Citrus Sinensis ID: 026988

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MSIGKEQAETTSHPEKLELEHGLQLEFKPVPVTNNIIPQAEGSSSSCPVNDDVTGVDEKKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIARKSHKFSCDEQAEAQDEK
ccccHHHHHHcccccEEEEEcccEEEEEcccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHccccccccccccEEEEcccccHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccccccc
cccHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccccccccccccccHHHHHHccccccEEEEEcccccccHHHHHHHHHHccccccccccccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccHHccHHcccc
msigkeqaettshpeklelehglqlefkpvpvtnniipqaegsssscpvnddvtgvdeKKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAgknhqiqnlhhgsnlethnsphydlilmdcqmgsmdgckATRVIRRLEAeaetgqsipiIAFTALvtadnerecfnsgmdtflnkPAQEHLLAAAIVETIARKshkfscdeqaeaqdek
msigkeqaettshpekleLEHGLQLEFKPVPVTNNIIPqaegsssscpvnDDVTGVDEKKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEaeaetgqsipiiAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIARKSHKFSCDEQAEAQDEK
MSIGKEQAETTSHPEKLELEHGLQLEFKPVPVTNNIIPQAEGSSSSCPVNDDVTGVDEKKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIARKSHKFSCDEQAEAQDEK
****************************************************VTGVDEKKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIAR*****************
MSIGKEQAETTSHPEKLELEHGLQLEFKPVPVTNN******************************SVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIV**********************
***************KLELEHGLQLEFKPVPVTNNIIPQAEGSSSSCPVNDDVTGVDEKKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIARKS***************
MSI*KEQAETTSHPEKLELEHGLQLEFKPVPVTNNIIPQ*********************VLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINA*******************NSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIAR*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIGKEQAETTSHPEKLELEHGLQLEFKPVPVTNNIIPQAEGSSSSCPVNDDVTGVDEKKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIARKSHKFSCDEQAEAQDEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
Q9SXL41207 Histidine kinase 1 OS=Ara yes no 0.643 0.122 0.436 1e-25
Q9C5U01080 Histidine kinase 4 OS=Ara no no 0.556 0.118 0.310 4e-13
Q9P4U61065 Two-component system prot yes no 0.504 0.108 0.335 5e-13
Q54YZ9 2062 Hybrid signal transductio yes no 0.582 0.064 0.337 2e-12
P48027 907 Sensor protein GacS OS=Ps N/A no 0.513 0.130 0.333 7e-12
Q9C5U21176 Histidine kinase 2 OS=Ara no no 0.504 0.098 0.310 9e-12
Q3S4A7922 Histidine kinase 5 OS=Ara no no 0.465 0.116 0.331 1e-11
Q86CZ21213 Hybrid signal transductio no no 0.660 0.125 0.284 2e-11
P399281220 Osmosensing histidine pro yes no 0.639 0.120 0.297 8e-11
Q54SK52388 Hybrid signal transductio no no 0.547 0.052 0.3 2e-10
>sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 Back     alignment and function desciption
 Score =  116 bits (291), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 94/158 (59%), Gaps = 10/158 (6%)

Query: 59   KKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLM-INAAG----- 112
            +K LEG+ +LL ED  VLQR+   ML+K+GA VT V DG+ AV+++    INA       
Sbjct: 1038 QKSLEGIRILLAEDTPVLQRVATIMLEKMGATVTAVWDGQQAVDSLNYKSINAQAPTEEH 1097

Query: 113  KNHQIQNLHHGSNLET--HNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPI 170
            K+ + +  +  +  ET   NS  YDLILMDCQM  MDG +AT+ IRR  AE  T   IPI
Sbjct: 1098 KSFEEETANKVTTRETSLRNSSPYDLILMDCQMPKMDGYEATKAIRR--AEIGTELHIPI 1155

Query: 171  IAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIV 208
            +A TA   + +E +C   GMD +L KP    L+ + I+
Sbjct: 1156 VALTAHAMSSDEAKCLEVGMDAYLTKPIDRKLMVSTIL 1193
Functions as an osmosensor histidine kinase that detects water stress and transmits the stress signal to a downstream MAPK cascade. This protein undergoes an ATP-dependent autophosphorylation at a conserved histidine residue in the kinase core, and a phosphoryl group is then transferred to a conserved aspartate residue in the receiver domain. Positive regulator of drought and salt stress responses, and abscisic acid (ABA) signaling. Confers drought tolerance, probably by regulating levels of ABA accumulation. Plays a redundant role in regulating plant growth and development. Required for the regulation of desiccation processes during seed formation.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 3EC: .EC: 3
>sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 Back     alignment and function description
>sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 Back     alignment and function description
>sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 Back     alignment and function description
>sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 Back     alignment and function description
>sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 Back     alignment and function description
>sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=2 SV=1 Back     alignment and function description
>sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 Back     alignment and function description
>sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 Back     alignment and function description
>sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
255577536 1206 histidine kinase 1 plant, putative [Rici 0.726 0.138 0.417 1e-26
224133676 1258 histidine kinase osmosensor protein [Pop 0.682 0.124 0.409 6e-25
449495060 1222 PREDICTED: histidine kinase 1-like [Cucu 0.673 0.126 0.401 1e-24
449456825 1221 PREDICTED: histidine kinase 1-like [Cucu 0.673 0.126 0.401 1e-24
357483831 1218 Histidine kinase osmosensor protein [Med 0.647 0.122 0.420 4e-24
225431092 1235 PREDICTED: histidine kinase 1-like [Viti 0.726 0.135 0.405 4e-24
297734988 1168 unnamed protein product [Vitis vinifera] 0.726 0.142 0.405 4e-24
18398532 1207 histidine kinase 1 [Arabidopsis thaliana 0.643 0.122 0.436 6e-24
4586626 1207 histidine kinase 1 [Arabidopsis thaliana 0.643 0.122 0.436 1e-23
60545052 1205 cold inducible histidine kinase 1 [Catha 0.639 0.121 0.413 2e-23
>gi|255577536|ref|XP_002529646.1| histidine kinase 1 plant, putative [Ricinus communis] gi|223530872|gb|EEF32733.1| histidine kinase 1 plant, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 104/175 (59%), Gaps = 8/175 (4%)

Query: 41   EGSSSSCPVNDDVTGVDEKKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAA 100
            +G +SSC +N     V E+K LEGL +LL ED  VLQR+   ML+K+GA V  V DG  A
Sbjct: 1036 KGQTSSC-LNK---SVKEQKALEGLRILLAEDTPVLQRVATIMLEKMGATVIAVGDGLQA 1091

Query: 101  VEAMTLMINA--AGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRL 158
            V+A+   ++   + +    Q+ ++ S  E  + P YDLILMDCQM  MDG +AT+ IR+ 
Sbjct: 1092 VDALNCRLSGRESRRESVFQDENNTSQTEMLDPPPYDLILMDCQMPKMDGYEATKAIRK- 1150

Query: 159  EAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIAR 213
             +EA +G  IPI+A TA   + +E +C   GMD +L KP    L+ + I+    R
Sbjct: 1151 -SEAGSGLHIPIVALTAHAMSSDEAKCLEVGMDAYLTKPIDYKLMVSTILSLTKR 1204

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224133676|ref|XP_002327653.1| histidine kinase osmosensor protein [Populus trichocarpa] gi|222836738|gb|EEE75131.1| histidine kinase osmosensor protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449495060|ref|XP_004159723.1| PREDICTED: histidine kinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449456825|ref|XP_004146149.1| PREDICTED: histidine kinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357483831|ref|XP_003612202.1| Histidine kinase osmosensor protein [Medicago truncatula] gi|355513537|gb|AES95160.1| Histidine kinase osmosensor protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225431092|ref|XP_002265248.1| PREDICTED: histidine kinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734988|emb|CBI17350.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|18398532|ref|NP_565424.1| histidine kinase 1 [Arabidopsis thaliana] gi|332278154|sp|Q9SXL4.2|AHK1_ARATH RecName: Full=Histidine kinase 1; AltName: Full=Arabidopsis histidine kinase 1; Short=AtHK1; AltName: Full=Protein AUTHENTIC HIS-KINASE 1 gi|330251597|gb|AEC06691.1| histidine kinase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4586626|dbj|BAA32085.1| histidine kinase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|60545052|gb|AAQ10680.2| cold inducible histidine kinase 1 [Catharanthus roseus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
TAIR|locus:28278361207 HK1 "histidine kinase 1" [Arab 0.643 0.122 0.436 1.1e-23
TIGR_CMR|CBU_0760124 CBU_0760 "response regulator p 0.186 0.346 0.441 1.7e-11
CGD|CAL00033441373 SLN1 [Candida albicans (taxid: 0.347 0.058 0.388 4.8e-11
UNIPROTKB|Q5A8721373 SLN1 "Potential response regul 0.347 0.058 0.388 4.8e-11
TAIR|locus:20597181080 WOL "WOODEN LEG" [Arabidopsis 0.343 0.073 0.392 1.2e-10
TIGR_CMR|GSU_0718589 GSU_0718 "sensory box histidin 0.521 0.203 0.328 1.6e-10
TAIR|locus:20619711122 CKI1 "CYTOKININ-INDEPENDENT 1" 0.621 0.127 0.325 2e-10
TAIR|locus:2159669922 HK5 "histidine kinase 5" [Arab 0.760 0.189 0.267 5.3e-10
TIGR_CMR|GSU_2314 1025 GSU_2314 "sensory box histidin 0.391 0.087 0.391 6.7e-10
DICTYBASE|DDB_G02778871213 dhkK "histidine kinase K" [Dic 0.386 0.073 0.358 9.7e-10
TAIR|locus:2827836 HK1 "histidine kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 1.1e-23, P = 1.1e-23
 Identities = 69/158 (43%), Positives = 94/158 (59%)

Query:    59 KKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLM-INAAG----- 112
             +K LEG+ +LL ED  VLQR+   ML+K+GA VT V DG+ AV+++    INA       
Sbjct:  1038 QKSLEGIRILLAEDTPVLQRVATIMLEKMGATVTAVWDGQQAVDSLNYKSINAQAPTEEH 1097

Query:   113 KNHQIQNLHHGSNLET--HNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPI 170
             K+ + +  +  +  ET   NS  YDLILMDCQM  MDG +AT+ IRR  AE  T   IPI
Sbjct:  1098 KSFEEETANKVTTRETSLRNSSPYDLILMDCQMPKMDGYEATKAIRR--AEIGTELHIPI 1155

Query:   171 IAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIV 208
             +A TA   + +E +C   GMD +L KP    L+ + I+
Sbjct:  1156 VALTAHAMSSDEAKCLEVGMDAYLTKPIDRKLMVSTIL 1193
GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0000156 "phosphorelay response regulator activity" evidence=IEA
GO:0004673 "protein histidine kinase activity" evidence=IEA;ISS
GO:0004871 "signal transducer activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0016020 "membrane" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005034 "osmosensor activity" evidence=IGI;IMP
GO:0006970 "response to osmotic stress" evidence=IMP
GO:0009927 "histidine phosphotransfer kinase activity" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0009414 "response to water deprivation" evidence=IEP;IMP
GO:0010431 "seed maturation" evidence=IMP
GO:0010375 "stomatal complex patterning" evidence=IMP
TIGR_CMR|CBU_0760 CBU_0760 "response regulator protein, putative" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
CGD|CAL0003344 SLN1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A872 SLN1 "Potential response regulator protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
TAIR|locus:2059718 WOL "WOODEN LEG" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0718 GSU_0718 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2061971 CKI1 "CYTOKININ-INDEPENDENT 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159669 HK5 "histidine kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2314 GSU_2314 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277887 dhkK "histidine kinase K" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00570069
histidine kinase osmosensor protein (1259 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal tra 5e-19
cd00156113 cd00156, REC, Signal receiver domain; originally t 5e-18
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinas 1e-16
pfam00072111 pfam00072, Response_reg, Response regulator receiv 2e-15
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor 1e-12
PRK15347921 PRK15347, PRK15347, two component system sensor ki 4e-12
COG0745229 COG0745, OmpR, Response regulators consisting of a 3e-11
PRK11091 779 PRK11091, PRK11091, aerobic respiration control se 4e-11
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-c 3e-09
COG2197211 COG2197, CitB, Response regulator containing a Che 5e-07
COG3437 360 COG3437, COG3437, Response regulator containing a 3e-06
smart0044855 smart00448, REC, cheY-homologous receiver domain 4e-06
TIGR02154226 TIGR02154, PhoB, phosphate regulon transcriptional 4e-06
PRK09959 1197 PRK09959, PRK09959, hybrid sensory histidine kinas 4e-06
PRK09581 457 PRK09581, pleD, response regulator PleD; Reviewed 7e-06
PRK15479221 PRK15479, PRK15479, transcriptional regulatory pro 1e-04
PRK10161229 PRK10161, PRK10161, transcriptional regulator PhoB 2e-04
TIGR01387218 TIGR01387, cztR_silR_copR, heavy metal response re 3e-04
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regula 0.001
PRK09836227 PRK09836, PRK09836, DNA-binding transcriptional ac 0.001
PRK10643222 PRK10643, PRK10643, DNA-binding transcriptional re 0.003
>gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information 
 Score = 79.5 bits (196), Expect = 5e-19
 Identities = 49/156 (31%), Positives = 69/156 (44%), Gaps = 30/156 (19%)

Query: 62  LEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLH 121
           L GL VL+V+D+ V +R+  R+L+ LG  V    DGE   EA+ L+              
Sbjct: 3   LSGLRVLVVDDEPVNRRLLKRLLEDLGYEVVEAADGE--EEALELL-------------- 46

Query: 122 HGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADN 181
                     P  DLIL+D  M  MDG +  R +R        G +IP+I  TA     +
Sbjct: 47  -------RELPQPDLILLDINMPGMDGIELLRRLRAR------GPNIPVILLTAYADEAD 93

Query: 182 ERECFNSGMDTFLNKPA-QEHLLAAAIVETIARKSH 216
                 +G D +L KP   E  L AA+   +AR + 
Sbjct: 94  RERALAAGADDYLTKPIFLEEELLAALRRLLARAAA 129

Length = 130
>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|182277 PRK10161, PRK10161, transcriptional regulator PhoB; Provisional Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
COG0745229 OmpR Response regulators consisting of a CheY-like 99.92
PRK11091 779 aerobic respiration control sensor protein ArcB; P 99.89
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 99.89
PRK10841924 hybrid sensory kinase in two-component regulatory 99.89
PRK15347921 two component system sensor kinase SsrA; Provision 99.88
TIGR02956 968 TMAO_torS TMAO reductase sytem sensor TorS. This p 99.88
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 99.87
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.86
PF00072112 Response_reg: Response regulator receiver domain; 99.84
COG4566202 TtrR Response regulator [Signal transduction mecha 99.84
COG2204 464 AtoC Response regulator containing CheY-like recei 99.84
COG4753 475 Response regulator containing CheY-like receiver d 99.83
COG3437 360 Response regulator containing a CheY-like receiver 99.82
KOG0519786 consensus Sensory transduction histidine kinase [S 99.82
COG4565224 CitB Response regulator of citrate/malate metaboli 99.81
PRK13837828 two-component VirA-like sensor kinase; Provisional 99.81
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 99.79
COG3706 435 PleD Response regulator containing a CheY-like rec 99.79
COG2197211 CitB Response regulator containing a CheY-like rec 99.78
PRK13557540 histidine kinase; Provisional 99.77
PRK10046225 dpiA two-component response regulator DpiA; Provis 99.76
PLN03029222 type-a response regulator protein; Provisional 99.75
PRK10816223 DNA-binding transcriptional regulator PhoP; Provis 99.74
PRK11173237 two-component response regulator; Provisional 99.74
PRK09836227 DNA-binding transcriptional activator CusR; Provis 99.74
PRK10529225 DNA-binding transcriptional activator KdpE; Provis 99.73
PRK10643222 DNA-binding transcriptional regulator BasR; Provis 99.73
PRK09468239 ompR osmolarity response regulator; Provisional 99.72
PRK10766221 DNA-binding transcriptional regulator TorR; Provis 99.71
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 99.71
PRK10161229 transcriptional regulator PhoB; Provisional 99.71
PRK11083228 DNA-binding response regulator CreB; Provisional 99.7
PRK10840216 transcriptional regulator RcsB; Provisional 99.7
COG3947 361 Response regulator containing CheY-like receiver a 99.7
PRK10701 240 DNA-binding transcriptional regulator RstA; Provis 99.7
PRK13856 241 two-component response regulator VirG; Provisional 99.7
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 99.7
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 99.69
PRK11517223 transcriptional regulatory protein YedW; Provision 99.69
PRK10955232 DNA-binding transcriptional regulator CpxR; Provis 99.69
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 99.69
COG4567182 Response regulator consisting of a CheY-like recei 99.68
CHL00148240 orf27 Ycf27; Reviewed 99.68
TIGR01387218 cztR_silR_copR heavy metal response regulator. Mem 99.67
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 99.67
TIGR02875 262 spore_0_A sporulation transcription factor Spo0A. 99.67
PRK15115 444 response regulator GlrR; Provisional 99.65
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 99.65
PRK09483217 response regulator; Provisional 99.65
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 99.65
PRK10365 441 transcriptional regulatory protein ZraR; Provision 99.64
PRK14084 246 two-component response regulator; Provisional 99.64
PRK09935210 transcriptional regulator FimZ; Provisional 99.64
PRK09581 457 pleD response regulator PleD; Reviewed 99.63
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 99.61
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 99.61
PRK15479221 transcriptional regulatory protein TctD; Provision 99.61
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 99.61
PRK09390202 fixJ response regulator FixJ; Provisional 99.61
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 99.6
PRK11697 238 putative two-component response-regulatory protein 99.6
PRK12555 337 chemotaxis-specific methylesterase; Provisional 99.58
PRK13435145 response regulator; Provisional 99.56
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 99.56
PRK13558 665 bacterio-opsin activator; Provisional 99.55
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.55
PRK09581 457 pleD response regulator PleD; Reviewed 99.55
PRK00742 354 chemotaxis-specific methylesterase; Provisional 99.54
PRK15369211 two component system sensor kinase SsrB; Provision 99.54
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 99.52
COG3707194 AmiR Response regulator with putative antiterminat 99.51
PRK10651216 transcriptional regulator NarL; Provisional 99.51
PRK10403215 transcriptional regulator NarP; Provisional 99.51
PRK15411207 rcsA colanic acid capsular biosynthesis activation 99.5
COG2201 350 CheB Chemotaxis response regulator containing a Ch 99.48
PRK09191261 two-component response regulator; Provisional 99.45
cd00156113 REC Signal receiver domain; originally thought to 99.37
PRK10693 303 response regulator of RpoS; Provisional 99.34
PRK15029 755 arginine decarboxylase; Provisional 99.3
PRK10618894 phosphotransfer intermediate protein in two-compon 99.16
COG3279 244 LytT Response regulator of the LytR/AlgR family [T 99.11
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 98.72
COG3706 435 PleD Response regulator containing a CheY-like rec 98.36
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 98.05
smart0044855 REC cheY-homologous receiver domain. CheY regulate 97.88
PRK02261137 methylaspartate mutase subunit S; Provisional 97.56
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 97.46
PF03709115 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal 97.45
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 97.1
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 96.47
COG4999140 Uncharacterized domain of BarA-like signal transdu 96.26
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 96.21
PRK15399 713 lysine decarboxylase LdcC; Provisional 96.04
PRK15400 714 lysine decarboxylase CadA; Provisional 95.77
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 95.15
TIGR03815 322 CpaE_hom_Actino helicase/secretion neighborhood Cp 94.36
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 94.17
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 93.97
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 93.89
PRK09426714 methylmalonyl-CoA mutase; Reviewed 93.5
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 93.07
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 92.96
PRK00208250 thiG thiazole synthase; Reviewed 92.94
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 90.76
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 90.57
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 90.09
PF1008797 DUF2325: Uncharacterized protein conserved in bact 90.01
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 89.42
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 88.72
PRK10558 256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 88.1
PRK10128 267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 87.85
cd02068127 radical_SAM_B12_BD B12 binding domain_like associa 87.38
TIGR02311 249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 86.73
COG0643716 CheA Chemotaxis protein histidine kinase and relat 85.94
TIGR03239 249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 85.87
PRK10547670 chemotaxis protein CheA; Provisional 85.31
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 84.86
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 84.73
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 84.72
cd02065125 B12-binding_like B12 binding domain (B12-BD). Most 83.73
PRK14974336 cell division protein FtsY; Provisional 83.62
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 83.53
PRK13566720 anthranilate synthase; Provisional 83.31
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 83.25
TIGR02026 497 BchE magnesium-protoporphyrin IX monomethyl ester 82.85
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 82.77
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 82.59
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 82.35
PF07688 283 KaiA: KaiA domain; InterPro: IPR011648 KaiA is a c 82.21
cd03820348 GT1_amsD_like This family is most closely related 82.13
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 81.85
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 81.73
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 81.71
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 81.57
PRK06774191 para-aminobenzoate synthase component II; Provisio 81.38
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 80.07
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information 
Probab=99.92  E-value=7.9e-24  Score=176.66  Aligned_cols=121  Identities=31%  Similarity=0.450  Sum_probs=113.1

Q ss_pred             cEEEEEeccHHHHHHHHHHHHhcCCeEEEEcCcHHHHHHHHHHHHhcccccchhccccCCcccccCCCCccEEEEecCCC
Q 026988           65 LSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMG  144 (230)
Q Consensus        65 ~~iLiVdd~~~~~~~l~~~L~~~g~~v~~~~~~~~al~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dlvl~D~~mp  144 (230)
                      ++||+|||++..+..+...|+..||.|..+.++.+|++.+.                         .. ||+||+|++||
T Consensus         1 ~~ILiveDd~~i~~~l~~~L~~~g~~v~~~~~~~~a~~~~~-------------------------~~-~dlviLD~~lP   54 (229)
T COG0745           1 MRILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAR-------------------------EQ-PDLVLLDLMLP   54 (229)
T ss_pred             CeEEEEcCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHh-------------------------cC-CCEEEEECCCC
Confidence            48999999999999999999999999999999999999987                         56 99999999999


Q ss_pred             CCCHHHHHHHHHHhhhhhhcCCCceEEEEecCCChHhHHHHHHcCCCeeEeCCCCHHHHHHHHHHHHHhccC
Q 026988          145 SMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIARKSH  216 (230)
Q Consensus       145 ~~dg~~l~~~lr~~~~~~~~~~~~pii~ls~~~~~~~~~~~~~~G~~~~L~KP~~~~~L~~~l~~~l~~~~~  216 (230)
                      ++||+++|++||+.     ....+|||++|+..+..+...++++|||+|++|||++.+|.++|+.++++...
T Consensus        55 ~~dG~~~~~~iR~~-----~~~~~PIi~Lta~~~~~d~v~gl~~GADDYl~KPf~~~EL~ARi~a~lRR~~~  121 (229)
T COG0745          55 DLDGLELCRRLRAK-----KGSGPPIIVLTARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRALLRRNAG  121 (229)
T ss_pred             CCCHHHHHHHHHhh-----cCCCCcEEEEECCCcHHHHHHHHhCcCCeeeeCCCCHHHHHHHHHHHHCcCcC
Confidence            99999999999952     34678999999999999999999999999999999999999999999998753

>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd02065 B12-binding_like B12 binding domain (B12-BD) Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>PF07688 KaiA: KaiA domain; InterPro: IPR011648 KaiA is a component of the kaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
4euk_A153 Crystal Structure Length = 153 7e-13
3mm4_A206 Crystal Structure Of The Receiver Domain Of The His 2e-12
1oxb_B134 Complex Between Ypd1 And Sln1 Response Regulator Do 4e-12
2r25_B133 Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef 5e-12
2ayx_A254 Solution Structure Of The E.Coli Rcsc C-Terminus (R 2e-08
2ayz_A133 Solution Structure Of The E.Coli Rcsc C-Terminus (R 4e-08
3c97_A140 Crystal Structure Of The Response Regulator Receive 5e-06
3dge_C122 Structure Of A Histidine Kinase-response Regulator 6e-05
1zes_A125 Bef3- Activated Phob Receiver Domain Length = 125 1e-04
1b00_A127 Phob Receiver Domain From Escherichia Coli Length = 2e-04
1kgs_A225 Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG 3e-04
3c3m_A138 Crystal Structure Of The N-Terminal Domain Of Respo 3e-04
3nnn_A122 Bef3 Activated Drrd Receiver Domain Length = 122 3e-04
1m5t_A124 Crystal Structure Of The Response Regulator Divk Le 4e-04
3m6m_D143 Crystal Structure Of Rpff Complexed With Rec Domain 4e-04
3gl9_A122 The Structure Of A Histidine Kinase-Response Regula 5e-04
2jb9_A127 Phob Response Regulator Receiver Domain Constitutiv 5e-04
2wb4_A 459 Activated Diguanylate Cyclase Pled In Complex With 5e-04
1w25_A 459 Response Regulator Pled In Complex With C-digmp Len 6e-04
3q9s_A249 Crystal Structure Of Rra(1-215) From Deinococcus Ra 8e-04
>pdb|4EUK|A Chain A, Crystal Structure Length = 153 Back     alignment and structure 
Iteration: 1

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 69/153 (45%), Gaps = 47/153 (30%)
Query: 67  VLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNL 126
           +LLVED  +   +   M+K+LG  + +  +G  A+ A+                      
Sbjct: 11  ILLVEDNKINIMVAKSMMKQLGHTMDIANNGVEAITAI---------------------- 48
Query: 127 ETHNSPHYDLILMDCQMGSMDGCKATRVIRRLE------AEAETGQSI------------ 168
              NS  YDL+LMD  M  +DG KATR+IR  E      A  E G  I            
Sbjct: 49  ---NSSSYDLVLMDVCMPVLDGLKATRLIRSYEETGNWNAAIEAGVDISTSENEQVCMRP 105
Query: 169 ----PIIAFTALVTADNERECFNSGMDTFLNKP 197
               PIIA TA   A++  EC+ +GMD+F++KP
Sbjct: 106 TNRLPIIAMTANTLAESSEECYANGMDSFISKP 138
>pdb|3MM4|A Chain A, Crystal Structure Of The Receiver Domain Of The Histidine Kinase Cki1 From Arabidopsis Thaliana Length = 206 Back     alignment and structure
>pdb|1OXB|B Chain B, Complex Between Ypd1 And Sln1 Response Regulator Domain In Space Group P2(1)2(1)2(1) Length = 134 Back     alignment and structure
>pdb|2R25|B Chain B, Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef3- Length = 133 Back     alignment and structure
>pdb|2AYX|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 700-949) Containing Linker Region And Phosphoreceiver Domain Length = 254 Back     alignment and structure
>pdb|2AYZ|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 817-949) Containing Phosphoreceiver Domain Length = 133 Back     alignment and structure
>pdb|3C97|A Chain A, Crystal Structure Of The Response Regulator Receiver Domain Of A Signal Transduction Histidine Kinase From Aspergillus Oryzae Length = 140 Back     alignment and structure
>pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain Length = 125 Back     alignment and structure
>pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli Length = 127 Back     alignment and structure
>pdb|1KGS|A Chain A, Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG FROM THERMOTOGA Maritima Length = 225 Back     alignment and structure
>pdb|3C3M|A Chain A, Crystal Structure Of The N-Terminal Domain Of Response Regulator Receiver Protein From Methanoculleus Marisnigri Jr1 Length = 138 Back     alignment and structure
>pdb|3NNN|A Chain A, Bef3 Activated Drrd Receiver Domain Length = 122 Back     alignment and structure
>pdb|1M5T|A Chain A, Crystal Structure Of The Response Regulator Divk Length = 124 Back     alignment and structure
>pdb|3M6M|D Chain D, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 143 Back     alignment and structure
>pdb|3GL9|A Chain A, The Structure Of A Histidine Kinase-Response Regulator Complex Sheds Light Into Two-Component Signaling And Reveals A Novel Cis Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>pdb|2JB9|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D10a And D53e. Length = 127 Back     alignment and structure
>pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 Back     alignment and structure
>pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-digmp Length = 459 Back     alignment and structure
>pdb|3Q9S|A Chain A, Crystal Structure Of Rra(1-215) From Deinococcus Radiodurans Length = 249 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 8e-39
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 1e-37
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 3e-35
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 1e-34
2ayx_A254 Sensor kinase protein RCSC; two independent struct 1e-33
3c97_A140 Signal transduction histidine kinase; structural g 6e-33
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 2e-31
1mb3_A124 Cell division response regulator DIVK; signal tran 6e-31
3i42_A127 Response regulator receiver domain protein (CHEY- 6e-31
3luf_A259 Two-component system response regulator/ggdef doma 3e-27
3luf_A 259 Two-component system response regulator/ggdef doma 3e-12
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 5e-19
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 3e-18
3grc_A140 Sensor protein, kinase; protein structure initiati 1e-16
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 5e-16
3eq2_A 394 Probable two-component response regulator; adaptor 2e-15
3bre_A 358 Probable two-component response regulator; protein 2e-15
1w25_A 459 Stalked-cell differentiation controlling protein; 3e-15
1w25_A 459 Stalked-cell differentiation controlling protein; 1e-10
3heb_A152 Response regulator receiver domain protein (CHEY); 8e-14
3h5i_A140 Response regulator/sensory box protein/ggdef domai 1e-13
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 3e-12
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 3e-11
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 1e-10
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 1e-10
3cg0_A140 Response regulator receiver modulated diguanylate 2e-10
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 3e-10
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 3e-10
1s8n_A205 Putative antiterminator; RV1626, structural genomi 4e-10
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 5e-10
3cnb_A143 DNA-binding response regulator, MERR family; signa 5e-10
2qsj_A154 DNA-binding response regulator, LUXR family; struc 2e-09
3lua_A140 Response regulator receiver protein; two-component 2e-09
2zay_A147 Response regulator receiver protein; structural ge 3e-09
3hdg_A137 Uncharacterized protein; two-component sensor acti 3e-09
3c3m_A138 Response regulator receiver protein; structural ge 5e-09
3snk_A135 Response regulator CHEY-like protein; P-loop conta 5e-09
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 6e-09
3gt7_A154 Sensor protein; structural genomics, signal receiv 7e-09
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 8e-09
4dad_A146 Putative pilus assembly-related protein; response 8e-09
3n0r_A286 Response regulator; sigma factor, receiver, two-co 2e-08
2rdm_A132 Response regulator receiver protein; structural ge 2e-08
3cz5_A153 Two-component response regulator, LUXR family; str 2e-08
1dz3_A130 Stage 0 sporulation protein A; response regulator, 2e-08
3r0j_A250 Possible two component system response transcript 3e-08
3eul_A152 Possible nitrate/nitrite response transcriptional 1e-07
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 1e-07
1srr_A124 SPO0F, sporulation response regulatory protein; as 1e-07
3f6c_A134 Positive transcription regulator EVGA; structural 1e-07
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 1e-07
3nhm_A133 Response regulator; protein structure initiative I 2e-07
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 2e-07
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 2e-07
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 4e-07
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 5e-07
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 7e-07
3c3w_A225 Two component transcriptional regulatory protein; 9e-07
3n53_A140 Response regulator receiver modulated diguanylate; 9e-07
2qxy_A142 Response regulator; regulation of transcription, N 1e-06
2pln_A137 HP1043, response regulator; signaling protein; 1.8 1e-06
1ys7_A233 Transcriptional regulatory protein PRRA; response 1e-06
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 1e-06
3rqi_A184 Response regulator protein; structural genomics, s 2e-06
1yio_A208 Response regulatory protein; transcription regulat 2e-06
3lte_A132 Response regulator; structural genomics, PSI, prot 4e-06
3crn_A132 Response regulator receiver domain protein, CHEY-; 4e-06
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 5e-06
3hdv_A136 Response regulator; PSI-II, structural genomics, P 5e-06
3a10_A116 Response regulator; phosphoacceptor, signaling pro 6e-06
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 8e-06
2hqr_A223 Putative transcriptional regulator; phosporylation 1e-05
1zgz_A122 Torcad operon transcriptional regulatory protein; 1e-05
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 1e-05
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 1e-05
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 1e-05
3cg4_A142 Response regulator receiver domain protein (CHEY-; 2e-05
3q9s_A249 DNA-binding response regulator; DNA binding protei 2e-05
3jte_A143 Response regulator receiver protein; structural ge 2e-05
1xhf_A123 DYE resistance, aerobic respiration control protei 5e-05
2gkg_A127 Response regulator homolog; social motility, recei 5e-05
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 6e-05
3eqz_A135 Response regulator; structural genomics, unknown f 6e-05
3cfy_A137 Putative LUXO repressor protein; structural genomi 6e-05
2gwr_A238 DNA-binding response regulator MTRA; two-component 7e-05
1mvo_A136 PHOP response regulator; phosphate regulon, transc 8e-05
2oqr_A230 Sensory transduction protein REGX3; response regul 8e-05
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 1e-04
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 1e-04
2rjn_A154 Response regulator receiver:metal-dependent phosph 2e-04
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 4e-04
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 7e-04
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 8e-04
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 9e-04
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 Back     alignment and structure
 Score =  132 bits (334), Expect = 8e-39
 Identities = 48/161 (29%), Positives = 77/161 (47%), Gaps = 18/161 (11%)

Query: 57  DEKKVLEGLSVLLVEDQAVLQRIGIRMLKKLG-AGVTLVKDGEAAVEAMTLMINAAGKNH 115
            + + L G  VL+V+D  + +++    LKK+G + V     G+ A+  +T          
Sbjct: 54  SDDEFLRGKRVLVVDDNFISRKVATGKLKKMGVSEVEQCDSGKEALRLVT---------- 103

Query: 116 QIQNLHHGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTA 175
             + L       + +   +D I MDCQM  MDG +ATR IR++  E   G   PIIA + 
Sbjct: 104 --EGLTQREEQGSVDKLPFDYIFMDCQMPEMDGYEATREIRKV--EKSYGVRTPIIAVSG 159

Query: 176 L-VTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIARKS 215
               ++  RE   +GMD FL+K   +  LA  I E  +++ 
Sbjct: 160 HDPGSEEARETIQAGMDAFLDKSLNQ--LANVIREIESKRH 198
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Length = 150 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Length = 225 Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Length = 223 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 99.96
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 99.95
2lpm_A123 Two-component response regulator; transcription re 99.92
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 99.91
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 99.91
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 99.91
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 99.9
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 99.9
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 99.9
3rqi_A184 Response regulator protein; structural genomics, s 99.89
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 99.89
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 99.89
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 99.88
3r0j_A250 Possible two component system response transcript 99.88
3crn_A132 Response regulator receiver domain protein, CHEY-; 99.88
3gt7_A154 Sensor protein; structural genomics, signal receiv 99.88
1srr_A124 SPO0F, sporulation response regulatory protein; as 99.88
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 99.88
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 99.88
3n0r_A286 Response regulator; sigma factor, receiver, two-co 99.88
3i42_A127 Response regulator receiver domain protein (CHEY- 99.88
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 99.87
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 99.87
1xhf_A123 DYE resistance, aerobic respiration control protei 99.87
2ayx_A254 Sensor kinase protein RCSC; two independent struct 99.87
3kto_A136 Response regulator receiver protein; PSI-II,struct 99.87
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 99.87
3jte_A143 Response regulator receiver protein; structural ge 99.87
4dad_A146 Putative pilus assembly-related protein; response 99.87
3lua_A140 Response regulator receiver protein; two-component 99.87
1mvo_A136 PHOP response regulator; phosphate regulon, transc 99.87
3f6c_A134 Positive transcription regulator EVGA; structural 99.87
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 99.87
1zgz_A122 Torcad operon transcriptional regulatory protein; 99.87
1mb3_A124 Cell division response regulator DIVK; signal tran 99.87
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 99.87
3luf_A259 Two-component system response regulator/ggdef doma 99.87
3grc_A140 Sensor protein, kinase; protein structure initiati 99.87
3hdv_A136 Response regulator; PSI-II, structural genomics, P 99.87
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 99.87
3hdg_A137 Uncharacterized protein; two-component sensor acti 99.87
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 99.87
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 99.87
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 99.87
3c3m_A138 Response regulator receiver protein; structural ge 99.86
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 99.86
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 99.86
3snk_A135 Response regulator CHEY-like protein; P-loop conta 99.86
3h5i_A140 Response regulator/sensory box protein/ggdef domai 99.86
2rjn_A154 Response regulator receiver:metal-dependent phosph 99.86
3nhm_A133 Response regulator; protein structure initiative I 99.86
3heb_A152 Response regulator receiver domain protein (CHEY); 99.86
3cfy_A137 Putative LUXO repressor protein; structural genomi 99.86
3cnb_A143 DNA-binding response regulator, MERR family; signa 99.86
1dz3_A130 Stage 0 sporulation protein A; response regulator, 99.86
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 99.86
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 99.86
3eul_A152 Possible nitrate/nitrite response transcriptional 99.86
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 99.86
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 99.85
2zay_A147 Response regulator receiver protein; structural ge 99.85
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 99.85
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 99.85
2qxy_A142 Response regulator; regulation of transcription, N 99.85
3q9s_A249 DNA-binding response regulator; DNA binding protei 99.85
2qr3_A140 Two-component system response regulator; structura 99.85
3lte_A132 Response regulator; structural genomics, PSI, prot 99.85
1yio_A208 Response regulatory protein; transcription regulat 99.85
3cg0_A140 Response regulator receiver modulated diguanylate 99.85
3a10_A116 Response regulator; phosphoacceptor, signaling pro 99.85
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 99.85
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 99.84
3cg4_A142 Response regulator receiver domain protein (CHEY-; 99.84
3n53_A140 Response regulator receiver modulated diguanylate; 99.84
3cz5_A153 Two-component response regulator, LUXR family; str 99.84
3eq2_A 394 Probable two-component response regulator; adaptor 99.84
2qsj_A154 DNA-binding response regulator, LUXR family; struc 99.84
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 99.84
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 99.84
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 99.84
1s8n_A205 Putative antiterminator; RV1626, structural genomi 99.83
2gkg_A127 Response regulator homolog; social motility, recei 99.83
3eqz_A135 Response regulator; structural genomics, unknown f 99.83
1ys7_A233 Transcriptional regulatory protein PRRA; response 99.83
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.83
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 99.83
2rdm_A132 Response regulator receiver protein; structural ge 99.83
1w25_A 459 Stalked-cell differentiation controlling protein; 99.82
2pln_A137 HP1043, response regulator; signaling protein; 1.8 99.82
3c97_A140 Signal transduction histidine kinase; structural g 99.81
2qv0_A143 Protein MRKE; structural genomics, transcription, 99.81
2gwr_A238 DNA-binding response regulator MTRA; two-component 99.81
2oqr_A230 Sensory transduction protein REGX3; response regul 99.81
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 99.81
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 99.8
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 99.8
3c3w_A225 Two component transcriptional regulatory protein; 99.79
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 99.79
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 99.79
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 99.79
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 99.79
3bre_A 358 Probable two-component response regulator; protein 99.78
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 99.78
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 99.78
2hqr_A223 Putative transcriptional regulator; phosporylation 99.77
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 99.73
3luf_A 259 Two-component system response regulator/ggdef doma 99.72
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.7
1w25_A 459 Stalked-cell differentiation controlling protein; 99.24
3cwo_X 237 Beta/alpha-barrel protein based on 1THF and 1TMY; 99.2
2ayx_A 254 Sensor kinase protein RCSC; two independent struct 97.91
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 97.7
3q7r_A121 Transcriptional regulatory protein; CHXR, receiver 97.5
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 96.79
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 96.13
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 95.67
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 94.0
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, 92.35
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 91.97
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 91.91
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 91.57
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 91.51
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 91.43
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 91.39
1req_A727 Methylmalonyl-COA mutase; isomerase, intramolecula 91.02
2xij_A762 Methylmalonyl-COA mutase, mitochondrial; isomerase 90.76
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 90.4
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 89.68
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 89.09
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 88.82
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 88.18
3ezx_A215 MMCP 1, monomethylamine corrinoid protein 1; N ter 88.03
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 86.56
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 86.29
3fkq_A 373 NTRC-like two-domain protein; RER070207001320, str 85.99
3kp1_A763 D-ornithine aminomutase E component; 5 aminomutase 85.58
1xrs_B262 D-lysine 5,6-aminomutase beta subunit; TIM barrel, 85.51
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 85.37
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 84.66
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 83.09
3rht_A259 (gatase1)-like protein; structural genomics, PSI-b 83.06
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 82.89
1r8j_A 289 KAIA; circadian clock protein; 2.03A {Synechococcu 82.81
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 81.64
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 81.39
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 81.04
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
Probab=99.96  E-value=6e-29  Score=190.32  Aligned_cols=122  Identities=23%  Similarity=0.422  Sum_probs=111.8

Q ss_pred             CCcEEEEEeccHHHHHHHHHHHHhcCCe-EEEEcCcHHHHHHHHHHHHhcccccchhccccCCcccccCCCCccEEEEec
Q 026988           63 EGLSVLLVEDQAVLQRIGIRMLKKLGAG-VTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDC  141 (230)
Q Consensus        63 ~~~~iLiVdd~~~~~~~l~~~L~~~g~~-v~~~~~~~~al~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dlvl~D~  141 (230)
                      +++|||||||++.++..+..+|+..||. +..+.||.+|++.+.                         ...||+||+|+
T Consensus        11 k~~rILiVDD~~~~r~~l~~~L~~~G~~~v~~a~~g~~al~~~~-------------------------~~~~DlillD~   65 (134)
T 3to5_A           11 KNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLK-------------------------KGDFDFVVTDW   65 (134)
T ss_dssp             TTCCEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHH-------------------------HHCCSEEEEES
T ss_pred             CCCEEEEEeCCHHHHHHHHHHHHHcCCcEEEEECCHHHHHHHHH-------------------------hCCCCEEEEcC
Confidence            4679999999999999999999999995 778999999999987                         45799999999


Q ss_pred             CCCCCCHHHHHHHHHHhhhhhhcCCCceEEEEecCCChHhHHHHHHcCCCeeEeCCCCHHHHHHHHHHHHHh
Q 026988          142 QMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIAR  213 (230)
Q Consensus       142 ~mp~~dg~~l~~~lr~~~~~~~~~~~~pii~ls~~~~~~~~~~~~~~G~~~~L~KP~~~~~L~~~l~~~l~~  213 (230)
                      +||+|||++++++||+    .+..+++|||++|+..+.+...+++++|+++||.|||++++|.++|++++++
T Consensus        66 ~MP~mdG~el~~~ir~----~~~~~~ipvI~lTa~~~~~~~~~~~~~Ga~~yl~KP~~~~~L~~~i~~~l~R  133 (134)
T 3to5_A           66 NMPGMQGIDLLKNIRA----DEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFER  133 (134)
T ss_dssp             CCSSSCHHHHHHHHHH----STTTTTCCEEEEESSCCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHCC-
T ss_pred             CCCCCCHHHHHHHHHh----CCCCCCCeEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHhc
Confidence            9999999999999996    2355789999999999999999999999999999999999999999988754
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>1req_A Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichii subspshermanii} SCOP: c.1.19.1 c.23.6.1 PDB: 2req_A* 3req_A* 4req_A* 6req_A* 7req_A* 5req_A* 1e1c_A* Back     alignment and structure
>2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3kp1_A D-ornithine aminomutase E component; 5 aminomutase (OAM), metal binding protein; HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB: 3kow_A* 3koy_A* 3koz_A* 3kp0_A* 3kox_A* Back     alignment and structure
>1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'-deoxyad radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.23.6.1 d.230.4.1 Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1r8j_A KAIA; circadian clock protein; 2.03A {Synechococcus elongatus pcc 7942} SCOP: a.186.1.1 c.23.1.5 PDB: 1m2e_A 1m2f_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 2e-19
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 1e-17
d1i3ca_144 c.23.1.1 (A:) Response regulator for cyanobacteria 4e-17
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 8e-17
d1k68a_140 c.23.1.1 (A:) Response regulator for cyanobacteria 7e-16
d1zesa1121 c.23.1.1 (A:3-123) PhoB receiver domain {Escherich 9e-16
d1jbea_128 c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI 2e-15
d1a04a2138 c.23.1.1 (A:5-142) Nitrate/nitrite response regula 2e-15
d1peya_119 c.23.1.1 (A:) Sporulation response regulator Spo0F 1e-14
d1u0sy_118 c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T 1e-14
d2a9pa1117 c.23.1.1 (A:2-118) DNA-binding response regulator 2e-14
d1mb3a_123 c.23.1.1 (A:) Cell division response regulator Div 3e-14
d1k66a_149 c.23.1.1 (A:) Response regulator for cyanobacteria 6e-14
d2ayxa1133 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C 2e-13
d1zgza1120 c.23.1.1 (A:2-121) TorCAD operon transcriptional r 2e-13
d1a2oa1140 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal 3e-13
d1p6qa_129 c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti 3e-13
d1zh2a1119 c.23.1.1 (A:2-120) Transcriptional regulatory prot 5e-13
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 5e-13
d2b4aa1118 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba 2e-12
d1krwa_123 c.23.1.1 (A:) NTRC receiver domain {Salmonella typ 2e-12
d1dbwa_123 c.23.1.1 (A:) Transcriptional regulatory protein F 2e-12
d1mvoa_121 c.23.1.1 (A:) PhoP receiver domain {Bacillus subti 4e-12
d1kgsa2122 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog 6e-12
d1qkka_140 c.23.1.1 (A:) Transcriptional regulatory protein D 2e-11
d1p2fa2120 c.23.1.1 (A:1-120) Response regulator DrrB {Thermo 2e-11
d1ys7a2121 c.23.1.1 (A:7-127) Transcriptional regulatory prot 3e-11
d1s8na_190 c.23.1.1 (A:) Probable two-component system transc 5e-11
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 7e-11
d1yioa2128 c.23.1.1 (A:3-130) Response regulatory protein Sty 1e-10
d2pl1a1119 c.23.1.1 (A:1-119) PhoP receiver domain {Escherich 2e-10
d1qo0d_189 c.23.1.3 (D:) Positive regulator of the amidase op 5e-09
d1w25a2153 c.23.1.1 (A:141-293) Response regulator PleD, rece 6e-09
d1w25a1139 c.23.1.1 (A:2-140) Response regulator PleD, receiv 8e-09
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: Receiver domain of the ethylene receptor
domain: Receiver domain of the ethylene receptor
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 79.3 bits (195), Expect = 2e-19
 Identities = 25/153 (16%), Positives = 53/153 (34%), Gaps = 27/153 (17%)

Query: 62  LEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLH 121
             GL VL++++  V + +   +L  LG  VT V   E  +  +                 
Sbjct: 5   FTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVV----------------- 47

Query: 122 HGSNLETHNSPHYDLILMDCQMGSMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADN 181
                    S  + ++ MD  M  ++  +    I     +    Q   ++A +       
Sbjct: 48  ---------SHEHKVVFMDVCMPGVENYQIALRIHEKFTKQRH-QRPLLVALSGNTDKST 97

Query: 182 ERECFNSGMDTFLNKPAQEHLLAAAIVETIARK 214
           + +C + G+D  L KP     +   + + +  +
Sbjct: 98  KEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPR 130
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 99.96
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 99.96
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 99.96
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 99.95
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 99.95
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 99.95
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 99.95
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 99.95
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 99.95
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 99.95
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 99.95
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 99.95
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.95
d1mb3a_123 Cell division response regulator DivK {Caulobacter 99.95
d1qkka_140 Transcriptional regulatory protein DctD, receiver 99.95
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 99.95
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 99.95
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 99.95
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 99.95
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 99.95
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 99.95
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 99.95
d1k66a_149 Response regulator for cyanobacterial phytochrome 99.94
d1k68a_140 Response regulator for cyanobacterial phytochrome 99.94
d1yioa2128 Response regulatory protein StyR, N-terminal domai 99.94
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 99.94
d1i3ca_144 Response regulator for cyanobacterial phytochrome 99.94
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 99.94
d1s8na_190 Probable two-component system transcriptional regu 99.94
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 99.94
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 99.93
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 99.91
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 99.89
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 99.88
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 96.87
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 95.7
d1xrsb1160 D-lysine 5,6-aminomutase beta subunit KamE, C-term 94.55
d1r8ja2135 N-terminal domain of the circadian clock protein K 90.94
d1dxea_ 253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 86.83
d1id1a_153 Rck domain from putative potassium channel Kch {Es 85.85
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 85.85
d7reqb2163 Methylmalonyl-CoA mutase beta subunit, C-terminal 85.72
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 85.54
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 85.04
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 84.22
d1izca_ 299 Macrophomate synthase {Macrophoma commelinae [TaxI 84.12
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 81.0
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 80.88
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: PhoP receiver domain
species: Escherichia coli [TaxId: 562]

Probab=99.96  E-value=1.1e-28  Score=183.33  Aligned_cols=118  Identities=25%  Similarity=0.333  Sum_probs=111.6

Q ss_pred             cEEEEEeccHHHHHHHHHHHHhcCCeEEEEcCcHHHHHHHHHHHHhcccccchhccccCCcccccCCCCccEEEEecCCC
Q 026988           65 LSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMINAAGKNHQIQNLHHGSNLETHNSPHYDLILMDCQMG  144 (230)
Q Consensus        65 ~~iLiVdd~~~~~~~l~~~L~~~g~~v~~~~~~~~al~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dlvl~D~~mp  144 (230)
                      +|||||||++.++..++..|+..||.|..+.++.+|++.+.                         ...||+||+|++||
T Consensus         1 mrILvVDDd~~~~~~l~~~L~~~G~~v~~a~~g~eal~~l~-------------------------~~~~dliilD~~mP   55 (119)
T d2pl1a1           1 MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLN-------------------------EHIPDIAIVDLGLP   55 (119)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHH-------------------------HSCCSEEEECSCCS
T ss_pred             CEEEEEeCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHH-------------------------hcccceeehhccCC
Confidence            58999999999999999999999999999999999999997                         66899999999999


Q ss_pred             CCCHHHHHHHHHHhhhhhhcCCCceEEEEecCCChHhHHHHHHcCCCeeEeCCCCHHHHHHHHHHHHHh
Q 026988          145 SMDGCKATRVIRRLEAEAETGQSIPIIAFTALVTADNERECFNSGMDTFLNKPAQEHLLAAAIVETIAR  213 (230)
Q Consensus       145 ~~dg~~l~~~lr~~~~~~~~~~~~pii~ls~~~~~~~~~~~~~~G~~~~L~KP~~~~~L~~~l~~~l~~  213 (230)
                      ++||+++++++|+      ..+.+|||++|+..+.....++++.|+++||.||++.++|..++++++++
T Consensus        56 ~~~G~e~~~~i~~------~~~~~pvi~lt~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~v~~~lrR  118 (119)
T d2pl1a1          56 DEDGLSLIRRWRS------NDVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRR  118 (119)
T ss_dssp             SSCHHHHHHHHHH------TTCCSCEEEEESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHH
T ss_pred             CchhHHHHHHHHh------cCcccceEeeeccCCHHHHHHHHHcCCCEEEECCCCHHHHHHHHHHHHcc
Confidence            9999999999996      34579999999999999999999999999999999999999999999865
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d1r8ja2 c.23.1.5 (A:1-135) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure