Citrus Sinensis ID: 026993


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MATSLHSNLTFLPSHHSPKHKPTIITTHHRLPIRCGPRSNRGPLVKGRILSTEAIQAVQFLKRAHKQNPQNPTYPSLSRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDRLIGELEEIDGGDGRGLSRVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVEREFCWVPGGSLENLSV
ccccccccccccccccccccccccccccccccEEEccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccc
cccHccccccccccccccccccccccccccEEEEEcccccccccHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHccc
matslhsnltflpshhspkhkptiitthhrlpircgprsnrgplvkgrilsTEAIQAVQFLKRAhkqnpqnptypslsRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDRLIGEleeidggdgrgLSRVVRAVVEAGSKESTVRIYGLMkrsgvgcswkvdEYVGKVLSKGLRRFGEEELANEVErefcwvpggslenlsv
matslhsnltflpshhspkhKPTIITThhrlpircgprsnrgplvkgRILSTEAIQAVQFLKrahkqnpqnptypslsRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDRLIGELeeidggdgrglSRVVRAVveagskestvriyglmkrsgvgcswkvDEYVGKVLSKGLRRFGEeelaneverefcwvpggslenlsv
MATSLHSNLTFLPSHHSPKHKPTIITTHHRLPIRCGPRSNRGPLVKGRILSTEAIQAVQFLKRAHKQNPQNPTYPSLSRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDrligeleeidggdgrglSRVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVEREFCWVPGGSLENLSV
***********************IITTHHRLPIRCGPR**RGPLVKGRILSTEAIQAVQFLKR************SLSRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDRLIGELEEIDGGDGRGLSRVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVEREFCWVPG********
***************************HHRLP******************STEAIQAVQFLKRAHKQNPQNPTYPSLSRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDRLIGELEEIDGGDGRGLSRVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVEREFCWVPGGSLENL**
MATSLHSNLTFLPSHHSPKHKPTIITTHHRLPIRCGPRSNRGPLVKGRILSTEAIQAVQFLKRAHKQNPQNPTYPSLSRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDRLIGELEEIDGGDGRGLSRVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVEREFCWVPGGSLENLSV
*************************TTHHRLPIRCGPRSNRGPLVKGRILSTEAIQAVQFLKRAHKQNPQNPTYPSLSRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDRLIGELEEIDGGDGRGLSRVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVEREFCWVPGGSLE*LS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSLHSNLTFLPSHHSPKHKPTIITTHHRLPIRCGPRSNRGPLVKGRILSTEAIQAVQFLKRAHKQNPQNPTYPSLSRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDRLIGELEEIDGGDGRGLSRVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVEREFCWVPGGSLENLSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
Q9STF9257 Pentatricopeptide repeat- no no 0.742 0.661 0.298 4e-10
Q1PFH7196 Pentatricopeptide repeat- no no 0.567 0.663 0.264 2e-05
>sp|Q9STF9|PP266_ARATH Pentatricopeptide repeat-containing protein At3g46870 OS=Arabidopsis thaliana GN=At3g46870 PE=2 SV=1 Back     alignment and function desciption
 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 95/181 (52%), Gaps = 11/181 (6%)

Query: 41  RGPLVKGR-ILSTEAIQAVQFLKRAHKQNPQNPTY--PSLSRLIKHDLLAALRELIRQGE 97
           RGPL +G+ ++  EA+  +  LKR  + + +   +    + RL+K D+LA + EL RQ E
Sbjct: 63  RGPLWRGKKLIGKEALFVILGLKRLKEDDEKLDKFIKTHVFRLLKLDMLAVIGELERQEE 122

Query: 98  CAVAVHVFSTIQR-EYQQQDLGLLTDLINTLAKNGLTGEVDRLIGELEEID-GGDGRGLS 155
            A+A+ +F  IQ+ E+ Q D+ +  DLI +LAK+    E   L  ++++ +   D +  +
Sbjct: 123 TALAIKMFEVIQKQEWYQPDVFMYKDLIVSLAKSKRMDEAMALWEKMKKENLFPDSQTYT 182

Query: 156 RVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVERE 215
            V+R  +  G     + +Y  M +S        +E   +VL KGL       L N+V+++
Sbjct: 183 EVIRGFLRDGCPADAMNVYEDMLKSPDPP----EELPFRVLLKGL--LPHPLLRNKVKKD 236

Query: 216 F 216
           F
Sbjct: 237 F 237





Arabidopsis thaliana (taxid: 3702)
>sp|Q1PFH7|PPR89_ARATH Pentatricopeptide repeat-containing protein At1g62350 OS=Arabidopsis thaliana GN=At1g62350 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
359482912230 PREDICTED: pentatricopeptide repeat-cont 0.956 0.952 0.512 4e-52
449448168230 PREDICTED: pentatricopeptide repeat-cont 0.917 0.913 0.493 8e-50
297815036220 hypothetical protein ARALYDRAFT_905030 [ 0.829 0.863 0.536 3e-48
15232255222 uncharacterized protein [Arabidopsis tha 0.917 0.945 0.511 9e-48
356528924238 PREDICTED: uncharacterized protein LOC10 0.921 0.886 0.517 3e-47
356523014240 PREDICTED: uncharacterized protein LOC10 0.912 0.870 0.513 1e-45
357513379239 hypothetical protein MTR_8g013670 [Medic 0.934 0.895 0.453 7e-43
224074009190 predicted protein [Populus trichocarpa] 0.790 0.952 0.540 2e-41
388505356263 unknown [Medicago truncatula] 0.868 0.756 0.448 2e-38
224286190274 unknown [Picea sitchensis] 0.786 0.656 0.374 2e-20
>gi|359482912|ref|XP_003632859.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Vitis vinifera] gi|297743240|emb|CBI36107.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 161/236 (68%), Gaps = 17/236 (7%)

Query: 1   MATS-LHSNLTFLPSHHSPKHKPT-IITTHHRLPIRCGPRSNRGPLVKGRILSTEAIQAV 58
           MA+S LHSN        SP  KP   ITT    PIRCGPR NRGPL+KGR+LS EAIQA+
Sbjct: 1   MASSALHSNFALF----SPIKKPVQTITTTSYTPIRCGPRDNRGPLMKGRVLSIEAIQAI 56

Query: 59  QFLKRAHKQNP---QNPTYPSLSRLIKHDLLAALRELIRQGECAVAVHVFSTIQRE-YQQ 114
           Q LKRAH+ +P    +    +LSRL+K DLLA L EL+RQ +C +A+ VFS ++ E + +
Sbjct: 57  QSLKRAHRGDPTKIDDFLSKTLSRLVKADLLATLNELLRQDQCDLALRVFSAVRSELWYK 116

Query: 115 QDLGLLTDLINTLAKNGLTGEVDRLIGELEEIDGG---DGRGLSRVVRAVVEAGSKESTV 171
            +L L  DL++ LA+ G+  E+DRLI +LE  +G    D +G+ R+V+AV+ A  ++STV
Sbjct: 117 TELSLYADLVSALARKGMKEEIDRLICDLEG-EGSVRCDDKGIVRLVKAVIAAERRDSTV 175

Query: 172 RIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVEREFCWVPGGSLENL 227
           RIYGLMKRSG G     DEYVG+VLS+GLRR GE  +A+EV+ EF  +  G+LE +
Sbjct: 176 RIYGLMKRSGCGGG---DEYVGRVLSRGLRRLGELGVADEVDLEFGRLSKGNLEKV 228




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449448168|ref|XP_004141838.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Cucumis sativus] gi|449491766|ref|XP_004158997.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297815036|ref|XP_002875401.1| hypothetical protein ARALYDRAFT_905030 [Arabidopsis lyrata subsp. lyrata] gi|297321239|gb|EFH51660.1| hypothetical protein ARALYDRAFT_905030 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15232255|ref|NP_189412.1| uncharacterized protein [Arabidopsis thaliana] gi|9294480|dbj|BAB02699.1| unnamed protein product [Arabidopsis thaliana] gi|49660179|gb|AAT68380.1| hypothetical protein At3g27750 [Arabidopsis thaliana] gi|60547779|gb|AAX23853.1| hypothetical protein At3g27750 [Arabidopsis thaliana] gi|332643839|gb|AEE77360.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356528924|ref|XP_003533047.1| PREDICTED: uncharacterized protein LOC100788379 [Glycine max] Back     alignment and taxonomy information
>gi|356523014|ref|XP_003530137.1| PREDICTED: uncharacterized protein LOC100799612 [Glycine max] Back     alignment and taxonomy information
>gi|357513379|ref|XP_003626978.1| hypothetical protein MTR_8g013670 [Medicago truncatula] gi|355521000|gb|AET01454.1| hypothetical protein MTR_8g013670 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224074009|ref|XP_002304213.1| predicted protein [Populus trichocarpa] gi|222841645|gb|EEE79192.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388505356|gb|AFK40744.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224286190|gb|ACN40805.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
TAIR|locus:2089154222 EMB3123 "EMBRYO DEFECTIVE 3123 0.908 0.936 0.479 7.5e-41
TAIR|locus:2102832257 AT3G46870 [Arabidopsis thalian 0.742 0.661 0.287 1.8e-08
TAIR|locus:2184727712 VPS9B "AT5G09320" [Arabidopsis 0.257 0.082 0.45 1.7e-06
TAIR|locus:2089154 EMB3123 "EMBRYO DEFECTIVE 3123" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 434 (157.8 bits), Expect = 7.5e-41, P = 7.5e-41
 Identities = 104/217 (47%), Positives = 134/217 (61%)

Query:     1 MATSLHSNLTFLPS-HHSPKHKPTIITTHHR-LPIRCGPRSNRGPLVKGRILSTEAIQAV 58
             MA SL    T  PS  HS  H  ++I      + IRCGPR NRGPL+KGRILSTEAIQ++
Sbjct:     1 MALSLSQ--TRPPSLSHS--HTLSVIVPKRTFVSIRCGPRDNRGPLLKGRILSTEAIQSI 56

Query:    59 QFLKRAHKQNPQ-NPTYPSLSRLIKHDLLAALRELIRQGECAVAVHVFSTIQREYQQQDL 117
             Q LKRAH+     + T   L RLIK DL++ LREL+RQ  C +AVHV ST++ EY   DL
Sbjct:    57 QSLKRAHRTGVSLSLTLRPLRRLIKSDLISVLRELLRQDYCTLAVHVLSTLRTEYPPLDL 116

Query:   118 GLLTDLINTLAKNGLTGEVDXXXXXXXXXXXXXXXXX-SRVVRAVVEAGSKESTVRIYGL 176
              L  D++N L +N    E+D                  ++++RAVV A  +ES VR+Y L
Sbjct:   117 VLYADIVNALTRNKEFDEIDRLIGEIDGIDQRSDDKALAKLIRAVVGAERRESVVRVYTL 176

Query:   177 MKRSGVGC-SWKVDEYVGKVLSKGLRRFGEEELANEV 212
             M+ SG G  SW+ DEYV +VLSKGL R GE +LA++V
Sbjct:   177 MRESGWGSESWEADEYVAEVLSKGLLRLGEPDLASQV 213




GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0000373 "Group II intron splicing" evidence=IMP
GO:0003723 "RNA binding" evidence=IDA
GO:0009658 "chloroplast organization" evidence=IMP
TAIR|locus:2102832 AT3G46870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184727 VPS9B "AT5G09320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034357001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (324 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
PLN03218 1060 maturation of RBCL 1; Provisional 99.94
PLN03218 1060 maturation of RBCL 1; Provisional 99.94
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.93
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.92
PLN03077 857 Protein ECB2; Provisional 99.9
PLN03077 857 Protein ECB2; Provisional 99.9
PF1304150 PPR_2: PPR repeat family 99.72
PF1304150 PPR_2: PPR repeat family 99.69
PF1285434 PPR_1: PPR repeat 99.28
PF1285434 PPR_1: PPR repeat 99.18
PRK11788389 tetratricopeptide repeat protein; Provisional 99.05
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.9
KOG4422 625 consensus Uncharacterized conserved protein [Funct 98.9
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.84
KOG4422 625 consensus Uncharacterized conserved protein [Funct 98.76
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.76
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.74
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.73
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.71
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.63
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.51
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.51
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.5
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.44
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.28
PRK12370553 invasion protein regulator; Provisional 98.17
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.13
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.11
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.09
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.09
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.08
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.04
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.99
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.96
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.93
PRK15359144 type III secretion system chaperone protein SscB; 97.92
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.87
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.84
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.82
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.8
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.79
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.78
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.78
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.77
PRK11189296 lipoprotein NlpI; Provisional 97.7
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.7
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.69
PRK10370198 formate-dependent nitrite reductase complex subuni 97.68
PRK12370 553 invasion protein regulator; Provisional 97.67
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.62
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.6
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.59
PRK15359144 type III secretion system chaperone protein SscB; 97.58
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.57
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.54
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.52
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.5
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.49
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.46
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.45
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.41
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 97.39
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 97.38
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.38
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.38
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.38
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.35
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.33
KOG1126638 consensus DNA-binding cell division cycle control 97.26
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.25
PRK14574 822 hmsH outer membrane protein; Provisional 97.25
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.22
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.22
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.21
PRK11189 296 lipoprotein NlpI; Provisional 97.21
PRK10370198 formate-dependent nitrite reductase complex subuni 97.19
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 97.19
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.17
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 97.17
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.05
PRK14574 822 hmsH outer membrane protein; Provisional 97.03
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.0
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.0
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 96.91
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 96.86
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.86
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.82
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.79
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 96.7
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.65
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 96.49
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 96.48
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.48
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.44
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.41
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.38
PRK10803263 tol-pal system protein YbgF; Provisional 96.3
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 96.29
KOG1129 478 consensus TPR repeat-containing protein [General f 96.22
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.17
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 96.16
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.13
KOG1126638 consensus DNA-binding cell division cycle control 95.94
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.92
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 95.86
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 95.81
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.75
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 95.75
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.74
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.65
KOG2076 895 consensus RNA polymerase III transcription factor 95.64
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.61
KOG2003 840 consensus TPR repeat-containing protein [General f 95.6
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.58
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.56
KOG3941 406 consensus Intermediate in Toll signal transduction 95.5
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 95.48
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.48
KOG1129478 consensus TPR repeat-containing protein [General f 95.46
KOG1070 1710 consensus rRNA processing protein Rrp5 [RNA proces 95.45
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 95.44
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.41
PRK10803263 tol-pal system protein YbgF; Provisional 95.23
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.08
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 95.04
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 95.03
PF1337173 TPR_9: Tetratricopeptide repeat 94.99
KOG3616 1636 consensus Selective LIM binding factor [Transcript 94.87
KOG0547606 consensus Translocase of outer mitochondrial membr 94.76
COG3629280 DnrI DNA-binding transcriptional activator of the 94.69
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.53
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.47
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 94.33
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 94.32
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 94.3
KOG2003 840 consensus TPR repeat-containing protein [General f 94.26
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.23
PF1337173 TPR_9: Tetratricopeptide repeat 94.23
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 94.2
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.2
KOG1915 677 consensus Cell cycle control protein (crooked neck 94.14
PF13512142 TPR_18: Tetratricopeptide repeat 94.04
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 93.91
KOG2376 652 consensus Signal recognition particle, subunit Srp 93.78
KOG2796366 consensus Uncharacterized conserved protein [Funct 93.65
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 93.42
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 93.42
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 93.34
PF13512142 TPR_18: Tetratricopeptide repeat 93.29
KOG3785557 consensus Uncharacterized conserved protein [Funct 93.04
PLN02789 320 farnesyltranstransferase 92.87
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 92.81
smart00299140 CLH Clathrin heavy chain repeat homology. 92.77
smart00299140 CLH Clathrin heavy chain repeat homology. 92.61
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.45
PLN02789 320 farnesyltranstransferase 92.39
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.13
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.07
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 92.03
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 92.0
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 91.69
KOG3941 406 consensus Intermediate in Toll signal transduction 91.52
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 91.51
PF12688120 TPR_5: Tetratrico peptide repeat 91.51
KOG0495 913 consensus HAT repeat protein [RNA processing and m 91.47
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.01
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.86
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.74
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 90.45
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.43
KOG2076 895 consensus RNA polymerase III transcription factor 90.19
KOG0553304 consensus TPR repeat-containing protein [General f 90.14
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 89.98
PRK14720 906 transcript cleavage factor/unknown domain fusion p 89.86
PRK04841 903 transcriptional regulator MalT; Provisional 89.63
KOG1125579 consensus TPR repeat-containing protein [General f 89.52
PRK04841 903 transcriptional regulator MalT; Provisional 89.04
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 88.74
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 88.62
KOG3785557 consensus Uncharacterized conserved protein [Funct 88.57
KOG0547 606 consensus Translocase of outer mitochondrial membr 88.4
KOG3616 1636 consensus Selective LIM binding factor [Transcript 88.29
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.94
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 87.66
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 87.46
COG4235287 Cytochrome c biogenesis factor [Posttranslational 87.46
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 87.45
PRK10153517 DNA-binding transcriptional activator CadC; Provis 87.11
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 87.1
COG4700251 Uncharacterized protein conserved in bacteria cont 86.95
KOG2376 652 consensus Signal recognition particle, subunit Srp 86.37
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.2
KOG2047 835 consensus mRNA splicing factor [RNA processing and 85.96
KOG1128 777 consensus Uncharacterized conserved protein, conta 85.37
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 85.1
PRK15331165 chaperone protein SicA; Provisional 84.95
COG1729262 Uncharacterized protein conserved in bacteria [Fun 84.73
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 84.64
KOG0553 304 consensus TPR repeat-containing protein [General f 84.64
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 84.49
PF1342844 TPR_14: Tetratricopeptide repeat 84.31
KOG4570 418 consensus Uncharacterized conserved protein [Funct 83.65
COG3629280 DnrI DNA-binding transcriptional activator of the 83.57
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 82.49
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 82.4
KOG1128 777 consensus Uncharacterized conserved protein, conta 82.17
COG2178204 Predicted RNA-binding protein of the translin fami 81.95
KOG2796366 consensus Uncharacterized conserved protein [Funct 81.84
PF1342844 TPR_14: Tetratricopeptide repeat 81.43
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.89
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 80.83
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 80.79
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.71
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 80.25
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 80.19
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=99.94  E-value=1.2e-25  Score=223.15  Aligned_cols=183  Identities=12%  Similarity=0.106  Sum_probs=155.5

Q ss_pred             CCCcccccccccceeeCCCCCCCCCcccCCCCHHHHHHHHHHHHhcCCCCC-CCchHHhhhh------------------
Q 026993           20 HKPTIITTHHRLPIRCGPRSNRGPLVKGRILSTEAIQAVQFLKRAHKQNPQ-NPTYPSLSRL------------------   80 (229)
Q Consensus        20 ~~p~~~~~~~~~~~~c~~~~~~~~~~~~r~l~~ea~~~~~~l~~~~~~~~~-~~~~~~~~~l------------------   80 (229)
                      ..|+..|++.++...|.-    |       ...+|..+++.|.+. +..|+ ..++.++..+                  
T Consensus       575 i~PD~vTynaLI~ay~k~----G-------~ldeA~elf~~M~e~-gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~  642 (1060)
T PLN03218        575 IDPDHITVGALMKACANA----G-------QVDRAKEVYQMIHEY-NIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKK  642 (1060)
T ss_pred             CCCcHHHHHHHHHHHHHC----C-------CHHHHHHHHHHHHHc-CCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHH
Confidence            357888899999888872    1       126788888888874 45554 2233333322                  


Q ss_pred             --hhhcH---HHHHHHHHhcCCHHHHHHHHHHHHHH-cCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhhCC-CCCHHH
Q 026993           81 --IKHDL---LAALRELIRQGECAVAVHVFSTIQRE-YQQQDLGLLTDLINTLAKNGLTGEVDRLIGELEEID-GGDGRG  153 (229)
Q Consensus        81 --~~~d~---~~vl~~l~~~g~~~~A~~vf~~m~~~-~~~pd~~ty~~LI~~~~k~g~~~~A~~lf~~M~~~g-~pd~~t  153 (229)
                        +.+|.   ..++..|++.|++++|+++|+.|.+. +. ||..+||+||++|+++|++++|.++|++|.+.| .||.++
T Consensus       643 ~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~-pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~Pdvvt  721 (1060)
T PLN03218        643 KGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIK-LGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVST  721 (1060)
T ss_pred             cCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCC-CCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHH
Confidence              23442   36799999999999999999999887 77 999999999999999999999999999999999 999999


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhhc
Q 026993          154 LSRVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVEREFCWV  219 (229)
Q Consensus       154 yn~lI~~~~~~g~~~~A~~~f~~M~~~g~~~~~~Pd~~Ty~~Li~~~~~~g~~~~A~~v~~e~~~~  219 (229)
                      ||+||.+||+.|++++|+++|++|.+.|+.    ||.+||++||++|++.|++++|.+++.+|.+.
T Consensus       722 yN~LI~gy~k~G~~eeAlelf~eM~~~Gi~----Pd~~Ty~sLL~a~~k~G~le~A~~l~~~M~k~  783 (1060)
T PLN03218        722 MNALITALCEGNQLPKALEVLSEMKRLGLC----PNTITYSILLVASERKDDADVGLDLLSQAKED  783 (1060)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHcCCC----CCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHc
Confidence            999999999999999999999999999997    99999999999999999999999999999886



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2178 Predicted RNA-binding protein of the translin family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.91
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.89
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.49
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.48
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.24
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.96
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.96
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.95
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.93
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.92
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.91
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.89
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.88
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.87
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.87
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.8
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.76
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 98.75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.72
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.7
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.69
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.68
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.68
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 98.67
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.66
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.65
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.63
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.62
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.6
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.6
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.59
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.59
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.58
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.54
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.54
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.53
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.45
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.45
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.44
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.43
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.43
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.42
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.41
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.38
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.37
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.37
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.34
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.32
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.32
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.31
3u4t_A272 TPR repeat-containing protein; structural genomics 98.3
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.3
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.29
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.29
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.28
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.25
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.25
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.21
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.2
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.18
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.17
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.17
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.11
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.1
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.1
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.1
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.08
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.08
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.07
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.07
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.03
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.03
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.02
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.01
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.01
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.01
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.99
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.98
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.98
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.96
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.96
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.95
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.93
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.92
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.92
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.91
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.91
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.9
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.9
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.89
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.89
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.86
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.84
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.84
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.83
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.83
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.82
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.81
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.81
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.8
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.77
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 97.77
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.76
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 97.75
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.74
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.73
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.71
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 97.71
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.67
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.66
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.65
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.64
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.64
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.63
3k9i_A117 BH0479 protein; putative protein binding protein, 97.61
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.55
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.54
3k9i_A117 BH0479 protein; putative protein binding protein, 97.53
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.53
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.53
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.53
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.5
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.48
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.48
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.48
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.47
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.46
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.45
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.43
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.42
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.42
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.41
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.4
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.37
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.33
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 97.33
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.31
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.16
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.15
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.14
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.13
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.08
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 97.05
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 97.02
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.99
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.98
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.94
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 96.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.9
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.89
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.89
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.87
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.71
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.71
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.71
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.7
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.67
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.65
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.64
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.59
4g1t_A 472 Interferon-induced protein with tetratricopeptide 96.55
4g1t_A472 Interferon-induced protein with tetratricopeptide 96.46
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.46
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.45
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.4
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.33
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 96.28
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.25
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.1
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 96.01
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.95
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 95.94
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.91
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 95.7
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.68
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 95.59
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 95.59
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 95.58
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 95.39
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.31
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 95.17
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 94.65
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 93.68
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 93.67
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.58
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.55
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 93.49
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 93.37
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 92.93
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 92.84
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 92.58
1pc2_A152 Mitochondria fission protein; unknown function; NM 92.06
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 91.72
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.94
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 90.88
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 90.76
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 90.54
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.0
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 89.68
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 88.59
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 87.63
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 87.56
2p58_C116 Putative type III secretion protein YSCG; type III 87.26
1pc2_A152 Mitochondria fission protein; unknown function; NM 86.97
2uwj_G115 Type III export protein PSCG; virulence, chaperone 86.1
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 84.59
1klx_A138 Cysteine rich protein B; structural genomics, heli 84.48
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 82.43
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 81.4
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=99.96  E-value=1.5e-28  Score=227.28  Aligned_cols=151  Identities=10%  Similarity=0.005  Sum_probs=133.6

Q ss_pred             HHHHHHHHHHHHhcCCCCCCCchHHhhhhhhhcHHHHHHHHHhcC---------CHHHHHHHHHHHHHH-cCCCCHHHHH
Q 026993           52 TEAIQAVQFLKRAHKQNPQNPTYPSLSRLIKHDLLAALRELIRQG---------ECAVAVHVFSTIQRE-YQQQDLGLLT  121 (229)
Q Consensus        52 ~ea~~~~~~l~~~~~~~~~~~~~~~~~~l~~~d~~~vl~~l~~~g---------~~~~A~~vf~~m~~~-~~~pd~~ty~  121 (229)
                      .+|..+++.|++. +..|+.+.+           .++|.+|++.+         .++.|.++|++|.+. +. ||.+|||
T Consensus        43 ~~A~~lf~~M~~~-Gv~pd~~ty-----------n~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~-Pd~~tyn  109 (501)
T 4g26_A           43 LEALRLYDEARRN-GVQLSQYHY-----------NVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVV-PNEATFT  109 (501)
T ss_dssp             HHHHHHHHHHHHH-TCCCCHHHH-----------HHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCC-CCHHHHH
T ss_pred             HHHHHHHHHHHHc-CCCCCHhHH-----------HHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCC-CCHHHHH
Confidence            5777777777763 455552221           24566666554         378899999999887 88 9999999


Q ss_pred             HHHHHHHhcCCHHHHHHHHHHhhhCC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCCCCCHHHHHHHHHHH
Q 026993          122 DLINTLAKNGLTGEVDRLIGELEEID-GGDGRGLSRVVRAVVEAGSKESTVRIYGLMKRSGVGCSWKVDEYVGKVLSKGL  200 (229)
Q Consensus       122 ~LI~~~~k~g~~~~A~~lf~~M~~~g-~pd~~tyn~lI~~~~~~g~~~~A~~~f~~M~~~g~~~~~~Pd~~Ty~~Li~~~  200 (229)
                      +||++|++.|++++|.++|++|.+.| .||.+|||+||.+||+.|++++|.++|++|.+.|+.    ||.+||++||++|
T Consensus       110 ~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~----Pd~~ty~~Li~~~  185 (501)
T 4g26_A          110 NGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVV----PEEPELAALLKVS  185 (501)
T ss_dssp             HHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCC----CCHHHHHHHHHHH
T ss_pred             HHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCC----CCHHHHHHHHHHH
Confidence            99999999999999999999999999 999999999999999999999999999999999997    9999999999999


Q ss_pred             HhcCCHHHHHHHHHHhhhc
Q 026993          201 RRFGEEELANEVEREFCWV  219 (229)
Q Consensus       201 ~~~g~~~~A~~v~~e~~~~  219 (229)
                      ++.|++++|.+++++|++.
T Consensus       186 ~~~g~~d~A~~ll~~Mr~~  204 (501)
T 4g26_A          186 MDTKNADKVYKTLQRLRDL  204 (501)
T ss_dssp             HHTTCHHHHHHHHHHHHHH
T ss_pred             hhCCCHHHHHHHHHHHHHh
Confidence            9999999999999999985



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.54
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.25
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.22
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.09
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.08
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.05
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.04
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.02
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.81
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.78
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.78
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.75
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.72
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 97.64
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 97.63
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.61
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.6
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.59
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.52
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.46
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.36
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.34
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.33
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.31
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.22
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.17
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.16
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.13
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 97.06
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.02
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.97
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.91
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.71
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.68
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.66
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.18
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.93
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 95.91
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 95.89
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.74
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.0
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 93.24
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 93.23
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 91.96
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 91.1
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 90.23
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 80.31
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.54  E-value=2.5e-06  Score=69.98  Aligned_cols=128  Identities=16%  Similarity=0.085  Sum_probs=97.8

Q ss_pred             HHHHHHhcCCHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHHHHcCCH
Q 026993           88 ALRELIRQGECAVAVHVFSTIQREYQQQDLGLLTDLINTLAKNGLTGEVDRLIGELEEIDGGDGRGLSRVVRAVVEAGSK  167 (229)
Q Consensus        88 vl~~l~~~g~~~~A~~vf~~m~~~~~~pd~~ty~~LI~~~~k~g~~~~A~~lf~~M~~~g~pd~~tyn~lI~~~~~~g~~  167 (229)
                      +-..+.+.|++++|+..|+...+... -+..+|..+-..|.+.|+.++|.+.|+........+...+..+...|.+.|++
T Consensus       243 l~~~~~~~~~~~~A~~~~~~al~~~p-~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~  321 (388)
T d1w3ba_         243 LACVYYEQGLIDLAIDTYRRAIELQP-HFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNI  321 (388)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHTCS-SCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCH
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCH
Confidence            34556678888888888887765332 35667888888888888999998888877654445677888888888888999


Q ss_pred             HHHHHHHHHHHHcCCCCCCCC-CHHHHHHHHHHHHhcCCHHHHHHHHHHhhhcCCC
Q 026993          168 ESTVRIYGLMKRSGVGCSWKV-DEYVGKVLSKGLRRFGEEELANEVEREFCWVPGG  222 (229)
Q Consensus       168 ~~A~~~f~~M~~~g~~~~~~P-d~~Ty~~Li~~~~~~g~~~~A~~v~~e~~~~~~~  222 (229)
                      ++|.+.|++..+..      | +..+|..+-..+.+.|++++|.+.+++.-+..|.
T Consensus       322 ~~A~~~~~~al~~~------p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~  371 (388)
T d1w3ba_         322 EEAVRLYRKALEVF------PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPT  371 (388)
T ss_dssp             HHHHHHHHHHTTSC------TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTT
T ss_pred             HHHHHHHHHHHHhC------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC
Confidence            99999888876542      4 4566777888888899999998888887666443



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure