcoma-associated herpesvi 97.79
d1f5qb1141 Viral cyclin {Murine herpesvirus 68 [TaxId: 33708] 97.74
d1w98b2140 G1/S-specific cyclin-E1 {Human (Homo sapiens) [Tax 97.63
d2ivxa2113 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 97.24
d2r7ga2142 Retinoblastoma tumor suppressor domains {Human (Ho 97.0
d1qxfa_58 Ribosomal protein S27e {Archaeon Archaeoglobus ful 96.94
d2i53a2110 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 96.47
d2jnya159 Uncharacterized protein Cgl1405/cg1592 {Corynebact 96.15
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 96.04
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 95.94
d2pk7a159 Uncharacterized protein PFL1779 {Pseudomonas fluor 95.88
d2hf1a159 Hypothetical protein CV3345 {Chromobacterium viola 95.66
d1vola195 Transcription factor IIB (TFIIB), core domain {Hum 95.43
d1aisb198 Transcription factor IIB (TFIIB), core domain {Arc 94.6
d1neea237 Zinc-binding domain of translation initiation fact 94.38
d2cchb2124 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 93.91
d1k81a_36 Zinc-binding domain of translation initiation fact 93.77
d1nuia254 Zinc-binding domain of primase-helicase {Bacteriop 93.73
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 91.96
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 91.75
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 91.65
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 91.42
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 90.76
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 90.6
d1u5ka2157 Recombinational repair protein RecO, C-terminal do 90.57
d1jkwa2126 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 90.41
d1rqga335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro 89.71
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 89.54
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 89.16
d1twfi272 RBP9 subunit of RNA polymerase II {Baker's yeast ( 89.15
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 89.08
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 88.94
d2j9ub147 Vacuolar protein-sorting-associated protein 36, VP 88.79
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 88.74
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 88.29
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 87.65
d2j015159 Ribosomal protein L32p {Thermus thermophilus [TaxI 87.39
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 87.02
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 86.97
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 86.94
d1qypa_57 RBP9 subunit of RNA polymerase II {Archaeon Thermo 86.68
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 86.6
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 86.55
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 86.16
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 85.17
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 84.95
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 84.95
d1i5za169 Catabolite gene activator protein (CAP), C-termina 84.4
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 82.85
d1yioa170 Response regulatory protein StyR, C-terminal domai 81.19
d1l1oc_178 Replication protein A 70 KDa subunit (RPA70) {Huma 81.19
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherich 81.11
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 80.72
d2apob155 Ribosome biogenesis protein Nop10 {Archaeon Methan 80.69
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 80.66
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 80.16
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 80.07
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
class: All alpha proteins
fold: Cyclin-like
superfamily: Cyclin-like
family: Transcription factor IIB (TFIIB), core domain
domain: Transcription factor IIB (TFIIB), core domain
species: Archaeon Pyrococcus woesei [TaxId: 2262]

Probab=99.91  E-value=5.7e-24  Score=152.81  Aligned_cols=93  Identities=32%  Similarity=0.628  Sum_probs=89.9

Q ss_pred             hHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhCCCCCCCCHHHHHHHHHHHHHHhCCCCcCHHHHHHHHhCCCHHHH
Q 025983          104 GLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATKKEI  183 (245)
Q Consensus       104 ~l~~~~~~I~~~~~~L~Lp~~v~~~A~~i~~~~~~~~~~~gr~~~~iaAA~lY~acR~~~~~~tl~dia~~~~~v~~~~i  183 (245)
                      +|..|+..|+++|+.|+||+.+.++|..||+++.+.++.+|+++.+++|||||+|||+++.|+|++||+++ +++++++|
T Consensus         1 nL~~a~~~I~~~~~~L~L~~~i~~~A~~i~k~~~~~~~~~g~~~~~iaaA~iY~Acr~~~~~~t~~eIa~~-~~is~~ti   79 (98)
T d1aisb1           1 NLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADI-ARVDKKEI   79 (98)
T ss_dssp             CHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHTTTTTTTCCHHHHHHHHHHHHHHHHTCCCCHHHHHHH-TTSCHHHH
T ss_pred             CHHHHHHHHHHHHHHcCcCHHHHHHHHHHHHHHHHhhhhcCCCHHHHHHHHHHHHHHHcCCCCCHHHHHHH-HCCCHHHH
Confidence            46789999999999999999999999999999999999999999999999999999999999999999995 99999999


Q ss_pred             HHHHHHHHHHhCCc
Q 025983          184 GRAKEYIVKQLGLE  197 (245)
Q Consensus       184 ~~~~~~l~~~l~~~  197 (245)
                      +++|+.|.+.|+++
T Consensus        80 ~k~yk~i~~~L~l~   93 (98)
T d1aisb1          80 GRSYRFIARNLNLT   93 (98)
T ss_dssp             HHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHHcCCC
Confidence            99999999999985
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Back     information, alignment and structure
>d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r7ga2 a.74.1.3 (A:644-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2cchb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nuia2 g.41.3.2 (A:10-63) Zinc-binding domain of primase-helicase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1jkwa2 a.74.1.1 (A:162-287) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j9ub1 g.41.11.1 (B:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1qypa_ g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1l1oc_ b.40.4.3 (C:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2apob1 g.41.16.1 (B:403-457) Ribosome biogenesis protein Nop10 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure