Citrus Sinensis ID: 027372


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MSTTTLYNCATTKLCSSLINNSSSFSKSRLFFSSSHFAPRVSSIRRPLSLRGASRSSSSSSSARAISTMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHERNVFI
cccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccEEEEcccccEEEEEcccccccccccccccccEEEEEEEEEEccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEccccccEEEEEEEEEc
ccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccEEEEEcccccccccccHccccccccccccccEEcEEEEEEcccccEEEEEEccccccccccEEccEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHccEHEEEEEEccccccccccEEHHcc
mstttlyncattkLCSSLinnsssfsksrlffssshfaprvssirrplslrgasrssssssSARAISTmgdattdaGMDAVQRRLMfedecilvdendrvvghenkynCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQrsgtkvtfplvwtntccshplyreselieeNALGVRNAAQRKLLDElgicaedvpvdeftplgrilykapsdgkwgehernvfi
mstttlyncattkLCSSLINNSSSFSKSRLFFssshfaprvssirrplslrgasrsssssssarAISTMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILykapsdgkwgehernvfi
MSTTTLYNCATTKLCsslinnsssfsksrlffssshfAPRVSSIrrplslrgasrsssssssaraisTMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHERNVFI
*****LYNCATTKLCSSLIN***********************************************************AVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKA***************
**********************************************************************************RRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHERNVFI
MSTTTLYNCATTKLCSSLINNSSSFSKSRLFFSSSHFAPRVSSIRRP**********************GDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHERNVFI
*************LCSSLINNSS**********SSHFAPRVSSI*******************************AGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHERNVFI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTTTLYNCATTKLCSSLINNSSSFSKSRLFFSSSHFAPRVSSIRRPLSLRGASRSSSSSSSARAISTMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHERNVFI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query224 2.2.26 [Sep-21-2011]
O48965309 Isopentenyl-diphosphate D N/A no 0.816 0.592 0.764 1e-83
Q38929291 Isopentenyl-diphosphate D yes no 0.799 0.615 0.801 6e-83
O48964235 Isopentenyl-diphosphate D N/A no 0.696 0.663 0.884 1e-80
Q42553284 Isopentenyl-diphosphate D no no 0.781 0.616 0.805 8e-80
Q39472287 Isopentenyl-diphosphate D N/A no 0.781 0.609 0.797 8e-80
Q39471286 Isopentenyl-diphosphate D N/A no 0.790 0.618 0.781 2e-79
Q39664290 Isopentenyl-diphosphate D N/A no 0.901 0.696 0.714 4e-79
Q1LZ95227 Isopentenyl-diphosphate D no no 0.660 0.651 0.615 8e-42
Q4R4W5227 Isopentenyl-diphosphate D N/A no 0.660 0.651 0.602 5e-41
Q13907227 Isopentenyl-diphosphate D no no 0.625 0.616 0.619 5e-41
>sp|O48965|IDI2_CAMAC Isopentenyl-diphosphate Delta-isomerase II OS=Camptotheca acuminata GN=IPI2 PE=2 SV=1 Back     alignment and function desciption
 Score =  308 bits (790), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 160/195 (82%), Gaps = 12/195 (6%)

Query: 30  LFFSSSHFAPRVSSIRRPLSLRGASRSSSSSSSARAISTMGDATTDAGMDAVQRRLMFED 89
           +F SSSH + RVSS              SS ++    S MGD  TDAGMDAVQRRLMFED
Sbjct: 48  VFCSSSHLSVRVSSYH------------SSVAAKATTSAMGDTATDAGMDAVQRRLMFED 95

Query: 90  ECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFP 149
           ECILVDEND VVGH+ KYNCHLMEKIES NLLHRAFSVFLFNSKYELLLQQRS TKVTFP
Sbjct: 96  ECILVDENDHVVGHDTKYNCHLMEKIESDNLLHRAFSVFLFNSKYELLLQQRSATKVTFP 155

Query: 150 LVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKA 209
           LVWTNTCCSHP YRESEL++ENALGVRNAAQRKLLDELGI AEDVPVD+F PLGR+LYKA
Sbjct: 156 LVWTNTCCSHPRYRESELVDENALGVRNAAQRKLLDELGIPAEDVPVDQFIPLGRMLYKA 215

Query: 210 PSDGKWGEHERNVFI 224
           PSDGKWGEHE +  +
Sbjct: 216 PSDGKWGEHELDYLL 230




Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
Camptotheca acuminata (taxid: 16922)
EC: 5EC: .EC: 3EC: .EC: 3EC: .EC: 2
>sp|Q38929|IDI1_ARATH Isopentenyl-diphosphate Delta-isomerase I, chloroplastic OS=Arabidopsis thaliana GN=IPP1 PE=2 SV=3 Back     alignment and function description
>sp|O48964|IDI1_CAMAC Isopentenyl-diphosphate Delta-isomerase I OS=Camptotheca acuminata GN=IPI1 PE=2 SV=1 Back     alignment and function description
>sp|Q42553|IDI2_ARATH Isopentenyl-diphosphate Delta-isomerase II, chloroplastic OS=Arabidopsis thaliana GN=IPP2 PE=2 SV=1 Back     alignment and function description
>sp|Q39472|IDI1_CLABR Isopentenyl-diphosphate Delta-isomerase I OS=Clarkia breweri GN=IPI1 PE=2 SV=2 Back     alignment and function description
>sp|Q39471|IDI2_CLABR Isopentenyl-diphosphate Delta-isomerase II OS=Clarkia breweri GN=IPI2 PE=3 SV=2 Back     alignment and function description
>sp|Q39664|IDI2_CLAXA Isopentenyl-diphosphate Delta-isomerase II OS=Clarkia xantiana GN=IPI2 PE=3 SV=1 Back     alignment and function description
>sp|Q1LZ95|IDI1_BOVIN Isopentenyl-diphosphate Delta-isomerase 1 OS=Bos taurus GN=IDI1 PE=2 SV=2 Back     alignment and function description
>sp|Q4R4W5|IDI1_MACFA Isopentenyl-diphosphate Delta-isomerase 1 OS=Macaca fascicularis GN=IDI1 PE=2 SV=2 Back     alignment and function description
>sp|Q13907|IDI1_HUMAN Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens GN=IDI1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
74027234296 isopentenyl diphosphate isomerase [Ipomo 0.937 0.709 0.729 1e-83
6225532309 RecName: Full=Isopentenyl-diphosphate De 0.816 0.592 0.764 7e-82
79514626291 Isopentenyl-diphosphate Delta-isomerase 0.799 0.615 0.801 4e-81
78191045292 isopentenyl pyrophosphate isomerase [Nic 0.794 0.609 0.806 4e-81
1213442262 isopentenyl pyrophosphate isomerase [Ara 0.799 0.683 0.801 6e-81
297807669289 isopentenyl pyrophosphate isomerase [Ara 0.803 0.622 0.809 7e-81
35186998301 isopentenyl pyrophosphate isomerase [Pue 0.767 0.571 0.814 2e-80
13603406290 isopentenyl diphosphate isomerase 1 [Nic 0.767 0.593 0.835 3e-80
157072591305 isopentenyl pyrophosphate isomerase [Sal 0.812 0.596 0.777 3e-80
363807460301 uncharacterized protein LOC100789313 [Gl 0.767 0.571 0.814 3e-80
>gi|74027234|gb|AAZ94730.1| isopentenyl diphosphate isomerase [Ipomoea batatas] Back     alignment and taxonomy information
 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 159/218 (72%), Positives = 173/218 (79%), Gaps = 8/218 (3%)

Query: 10  ATTKLC---SSLINNSSSFSKSRLFFSSSHFAPRVSSIRRPLSLRGASRSSSSSSSARAI 66
           A+ ++C   S L+   + +S +  F S   FA    SI  P+ LR      +S  S RA 
Sbjct: 5   ASVQICRRFSPLVARPAIYSANSSFLSPVSFASSSLSIM-PIRLR----CRASVHSVRAA 59

Query: 67  STMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFS 126
           STMGD  TDA MDAVQRRLMF+DECILVDENDRVVGH+ KYNCHLMEKIES NLLHRAFS
Sbjct: 60  STMGDTITDANMDAVQRRLMFDDECILVDENDRVVGHDTKYNCHLMEKIESENLLHRAFS 119

Query: 127 VFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDE 186
           VFLFNS YELLLQQRS TKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDE
Sbjct: 120 VFLFNSNYELLLQQRSATKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDE 179

Query: 187 LGICAEDVPVDEFTPLGRILYKAPSDGKWGEHERNVFI 224
           LGI AEDVPVDEFT LGRILYKAPSDG+WGEHE +  +
Sbjct: 180 LGIPAEDVPVDEFTTLGRILYKAPSDGRWGEHELDYLL 217




Source: Ipomoea batatas

Species: Ipomoea batatas

Genus: Ipomoea

Family: Convolvulaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|6225532|sp|O48965.1|IDI2_CAMAC RecName: Full=Isopentenyl-diphosphate Delta-isomerase II; AltName: Full=Isopentenyl pyrophosphate isomerase II; Short=IPP isomerase II gi|2736288|gb|AAB94133.1| isopentenyl diphosphate isomerase II [Camptotheca acuminata] Back     alignment and taxonomy information
>gi|79514626|ref|NP_197148.3| Isopentenyl-diphosphate Delta-isomerase I [Arabidopsis thaliana] gi|334302895|sp|Q38929.3|IDI1_ARATH RecName: Full=Isopentenyl-diphosphate Delta-isomerase I, chloroplastic; AltName: Full=Isopentenyl pyrophosphate isomerase I; Short=IPP isomerase I; Flags: Precursor gi|9759126|dbj|BAB09611.1| isopentenyl pyrophosphate:dimethyllallyl pyrophosphate isomerase [Arabidopsis thaliana] gi|332004909|gb|AED92292.1| Isopentenyl-diphosphate Delta-isomerase I [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|78191045|gb|ABB29847.1| isopentenyl pyrophosphate isomerase [Nicotiana langsdorffii x Nicotiana sanderae] Back     alignment and taxonomy information
>gi|1213442|gb|AAB67741.1| isopentenyl pyrophosphate isomerase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297807669|ref|XP_002871718.1| isopentenyl pyrophosphate isomerase [Arabidopsis lyrata subsp. lyrata] gi|297317555|gb|EFH47977.1| isopentenyl pyrophosphate isomerase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|35186998|gb|AAQ84167.1| isopentenyl pyrophosphate isomerase [Pueraria montana var. lobata] Back     alignment and taxonomy information
>gi|13603406|dbj|BAB40973.1| isopentenyl diphosphate isomerase 1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|157072591|gb|ABV08818.1| isopentenyl pyrophosphate isomerase [Salvia miltiorrhiza] Back     alignment and taxonomy information
>gi|363807460|ref|NP_001242135.1| uncharacterized protein LOC100789313 [Glycine max] gi|255647098|gb|ACU24017.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
TAIR|locus:2171382291 IPP1 "isopentenyl diphosphate 0.674 0.518 0.914 3.2e-72
TAIR|locus:2075412284 IPP2 "isopentenyl pyrophosphat 0.656 0.517 0.918 1.8e-71
UNIPROTKB|Q1LZ95227 IDI1 "Isopentenyl-diphosphate 0.660 0.651 0.615 2e-40
UNIPROTKB|I3LDY2287 LOC100739304 "Uncharacterized 0.665 0.519 0.592 6.8e-40
UNIPROTKB|Q13907227 IDI1 "Isopentenyl-diphosphate 0.625 0.616 0.619 1.4e-39
UNIPROTKB|G4MT46254 MGG_07125 "Isopentenyl-diphosp 0.660 0.582 0.587 3.7e-39
ZFIN|ZDB-GENE-050913-44278 idi1 "isopentenyl-diphosphate 0.683 0.550 0.564 6.1e-39
UNIPROTKB|F1NZX3233 IDI1 "Uncharacterized protein" 0.665 0.639 0.572 4.3e-38
ASPGD|ASPL0000061206268 AN0579 [Emericella nidulans (t 0.633 0.529 0.564 7e-38
MGI|MGI:2442264227 Idi1 "isopentenyl-diphosphate 0.625 0.616 0.577 1.9e-37
TAIR|locus:2171382 IPP1 "isopentenyl diphosphate isomerase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 730 (262.0 bits), Expect = 3.2e-72, P = 3.2e-72
 Identities = 139/152 (91%), Positives = 143/152 (94%)

Query:    68 TMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSV 127
             TM D+  DAGMDAVQRRLMFEDECILVDENDRVVGH+ KYNCHLMEKIE+ NLLHRAFSV
Sbjct:    58 TMTDSN-DAGMDAVQRRLMFEDECILVDENDRVVGHDTKYNCHLMEKIEAENLLHRAFSV 116

Query:   128 FLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDEL 187
             FLFNSKYELLLQQRS TKVTFPLVWTNTCCSHPLYRESELIEEN LGVRNAAQRKL DEL
Sbjct:   117 FLFNSKYELLLQQRSKTKVTFPLVWTNTCCSHPLYRESELIEENVLGVRNAAQRKLFDEL 176

Query:   188 GICAEDVPVDEFTPLGRILYKAPSDGKWGEHE 219
             GI AEDVPVDEFTPLGR+LYKAPSDGKWGEHE
Sbjct:   177 GIVAEDVPVDEFTPLGRMLYKAPSDGKWGEHE 208




GO:0004452 "isopentenyl-diphosphate delta-isomerase activity" evidence=IEA;IDA;IMP
GO:0008299 "isoprenoid biosynthetic process" evidence=IEA;TAS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0009240 "isopentenyl diphosphate biosynthetic process" evidence=IMP
GO:0009536 "plastid" evidence=IDA
GO:0015995 "chlorophyll biosynthetic process" evidence=TAS
TAIR|locus:2075412 IPP2 "isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZ95 IDI1 "Isopentenyl-diphosphate Delta-isomerase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDY2 LOC100739304 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q13907 IDI1 "Isopentenyl-diphosphate Delta-isomerase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G4MT46 MGG_07125 "Isopentenyl-diphosphate Delta-isomerase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-44 idi1 "isopentenyl-diphosphate delta isomerase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZX3 IDI1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061206 AN0579 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
MGI|MGI:2442264 Idi1 "isopentenyl-diphosphate delta isomerase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q39471IDI2_CLABR5, ., 3, ., 3, ., 20.78190.79010.6188N/Ano
Q39472IDI1_CLABR5, ., 3, ., 3, ., 20.79770.78120.6097N/Ano
Q5R8R6IDI1_PONAB5, ., 3, ., 3, ., 20.59600.66070.6519yesno
Q38929IDI1_ARATH5, ., 3, ., 3, ., 20.80100.79910.6151yesno
Q39664IDI2_CLAXA5, ., 3, ., 3, ., 20.71420.90170.6965N/Ano
Q10132IDI1_SCHPO5, ., 3, ., 3, ., 20.53240.66510.6506yesno
O48964IDI1_CAMAC5, ., 3, ., 3, ., 20.88460.69640.6638N/Ano
O35760IDI1_RAT5, ., 3, ., 3, ., 20.56250.63390.6255yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.20.946
3rd Layer5.3.30.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
PLN02552247 PLN02552, PLN02552, isopentenyl-diphosphate delta- 1e-107
cd02885165 cd02885, IPP_Isomerase, Isopentenyl diphosphate (I 4e-61
TIGR02150158 TIGR02150, IPP_isom_1, isopentenyl-diphosphate del 3e-52
COG1443185 COG1443, Idi, Isopentenyldiphosphate isomerase [Li 4e-45
PRK03759184 PRK03759, PRK03759, isopentenyl-diphosphate delta- 3e-26
cd04692144 cd04692, Nudix_Hydrolase_33, Members of the Nudix 2e-11
pfam00293133 pfam00293, NUDIX, NUDIX domain 4e-10
cd04697126 cd04697, Nudix_Hydrolase_38, Members of the Nudix 4e-09
cd04693127 cd04693, Nudix_Hydrolase_34, Members of the Nudix 7e-08
PLN02791 770 PLN02791, PLN02791, Nudix hydrolase homolog 4e-05
PRK15393180 PRK15393, PRK15393, NUDIX hydrolase YfcD; Provisio 2e-04
>gnl|CDD|215303 PLN02552, PLN02552, isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
 Score =  307 bits (787), Expect = e-107
 Identities = 123/167 (73%), Positives = 130/167 (77%), Gaps = 14/167 (8%)

Query: 67  STMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFS 126
                  T AGMDAVQRRLMFEDECILVDEND VVGH++KYNCHL EKIE   LLHRAFS
Sbjct: 1   MGTMADATWAGMDAVQRRLMFEDECILVDENDNVVGHDSKYNCHLFEKIEPRGLLHRAFS 60

Query: 127 VFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLY--------RESELIEENALGVRNA 178
           VFLFNSKYELLLQQR+ TKVTFPLVWTNTCCSHPLY        RESELI+ N LGV+NA
Sbjct: 61  VFLFNSKYELLLQQRAATKVTFPLVWTNTCCSHPLYGQDPNEVDRESELIDGNVLGVKNA 120

Query: 179 AQRKLLDELGICAEDVPVDEFTPLGRILYKAPSD------GKWGEHE 219
           AQRKLL ELGI AEDVPVD+FT L R+ YKA  D      GKWGEHE
Sbjct: 121 AQRKLLHELGIPAEDVPVDQFTFLTRLHYKAADDVTHGPDGKWGEHE 167


Length = 247

>gnl|CDD|239218 cd02885, IPP_Isomerase, Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>gnl|CDD|233749 TIGR02150, IPP_isom_1, isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>gnl|CDD|224360 COG1443, Idi, Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235156 PRK03759, PRK03759, isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>gnl|CDD|240048 cd04692, Nudix_Hydrolase_33, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|240053 cd04697, Nudix_Hydrolase_38, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240049 cd04693, Nudix_Hydrolase_34, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|215425 PLN02791, PLN02791, Nudix hydrolase homolog Back     alignment and domain information
>gnl|CDD|185291 PRK15393, PRK15393, NUDIX hydrolase YfcD; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 224
KOG0142225 consensus Isopentenyl pyrophosphate:dimethylallyl 100.0
PLN02552247 isopentenyl-diphosphate delta-isomerase 100.0
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 100.0
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 99.96
PLN02791 770 Nudix hydrolase homolog 99.96
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.95
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.95
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 99.94
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.92
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.85
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.75
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.72
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.68
PLN02839372 nudix hydrolase 99.66
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.64
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.62
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.6
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.58
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.52
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.52
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.51
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.51
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.51
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.5
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.5
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.48
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.47
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.47
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.47
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.47
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.47
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.46
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.45
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.45
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.45
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.44
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.43
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.42
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.42
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.41
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.4
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.4
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.39
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.39
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.39
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.39
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.39
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.37
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.35
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.35
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.33
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.31
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.3
PLN02325144 nudix hydrolase 99.3
KOG4313306 consensus Thiamine pyrophosphokinase [Nucleotide t 99.29
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.28
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.27
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.27
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.25
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.23
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.21
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.17
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.17
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.16
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.15
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.12
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.11
PRK10707190 putative NUDIX hydrolase; Provisional 99.08
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.01
PRK08999 312 hypothetical protein; Provisional 98.98
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 98.97
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 98.96
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 98.95
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 98.91
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 98.89
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 98.86
PLN02709222 nudix hydrolase 98.82
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 98.81
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 98.74
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 98.73
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 98.56
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 98.52
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 98.45
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 98.33
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 98.24
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 98.17
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 98.16
PLN03143291 nudix hydrolase; Provisional 98.05
KOG3069 246 consensus Peroxisomal NUDIX hydrolase [Replication 97.99
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 97.94
KOG0648295 consensus Predicted NUDIX hydrolase FGF-2 and rela 97.61
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 97.01
COG4112203 Predicted phosphoesterase (MutT family) [General f 96.32
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 96.2
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 96.13
KOG4195275 consensus Transient receptor potential-related cha 91.99
PF14443126 DBC1: DBC1 91.79
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 87.7
PRK10880350 adenine DNA glycosylase; Provisional 85.93
TIGR01084275 mutY A/G-specific adenine glycosylase. This equiva 82.15
>KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=3.2e-49  Score=340.19  Aligned_cols=153  Identities=66%  Similarity=1.020  Sum_probs=146.9

Q ss_pred             CCCcccccccHHHHHhhhcCeEEEEcCCCcEEEEEecccccchhhcccCCeeEEEEEEEEEeCCCeEEEEEecCCCCCCC
Q 027372           70 GDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFP  149 (224)
Q Consensus        70 ~~~~~~~~~d~~q~~lm~eE~~~vvD~~d~~iG~~~R~~~Hl~~~i~~~gllHra~sv~lfn~~g~lLLqqRs~~K~tfP  149 (224)
                      |.+..+++||+.|.++|.+ .|++||+||++||..+|+.||+|+++++ |++|||||||+||++|++||||||..|++||
T Consensus         2 ~~~~~~~~~d~~Q~~~l~e-~ci~VDenD~~IG~~tk~~cHl~eni~k-glLHRaFSVFlFns~~~lLlQqRS~~KitFP   79 (225)
T KOG0142|consen    2 MSETNLSGMDEQQVKLLAE-NCILVDENDNVIGAGTKKNCHLMENIEK-GLLHRAFSVFLFNSKNELLLQQRSDEKITFP   79 (225)
T ss_pred             CccccccccCHHHHHHHhh-heEeeccccccccchhhhhhhcchhHHh-hhhhheeeEEEecCcchHHHhhhcccccccc
Confidence            5678999999999999986 9999999999999999999999999976 8999999999999999999999999999999


Q ss_pred             CceeecCCccCCCCCChhhhhhhhcHHHHHHHHHHHHhCCCccCCCCCceeeeeEEEEEcccCCCeeeeeeeeeC
Q 027372          150 LVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHERNVFI  224 (224)
Q Consensus       150 G~Wd~t~gGh~~~gEs~~~~~~~~g~~~AA~REL~EElGI~~~~v~~~~l~~lgri~Y~a~~~~~wgEhEidyil  224 (224)
                      +.|+|+|||||++...++.+.+++|++.||+|.|+.||||+.+.++.++|+|+++|||++++++.||||||||||
T Consensus        80 ~~~TNtccSHPL~~~~el~~~d~lGVr~AAqRkL~~ELGIp~e~v~pee~~~ltrihYkA~sdg~wGEhEiDYiL  154 (225)
T KOG0142|consen   80 GLWTNTCCSHPLYNPGELEENDALGVRRAAQRKLKAELGIPLEEVPPEEFNFLTRIHYKAPSDGIWGEHEIDYIL  154 (225)
T ss_pred             chhhhhhhcCcCCChhhhccCchHHHHHHHHHHHHHhhCCCccccCHHHcccceeeeeecCCCCCcccceeeEEE
Confidence            999999999999877777788899999999999999999999999999999999999999999999999999996



>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF14443 DBC1: DBC1 Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>TIGR01084 mutY A/G-specific adenine glycosylase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
2i6k_A235 Crystal Structure Of Human Type I Ipp Isomerase Com 8e-42
2dho_A235 Crystal Structure Of Human Ipp Isomerase I In Space 1e-41
2icj_A233 The Crystal Structure Of Human Isopentenyl Diphopha 1e-41
2pny_A246 Structure Of Human Isopentenyl-Diphosphate Delta-Is 9e-37
3hyq_A184 Crystal Structure Of Isopentenyl-Diphosphate Delta- 3e-10
1x83_A189 Y104f Ipp Isomerase Reacted With (S)-Bromohydrine O 4e-09
2g73_A183 Y104f Mutant Type 1 Ipp Isomerase Complex With Eipp 4e-09
1r67_A190 Y104a Mutant Of E.coli Ipp Isomerase Length = 190 5e-09
1x84_A189 Ipp Isomerase (Wt) Reacted With (S)-Bromohydrine Of 5e-09
1nfs_A183 Structure And Mechanism Of Action Of Isopentenylpyr 5e-09
1hzt_A190 Crystal Structure Of Metal-Free Isopentenyl Diphosp 6e-09
1i9a_A182 Structural Studies Of Cholesterol Biosynthesis: Mev 9e-09
1q54_A183 Structure And Mechanism Of Action Of Isopentenylpyr 5e-08
1hx3_A190 Crystal Structure Of E.Coli Isopentenyl Diphosphate 5e-08
>pdb|2I6K|A Chain A, Crystal Structure Of Human Type I Ipp Isomerase Complexed With A Substrate Analog Length = 235 Back     alignment and structure

Iteration: 1

Score = 166 bits (421), Expect = 8e-42, Method: Compositional matrix adjust. Identities = 88/142 (61%), Positives = 103/142 (72%), Gaps = 2/142 (1%) Query: 78 MDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELL 137 +D Q +L+ E CIL+DEND +G E K NCHL E IE LLHRAFSVFLFN++ +LL Sbjct: 17 LDKQQVQLLAE-XCILIDENDNKIGAETKKNCHLNENIEK-GLLHRAFSVFLFNTENKLL 74 Query: 138 LQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVD 197 LQQRS K+TFP +TNTCCSHPL +EL E +ALGVR AAQR+L ELGI E+VP + Sbjct: 75 LQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPE 134 Query: 198 EFTPLGRILYKAPSDGKWGEHE 219 E L RI YKA SDG WGEHE Sbjct: 135 EINYLTRIHYKAQSDGIWGEHE 156
>pdb|2DHO|A Chain A, Crystal Structure Of Human Ipp Isomerase I In Space Group P212121 Length = 235 Back     alignment and structure
>pdb|2ICJ|A Chain A, The Crystal Structure Of Human Isopentenyl Diphophate Isomerase Length = 233 Back     alignment and structure
>pdb|2PNY|A Chain A, Structure Of Human Isopentenyl-Diphosphate Delta-Isomerase 2 Length = 246 Back     alignment and structure
>pdb|3HYQ|A Chain A, Crystal Structure Of Isopentenyl-Diphosphate Delta-Isomerase From Salmonella Entericase Length = 184 Back     alignment and structure
>pdb|1X83|A Chain A, Y104f Ipp Isomerase Reacted With (S)-Bromohydrine Of Ipp Length = 189 Back     alignment and structure
>pdb|2G73|A Chain A, Y104f Mutant Type 1 Ipp Isomerase Complex With Eipp Length = 183 Back     alignment and structure
>pdb|1R67|A Chain A, Y104a Mutant Of E.coli Ipp Isomerase Length = 190 Back     alignment and structure
>pdb|1X84|A Chain A, Ipp Isomerase (Wt) Reacted With (S)-Bromohydrine Of Ipp Length = 189 Back     alignment and structure
>pdb|1NFS|A Chain A, Structure And Mechanism Of Action Of Isopentenylpyrophosphate-dimethylallylpyrophosphate Isomerase: Complex With Nipp Length = 183 Back     alignment and structure
>pdb|1HZT|A Chain A, Crystal Structure Of Metal-Free Isopentenyl Diphosphate:dimethylallyl Diphosphate Isomerase Length = 190 Back     alignment and structure
>pdb|1I9A|A Chain A, Structural Studies Of Cholesterol Biosynthesis: Mevalonate 5-Diphosphate Decarboxylase And Isopentenyl Diphosphate Isomerase Length = 182 Back     alignment and structure
>pdb|1Q54|A Chain A, Structure And Mechanism Of Action Of Isopentenylpyrophosphate-Dimethylallylpyrophosphate Isomerase: Complex With The Bromohydrine Of Ipp Length = 183 Back     alignment and structure
>pdb|1HX3|A Chain A, Crystal Structure Of E.Coli Isopentenyl Diphosphate:dimethylallyl Diphosphate Isomerase Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 1e-56
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 2e-55
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 1e-49
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 2e-44
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 2e-39
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 2e-05
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Length = 235 Back     alignment and structure
 Score =  178 bits (453), Expect = 1e-56
 Identities = 90/152 (59%), Positives = 107/152 (70%), Gaps = 3/152 (1%)

Query: 68  TMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSV 127
            M +  T+  +D  Q +L+ E  CIL+DEND  +G E K NCHL E IE   LLHRAFSV
Sbjct: 8   HMPEINTN-HLDKQQVQLLAE-MCILIDENDNKIGAETKKNCHLNENIEK-GLLHRAFSV 64

Query: 128 FLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDEL 187
           FLFN++ +LLLQQRS  K+TFP  +TNTCCSHPL   +EL E +ALGVR AAQR+L  EL
Sbjct: 65  FLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAEL 124

Query: 188 GICAEDVPVDEFTPLGRILYKAPSDGKWGEHE 219
           GI  E+VP +E   L RI YKA SDG WGEHE
Sbjct: 125 GIPLEEVPPEEINYLTRIHYKAQSDGIWGEHE 156


>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Length = 246 Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Length = 300 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 100.0
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 100.0
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 99.94
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.92
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.9
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.85
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.65
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.59
3grn_A153 MUTT related protein; structural genomics, hydrola 99.58
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.54
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.53
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.53
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.5
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.49
3exq_A161 Nudix family hydrolase; protein structure initiati 99.49
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.48
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.48
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.47
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.47
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.46
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.46
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.45
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.45
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.45
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.44
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.42
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.42
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.42
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.41
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.41
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.41
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.41
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.4
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.39
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.37
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.37
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.37
3fk9_A 188 Mutator MUTT protein; structural genomics, hydrola 99.36
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.35
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.34
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.34
3e57_A211 Uncharacterized protein TM1382; structural genomic 99.33
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.32
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.3
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.3
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.28
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.28
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.27
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.27
2fb1_A 226 Conserved hypothetical protein; structural genomic 99.26
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.26
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.24
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.23
3gz5_A 240 MUTT/nudix family protein; DNA binding protein, nu 99.23
3f13_A163 Putative nudix hydrolase family member; structural 99.23
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 99.23
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.22
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.2
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.17
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.14
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.14
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.13
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.1
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.1
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.09
2fml_A 273 MUTT/nudix family protein; structural genomics, PS 99.08
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.06
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 99.02
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 98.97
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 98.97
3qsj_A 232 Nudix hydrolase; structural genomics, PSI-biology, 98.94
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 98.81
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 98.76
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 98.74
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 98.43
3bho_A208 Cleavage and polyadenylation specificity factor su 98.09
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 97.46
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.6e-37  Score=271.37  Aligned_cols=155  Identities=48%  Similarity=0.701  Sum_probs=135.0

Q ss_pred             ccCCCcccccccHHHHHhhhcCeEEEEcCCCcEEEEEecccccchhhcccCCeeEEEEEEEEEeCCCeEEEEEecCCCCC
Q 027372           68 TMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVT  147 (224)
Q Consensus        68 ~~~~~~~~~~~d~~q~~lm~eE~~~vvD~~d~~iG~~~R~~~Hl~~~i~~~gllHra~sv~lfn~~g~lLLqqRs~~K~t  147 (224)
                      ..|++...+|||+.|+++| +|.|+|||++|+++|.++|+.||+++++ ++|++|++|+|+|+|++|+||||||+..|.+
T Consensus        18 ~~~~~~~~~~~~~~q~~~~-~E~~~lvd~~~~~iG~~~r~~~h~~~~~-~~g~~h~av~v~v~~~~g~lLLqrRs~~K~~   95 (246)
T 2pny_A           18 GSMSDINLDWVDRRQLQRL-EEMLIVVDENDKVIGADTKRNCHLNENI-EKGLLHRAFSVVLFNTKNRILIQQRSDTKVT   95 (246)
T ss_dssp             SCGGGGCCTTSCHHHHHHT-TCEEEEECTTCCEEEEEEHHHHTBHHHH-TTTCCEEEEEEEEECTTCCEEEEEECTTCSS
T ss_pred             ccccccccccCCHHHHhhc-cceEEEEcCCCCEEEEEEhHHhcccccc-CCCcEEEEEEEEEEeCCCEEEEEEecCCCCC
Confidence            4566778999999999988 5799999999999999999999988777 4599999999999999999999999999999


Q ss_pred             CCCceeecCCccCCCCCChhhhhhhhcHHHHHHHHHHHHhCCCccCCCCCceeeeeEEEEEcccCCCeeeeeeeeeC
Q 027372          148 FPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHERNVFI  224 (224)
Q Consensus       148 fPG~Wd~t~gGh~~~gEs~~~~~~~~g~~~AA~REL~EElGI~~~~v~~~~l~~lgri~Y~a~~~~~wgEhEidyil  224 (224)
                      |||+|+++||||+++||++..++..+|+.+||+|||+|||||++..++.+++.++++++|.++.+++|++||++|+|
T Consensus        96 ~pG~W~~p~gG~v~~G~~E~~~Et~~~~~eAA~REl~EElGi~~~~v~~~~l~~l~~~~y~~~~~~~~~~~e~~~vf  172 (246)
T 2pny_A           96 FPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLL  172 (246)
T ss_dssp             STTCBCCSEEECCBSSHHHHCCGGGHHHHHHHHHHHHHHHCCCTTTCCGGGSEEEEEEEEEEESSSSBEEEEEEEEE
T ss_pred             CCCceEeccCceeccCCcccccccchhHHHHHHHHHHHHHCCCccccCccccEEEEEEEEEecCCCceeeeEEEEEE
Confidence            99999999999999993211111123348999999999999998766666789999999999988889999999985



>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 224
d2fkba1161 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Esc 7e-16
d1hzta_153 d.113.1.2 (A:) Isopentenyl diphosphate isomerase { 9e-14
d2o5fa1162 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D 3e-13
d1sjya_158 d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc 1e-04
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: IPP isomerase-like
domain: Hypothetical protein YfcD
species: Escherichia coli [TaxId: 562]
 Score = 70.2 bits (171), Expect = 7e-16
 Identities = 25/125 (20%), Positives = 48/125 (38%), Gaps = 20/125 (16%)

Query: 92  ILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLV 151
            +V+E + V+   ++             L HRA  + + +   ++L+Q+R+ TK   P +
Sbjct: 6   DIVNEENEVIAQASREQMRA------QCLRHRATYIVVHDGMGKILVQRRTETKDFLPGM 59

Query: 152 WTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPS 211
              T        E             +A+R+  +ELGI         F   G+  ++  +
Sbjct: 60  LDATAGGVVQADEQL---------LESARREAEEELGIAGVP-----FAEHGQFYFEDKN 105

Query: 212 DGKWG 216
              WG
Sbjct: 106 CRVWG 110


>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.95
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.94
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.9
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.64
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.6
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.53
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.53
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.52
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.46
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.4
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.38
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.37
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.36
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.34
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.31
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.26
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.25
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.23
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.22
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.22
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.16
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 99.1
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 98.97
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 98.89
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 98.89
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 98.82
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 98.57
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 98.39
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 98.21
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 98.17
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: IPP isomerase-like
domain: Hypothetical protein YfcD
species: Escherichia coli [TaxId: 562]
Probab=99.95  E-value=6.4e-28  Score=194.14  Aligned_cols=104  Identities=22%  Similarity=0.317  Sum_probs=94.4

Q ss_pred             cCeEEEEcCCCcEEEEEecccccchhhcccCCeeEEEEEEEEEeCCCeEEEEEecCCCCCCCCceeecCCccCCCCCChh
Q 027372           88 EDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESEL  167 (224)
Q Consensus        88 eE~~~vvD~~d~~iG~~~R~~~Hl~~~i~~~gllHra~sv~lfn~~g~lLLqqRs~~K~tfPG~Wd~t~gGh~~~gEs~~  167 (224)
                      .|.++|||++|+++|..+|..+|.      .|++|++++|+|+|++|++|||||+..|.+|||+|++++|||+++||+  
T Consensus         2 ~E~~~i~d~~~~~ig~~~R~~~~~------~~~~h~~v~v~v~~~~g~vLl~rR~~~~~~~pg~w~~~~GG~ie~gEs--   73 (161)
T d2fkba1           2 TEWVDIVNEENEVIAQASREQMRA------QCLRHRATYIVVHDGMGKILVQRRTETKDFLPGMLDATAGGVVQADEQ--   73 (161)
T ss_dssp             CCEEEEECTTSCEEEEEEHHHHHH------HTCCEEEEEEEEECSSSCEEEEEECSSCSSSTTCEESSBCCBCBTTCC--
T ss_pred             cEEEEEECCCCCEEeEEEHHHhhc------CCCcEeEEEEEEEeCCCCEEEEEecCccccccccccccccccccccCc--
Confidence            479999999999999999999885      599999999999999999999999999999999999999999999999  


Q ss_pred             hhhhhhcHHHHHHHHHHHHhCCCccCCCCCceeeeeEEEEEccc
Q 027372          168 IEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPS  211 (224)
Q Consensus       168 ~~~~~~g~~~AA~REL~EElGI~~~~v~~~~l~~lgri~Y~a~~  211 (224)
                             +.+||+||++|||||...     .+.+++.+.|..+.
T Consensus        74 -------~~~aa~REl~EE~Gi~~~-----~~~~~~~~~~~~~~  105 (161)
T d2fkba1          74 -------LLESARREAEEELGIAGV-----PFAEHGQFYFEDKN  105 (161)
T ss_dssp             -------HHHHHHHHHHHHHCCBSC-----CCEEEEEEEEEETT
T ss_pred             -------HHHHHHHHHHHHhCCccc-----eeEEEEEEEeecCC
Confidence                   799999999999999864     35677777776543



>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure