Citrus Sinensis ID: 027409


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MKLVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSEVIVRQAEEVMGELKGVDFLVVDCTSKDFARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPVGQGLDIVHVGSTSGSGSGESMNKNHSRWIKHVDQKSGEEHFFRGKF
ccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHcccEEEEEEccHHHHHcccccccEEEEEcccccHHHHHHHcccccccEEEEEEccccccccccccccccEEccccccEEEEEEEccccEEEEEEEEcccccccccccccccccEEEEccccccEEEEEEcc
ccEEEcHHHHHHHHHHHHHHcHccccccHHHHHHHHHHccccHEEEEEEccccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHccccEEEEEccHHHHHHHHHHHccccccEEEEEEcccccccccEEEEEcEEEEcccEEEEEEEEEccccEEEEEEEEcccccccccccccccEEEEEEEcccccEEEEEEEc
mklvwspdaaskAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWthggpittSIGLAIAARHTCARhvcivpderSRLAYVKAMYDVVGWVSEVIVRQAEEVMGELKGVDFLVVDCTSKDFARVLRFARFSNKGAVLAFKNAFQRStsglrwqgqgvldrgtrVVRSVFlpvgqgldivhvgstsgsgsgesmnkNHSRWIKhvdqksgeehffrgkf
mklvwspdaaskayiDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSEVIVRQAEEVMGELKGVDFLVVDCTSKDFARVLRFARFSNKGAVLAFKNAfqrstsglrwqgqgvldRGTRVVRSVFLPVGQGLDIVHVGstsgsgsgesMNKNHSRWIkhvdqksgeehffrgkf
MKLVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSEVIVRQAEEVMGELKGVDFLVVDCTSKDFARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPVGQGLDIVHVgstsgsgsgesMNKNHSRWIKHVDQKSGEEHFFRGKF
***********KAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSEVIVRQAEEVMGELKGVDFLVVDCTSKDFARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPVGQGLDIVHV*************************************
**LVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSEVIVRQAEEVMGELKGVDFLVVDCTSKDFARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPVGQGLDIV*********************IKHVDQKSGEEHFFRGKF
MKLVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSEVIVRQAEEVMGELKGVDFLVVDCTSKDFARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPVGQGLDIVHVGS************NHSRWIKHVDQK***********
*KLVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSEVIVRQAEEVMGELKGVDFLVVDCTSKDFARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPVGQGLDIVHVGSTSG**********HSRWIKHVDQKSGEEHFFRGKF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSEVIVRQAEEVMGELKGVDFLVVDCTSKDFARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPVGQGLDIVHVGSTSGSGSGESMNKNHSRWIKHVDQKSGEEHFFRGKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
255541292223 conserved hypothetical protein [Ricinus 0.982 0.982 0.662 3e-79
224063798216 predicted protein [Populus trichocarpa] 0.964 0.995 0.659 2e-77
225453945216 PREDICTED: uncharacterized protein LOC10 0.968 1.0 0.651 4e-76
224127378216 predicted protein [Populus trichocarpa] 0.968 1.0 0.669 2e-74
224160951216 predicted protein [Populus trichocarpa] 0.968 1.0 0.669 3e-74
15225459215 uncharacterized protein [Arabidopsis tha 0.959 0.995 0.65 7e-70
356496376223 PREDICTED: uncharacterized protein LOC10 0.973 0.973 0.635 5e-69
255537091215 conserved hypothetical protein [Ricinus 0.955 0.990 0.638 2e-68
297824587221 hypothetical protein ARALYDRAFT_483673 [ 0.973 0.981 0.627 1e-67
449526126217 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.964 0.990 0.619 1e-67
>gi|255541292|ref|XP_002511710.1| conserved hypothetical protein [Ricinus communis] gi|223548890|gb|EEF50379.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 177/225 (78%), Gaps = 6/225 (2%)

Query: 1   MKLVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIG 60
           MKLVWSPD A K+YI TVKSC+N+KESGV ELLSAMAAGWNAK+IVE+W++G PI TSIG
Sbjct: 1   MKLVWSPDTALKSYIYTVKSCKNLKESGVPELLSAMAAGWNAKMIVESWSYGNPIATSIG 60

Query: 61  LAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSE---VIVRQAEEVMGELKGVDFL 117
           LA+AA HTC RHVC+VPDERSR  Y+KA+    G   E   +IV +AEE +  L GVDF+
Sbjct: 61  LAVAATHTCGRHVCLVPDERSRAEYLKAIRSSAGMAIETEVIIVGEAEEAVAGLVGVDFM 120

Query: 118 VVDCTSKDFARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPV 177
           VVDC  ++F RVLRFA+ SNKGAVL  KNA+Q   +G RW   GVL+RGTRVVRSVFLPV
Sbjct: 121 VVDCKRREFIRVLRFAKLSNKGAVLVRKNAYQSCFTGFRW--HGVLERGTRVVRSVFLPV 178

Query: 178 GQGLDIVHVGSTSGSGSG-ESMNKNHSRWIKHVDQKSGEEHFFRG 221
           G GLDI H+GST+ + +G  S+ ++ SRWIK VDQKSGEEH FRG
Sbjct: 179 GNGLDIAHIGSTTTTIAGAASLKRSSSRWIKCVDQKSGEEHVFRG 223




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224063798|ref|XP_002301283.1| predicted protein [Populus trichocarpa] gi|222843009|gb|EEE80556.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225453945|ref|XP_002273878.1| PREDICTED: uncharacterized protein LOC100245353 [Vitis vinifera] gi|296089168|emb|CBI38871.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127378|ref|XP_002320059.1| predicted protein [Populus trichocarpa] gi|222860832|gb|EEE98374.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224160951|ref|XP_002338274.1| predicted protein [Populus trichocarpa] gi|222871592|gb|EEF08723.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15225459|ref|NP_182061.1| uncharacterized protein [Arabidopsis thaliana] gi|2583118|gb|AAB82627.1| hypothetical protein [Arabidopsis thaliana] gi|26451827|dbj|BAC43006.1| unknown protein [Arabidopsis thaliana] gi|28950747|gb|AAO63297.1| At2g45360 [Arabidopsis thaliana] gi|330255449|gb|AEC10543.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356496376|ref|XP_003517044.1| PREDICTED: uncharacterized protein LOC100791746 [Glycine max] Back     alignment and taxonomy information
>gi|255537091|ref|XP_002509612.1| conserved hypothetical protein [Ricinus communis] gi|223549511|gb|EEF50999.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297824587|ref|XP_002880176.1| hypothetical protein ARALYDRAFT_483673 [Arabidopsis lyrata subsp. lyrata] gi|297326015|gb|EFH56435.1| hypothetical protein ARALYDRAFT_483673 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449526126|ref|XP_004170065.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101214121 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
TAIR|locus:2050842215 AT2G45360 "AT2G45360" [Arabido 0.946 0.981 0.627 2e-65
TAIR|locus:2101911218 AT3G60780 "AT3G60780" [Arabido 0.964 0.986 0.558 3.2e-58
TAIR|locus:2026202224 AT1G62840 "AT1G62840" [Arabido 0.968 0.964 0.515 3.5e-52
TAIR|locus:2034645212 AT1G12320 "AT1G12320" [Arabido 0.923 0.971 0.479 5.4e-47
TAIR|locus:2167913236 AT5G62280 "AT5G62280" [Arabido 0.919 0.868 0.280 3e-14
TAIR|locus:2050842 AT2G45360 "AT2G45360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 666 (239.5 bits), Expect = 2.0e-65, P = 2.0e-65
 Identities = 140/223 (62%), Positives = 159/223 (71%)

Query:     1 MKLVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIG 60
             MKLVWSP+ AS AYIDTVKSC++ KESGVAE LSA AAGWNA+LIVE W+ G PITTS+G
Sbjct:     1 MKLVWSPETASDAYIDTVKSCKSDKESGVAEFLSATAAGWNARLIVETWSRGDPITTSVG 60

Query:    61 LAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWVSEVIV--RQAEEVMGELKGVDFLV 118
             LA+AA HT  RHVCIVPDE+S+L YV AM   V   +EV+V     E  M E  GVDFLV
Sbjct:    61 LAVAATHTGGRHVCIVPDEQSKLEYVLAMRGFV--TTEVVVVGESVENTMEEFPGVDFLV 118

Query:   119 VDCTSKDFARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPVG 178
             VD   ++F R LRFA+ SNKGAVL  KNA  R+ SG +W    VL RGTRVVRSVFLPVG
Sbjct:   119 VDSKRREFVRTLRFAKLSNKGAVLVCKNAMHRAISGFKWHD--VLKRGTRVVRSVFLPVG 176

Query:   179 QGLDIVHVXXXXXXXXXXXMNKN-HSRWIKHVDQKSGEEHFFR 220
              GLDIVHV            ++N  SRWI+HVD  SGEEH FR
Sbjct:   177 SGLDIVHVGATGRGD-----SRNLRSRWIRHVDHLSGEEHLFR 214




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2101911 AT3G60780 "AT3G60780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026202 AT1G62840 "AT1G62840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034645 AT1G12320 "AT1G12320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167913 AT5G62280 "AT5G62280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00021356
hypothetical protein (216 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
pfam07279218 pfam07279, DUF1442, Protein of unknown function (D 1e-104
>gnl|CDD|115904 pfam07279, DUF1442, Protein of unknown function (DUF1442) Back     alignment and domain information
 Score =  299 bits (766), Expect = e-104
 Identities = 130/223 (58%), Positives = 159/223 (71%), Gaps = 9/223 (4%)

Query: 1   MKLVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIG 60
           MKLVWSP+ ASKAYIDTVKSCEN+   G AELL+AMAAGWNA+LIVE W+ G PI TS+G
Sbjct: 1   MKLVWSPETASKAYIDTVKSCENLGTPGAAELLAAMAAGWNARLIVETWSEGDPIATSVG 60

Query: 61  LAIAARHTCARHVCIVPDERSRLAYVKAMYD-VVGWVSEVIV-RQAEEVMGELKGVDFLV 118
           L +A+RHT  RH+CIVP+ERS+ AY++AM +     + E IV  + E  M  L+GVDFLV
Sbjct: 61  LNVASRHTNGRHICIVPNERSQSAYLQAMREQSTSNLPETIVGEELEHTMETLQGVDFLV 120

Query: 119 VDCTSKDF-ARVLRFARFSNKGAVLAFKNAFQRSTSGLRWQGQGVLDRGTRVVRSVFLPV 177
           VD   K+F A  LR A+F N+GAV+  +N ++RS SG  W     + R  RVVR+V LPV
Sbjct: 121 VDWKRKEFAANALRNAKFGNRGAVVVCRNGYRRSISGFSWTK---VLRDRRVVRTVTLPV 177

Query: 178 GQGLDIVHVGSTSGSGSGESMNKNHSRWIKHVDQKSGEEHFFR 220
           G GL+I HV +    GSG S N N  RWIKHVDQ+SGEEH FR
Sbjct: 178 GGGLEIAHVAAA---GSGGSSNNNKRRWIKHVDQRSGEEHVFR 217


This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length. The function of this family is unknown. Length = 218

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 100.0
COG4122219 Predicted O-methyltransferase [General function pr 100.0
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 100.0
PLN02589247 caffeoyl-CoA O-methyltransferase 100.0
PLN02476278 O-methyltransferase 100.0
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 100.0
KOG1663237 consensus O-methyltransferase [Secondary metabolit 100.0
PLN03075296 nicotianamine synthase; Provisional 99.73
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.64
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 99.62
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.61
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.59
PRK04457262 spermidine synthase; Provisional 99.58
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.57
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.54
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.53
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.53
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.52
PRK07402196 precorrin-6B methylase; Provisional 99.52
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.52
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.49
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.48
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.47
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.45
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.42
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.4
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 99.36
PRK01581374 speE spermidine synthase; Validated 99.35
PLN02366308 spermidine synthase 99.35
PRK00811283 spermidine synthase; Provisional 99.35
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.29
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.29
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.28
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.28
PRK14902444 16S rRNA methyltransferase B; Provisional 99.27
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.26
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.26
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.24
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.23
PLN02823336 spermine synthase 99.22
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.2
PRK14903431 16S rRNA methyltransferase B; Provisional 99.2
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.19
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.19
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.18
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 99.18
PRK14904445 16S rRNA methyltransferase B; Provisional 99.16
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.15
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.15
PRK14901434 16S rRNA methyltransferase B; Provisional 99.13
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.12
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.12
PRK10901427 16S rRNA methyltransferase B; Provisional 99.11
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.11
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.1
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.08
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.07
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.06
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.05
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.05
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.04
PLN02244340 tocopherol O-methyltransferase 99.04
PRK03612521 spermidine synthase; Provisional 99.02
PRK11207197 tellurite resistance protein TehB; Provisional 99.01
PRK14967223 putative methyltransferase; Provisional 99.0
PRK14968188 putative methyltransferase; Provisional 99.0
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.0
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.0
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.99
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.97
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.97
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.96
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.96
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.95
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.94
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.94
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.94
PRK04266226 fibrillarin; Provisional 98.93
PLN02233261 ubiquinone biosynthesis methyltransferase 98.93
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.93
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.92
PRK12335287 tellurite resistance protein TehB; Provisional 98.92
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.9
COG0421282 SpeE Spermidine synthase [Amino acid transport and 98.89
PRK08317241 hypothetical protein; Provisional 98.89
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.89
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.89
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.89
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.88
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.87
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.86
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.85
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.85
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.84
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.84
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.83
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.83
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.82
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.81
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.8
COG4123248 Predicted O-methyltransferase [General function pr 98.79
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.77
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.77
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.74
PLN02336475 phosphoethanolamine N-methyltransferase 98.74
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.72
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 98.71
PRK06922677 hypothetical protein; Provisional 98.71
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.7
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.7
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.7
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.68
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.67
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.66
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.65
TIGR03438301 probable methyltransferase. This model represents 98.63
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.63
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.62
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.61
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.59
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.56
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.56
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.56
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.55
COG2890280 HemK Methylase of polypeptide chain release factor 98.54
PRK06202232 hypothetical protein; Provisional 98.54
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.52
PLN02336 475 phosphoethanolamine N-methyltransferase 98.51
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.5
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.48
PTZ00146293 fibrillarin; Provisional 98.47
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.46
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.45
KOG2904328 consensus Predicted methyltransferase [General fun 98.44
PLN02490340 MPBQ/MSBQ methyltransferase 98.43
COG2521287 Predicted archaeal methyltransferase [General func 98.42
TIGR00452314 methyltransferase, putative. Known examples to dat 98.42
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 98.4
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.38
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 98.37
KOG4300252 consensus Predicted methyltransferase [General fun 98.37
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.37
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.37
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.36
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.34
TIGR00438188 rrmJ cell division protein FtsJ. 98.34
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.31
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.31
COG4106257 Tam Trans-aconitate methyltransferase [General fun 98.29
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.27
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.25
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.24
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.23
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 98.22
PHA03412241 putative methyltransferase; Provisional 98.18
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.18
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.17
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.16
PRK05785226 hypothetical protein; Provisional 98.16
PRK00536262 speE spermidine synthase; Provisional 98.16
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.08
PLN02672 1082 methionine S-methyltransferase 98.07
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.05
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.05
PHA03411279 putative methyltransferase; Provisional 98.03
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.03
PF05711248 TylF: Macrocin-O-methyltransferase (TylF); InterPr 98.02
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.01
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.0
COG2263198 Predicted RNA methylase [Translation, ribosomal st 97.97
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.9
COG2520341 Predicted methyltransferase [General function pred 97.89
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.88
KOG2730263 consensus Methylase [General function prediction o 97.81
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.77
PRK04148134 hypothetical protein; Provisional 97.74
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.74
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.72
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.71
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 97.69
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.66
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.66
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.59
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 97.59
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.52
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 97.44
KOG1709271 consensus Guanidinoacetate methyltransferase and r 97.42
PRK10742250 putative methyltransferase; Provisional 97.38
COG1041347 Predicted DNA modification methylase [DNA replicat 97.37
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.37
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.32
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.27
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.26
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 97.26
COG4262508 Predicted spermidine synthase with an N-terminal m 97.25
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.17
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.15
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.15
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.14
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.14
COG4076252 Predicted RNA methylase [General function predicti 97.13
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.13
KOG1271227 consensus Methyltransferases [General function pre 97.06
PF13679141 Methyltransf_32: Methyltransferase domain 97.02
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 96.96
PLN02232160 ubiquinone biosynthesis methyltransferase 96.91
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 96.87
KOG2361264 consensus Predicted methyltransferase [General fun 96.85
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 96.83
PHA01634156 hypothetical protein 96.79
PRK10611287 chemotaxis methyltransferase CheR; Provisional 96.75
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 96.72
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 96.68
KOG3010261 consensus Methyltransferase [General function pred 96.67
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 96.62
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 96.61
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.57
KOG1562337 consensus Spermidine synthase [Amino acid transpor 96.56
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 96.54
KOG3420185 consensus Predicted RNA methylase [Translation, ri 96.37
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 96.36
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 96.36
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 96.25
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 96.01
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 95.99
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 95.96
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 95.94
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 95.79
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 95.63
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 95.43
COG2384226 Predicted SAM-dependent methyltransferase [General 95.41
COG3897218 Predicted methyltransferase [General function pred 95.34
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 95.26
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 95.17
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 94.98
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 94.95
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 94.9
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 94.88
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 94.87
KOG2899288 consensus Predicted methyltransferase [General fun 94.86
PRK13699227 putative methylase; Provisional 94.73
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 94.66
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 94.52
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 94.44
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.43
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 93.95
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 93.42
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 93.29
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 93.28
PF04378245 RsmJ: Ribosomal RNA small subunit methyltransferas 93.09
KOG1501 636 consensus Arginine N-methyltransferase [General fu 92.73
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 92.66
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 92.48
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.14
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 92.11
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 92.08
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 92.04
PRK11524 284 putative methyltransferase; Provisional 91.99
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 91.99
PRK06176 380 cystathionine gamma-synthase/cystathionine beta-ly 91.66
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 91.65
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 91.62
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 91.57
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.36
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 91.29
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 91.18
PF00072112 Response_reg: Response regulator receiver domain; 91.18
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 91.18
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 90.99
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 90.96
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 90.94
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 90.84
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 90.81
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 90.74
PRK08247 366 cystathionine gamma-synthase; Reviewed 90.35
KOG0053 409 consensus Cystathionine beta-lyases/cystathionine 90.21
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 90.12
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 90.1
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 90.08
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 90.04
PRK08114 395 cystathionine beta-lyase; Provisional 89.9
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 89.86
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 89.78
PLN02827378 Alcohol dehydrogenase-like 89.71
PRK06223 307 malate dehydrogenase; Reviewed 89.68
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 89.27
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 89.16
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 89.06
PRK08064 390 cystathionine beta-lyase; Provisional 88.96
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 88.57
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 88.51
PRK07671 377 cystathionine beta-lyase; Provisional 88.39
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaea 88.23
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 88.21
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 87.79
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 87.7
PRK13512438 coenzyme A disulfide reductase; Provisional 87.65
PF01053 386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 87.5
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 87.46
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 87.27
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 87.23
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 86.98
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 86.9
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 86.89
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 86.79
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 86.75
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 86.7
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 86.6
PRK05967 395 cystathionine beta-lyase; Provisional 86.28
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 86.25
PRK13771334 putative alcohol dehydrogenase; Provisional 86.17
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 86.16
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 85.93
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 85.67
PRK06172253 short chain dehydrogenase; Provisional 85.66
PRK1031094 PTS system galactitol-specific transporter subunit 85.64
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 85.5
PHA02518211 ParA-like protein; Provisional 85.44
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 85.39
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 85.3
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 84.56
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 84.53
PTZ00117 319 malate dehydrogenase; Provisional 84.5
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 84.45
KOG2360413 consensus Proliferation-associated nucleolar prote 84.43
PRK07582 366 cystathionine gamma-lyase; Validated 84.29
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 84.15
PRK07478254 short chain dehydrogenase; Provisional 84.05
PLN02740381 Alcohol dehydrogenase-like 84.04
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 83.98
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 83.96
PRK05939 397 hypothetical protein; Provisional 83.84
PRK06194287 hypothetical protein; Provisional 83.77
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.61
PRK07523255 gluconate 5-dehydrogenase; Provisional 83.51
PRK07109 334 short chain dehydrogenase; Provisional 83.44
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 83.43
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 83.35
PRK05867253 short chain dehydrogenase; Provisional 83.27
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.23
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 83.21
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 83.09
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 82.76
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 82.74
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 82.74
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 82.57
PRK07904253 short chain dehydrogenase; Provisional 82.57
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 82.57
PRK06949258 short chain dehydrogenase; Provisional 82.35
PRK09028 394 cystathionine beta-lyase; Provisional 82.33
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 82.21
TIGR01329 378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 82.19
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 82.09
PRK05866293 short chain dehydrogenase; Provisional 82.01
PRK07890258 short chain dehydrogenase; Provisional 81.79
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 81.74
PRK09496453 trkA potassium transporter peripheral membrane com 81.5
COG1255129 Uncharacterized protein conserved in archaea [Func 81.5
PRK08643256 acetoin reductase; Validated 81.37
PRK07677252 short chain dehydrogenase; Provisional 81.34
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 81.25
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 81.24
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 81.23
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 81.22
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 81.13
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 81.12
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 81.04
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 80.94
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 80.88
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 80.84
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 80.78
TIGR02415254 23BDH acetoin reductases. One member of this famil 80.44
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 80.43
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 80.41
PRK07503 403 methionine gamma-lyase; Provisional 80.4
PRK08574 385 cystathionine gamma-synthase; Provisional 80.36
KOG1253 525 consensus tRNA methyltransferase [Translation, rib 80.26
PRK07832272 short chain dehydrogenase; Provisional 80.25
PF02636252 Methyltransf_28: Putative S-adenosyl-L-methionine- 80.2
PRK06139 330 short chain dehydrogenase; Provisional 80.04
PRK06914280 short chain dehydrogenase; Provisional 80.03
PLN02602 350 lactate dehydrogenase 80.03
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
Probab=100.00  E-value=2e-57  Score=391.16  Aligned_cols=213  Identities=62%  Similarity=1.043  Sum_probs=194.4

Q ss_pred             CccccChhHHHHHHHHhhcccCCCCcHHHHHHHHHHHHhcCCCeEEEEccCcchHHHHHHHHHhcCCCCcEEEEEeCCch
Q 027409            1 MKLVWSPDAASKAYIDTVKSCENIKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDER   80 (223)
Q Consensus         1 ~~~~w~~~~a~~ayl~~l~~~~~ii~p~~g~fL~~L~~~~~ak~ILEIGT~~Gys~Stl~la~A~~~~~g~i~TIE~d~e   80 (223)
                      ||++||||+|++|||+||++|+...+|++++||+.|++.++||.|+|+.+..|.+++||+||.|+++|+|+++||.++++
T Consensus         1 mkl~WSpe~AtkAYl~Tvk~c~~~~ep~~aEfISAlAAG~nAkliVe~~s~g~~~~ttiaLaaAAr~TgGR~vCIvp~~~   80 (218)
T PF07279_consen    1 MKLVWSPENATKAYLDTVKMCKKFKEPGVAEFISALAAGWNAKLIVEAWSSGGAISTTIALAAAARQTGGRHVCIVPDEQ   80 (218)
T ss_pred             CcceeChhHHHHHHHHHHHHhhhcCCCCHHHHHHHHhccccceEEEEEecCCCchHhHHHHHHHHHhcCCeEEEEcCChh
Confidence            89999999999999999999999999999999999999999999999988877667899999999999999999999999


Q ss_pred             HHHHHHHHHHhhcCce--EEEEecch-HHHhcCCCCccEEEEeCCCcccH-HHHHHhccCCCceEEEEeCCCCCCccccc
Q 027409           81 SRLAYVKAMYDVVGWV--SEVIVRQA-EEVMGELKGVDFLVVDCTSKDFA-RVLRFARFSNKGAVLAFKNAFQRSTSGLR  156 (223)
Q Consensus        81 ~~~~Ar~~~~~a~G~~--I~li~GdA-~evL~~L~~fDfVFIDa~K~~Y~-~~f~~~~~l~~GgvIV~DNvl~~g~~~~~  156 (223)
                      .....++.+..+ |+.  ++|+.|++ .+++++|...||++|||..++|. ++|+.+++.+.|+|||++|++.++...+.
T Consensus        81 ~~~~~~~~l~~~-~~~~~vEfvvg~~~e~~~~~~~~iDF~vVDc~~~d~~~~vl~~~~~~~~GaVVV~~Na~~r~~~~~~  159 (218)
T PF07279_consen   81 SLSEYKKALGEA-GLSDVVEFVVGEAPEEVMPGLKGIDFVVVDCKREDFAARVLRAAKLSPRGAVVVCYNAFSRSTNGFS  159 (218)
T ss_pred             hHHHHHHHHhhc-cccccceEEecCCHHHHHhhccCCCEEEEeCCchhHHHHHHHHhccCCCceEEEEeccccCCcCCcc
Confidence            999999999999 987  89999995 56899999999999999999999 99999998889999999999987655556


Q ss_pred             cccccccccCCCceEEEEeecCCceEEEEEcccCCCCCCCCCCCcCccceEecccccCceeeee
Q 027409          157 WQGQGVLDRGTRVVRSVFLPVGQGLDIVHVGSTSGSGSGESMNKNHSRWIKHVDQKSGEEHFFR  220 (223)
Q Consensus       157 ~~~r~~v~~~~~~~~t~lLPiGDGl~vs~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  220 (223)
                      |+.  .++ +.+.++|++||||.||+|++...+.+..   ++++.|||||+|||+|||||||||
T Consensus       160 w~~--~~~-~~r~Vrsv~LPIG~GleVt~ig~~~~~~---~~~~~~srWi~~vD~~sGEeHv~R  217 (218)
T PF07279_consen  160 WRS--VLR-GRRVVRSVFLPIGKGLEVTRIGASGGSN---SSRRKKSRWIKHVDQCSGEEHVFR  217 (218)
T ss_pred             HHH--hcC-CCCceeEEEeccCCCeEEEEEeecCCCC---CCCCCCccceEeeccCCCceeeec
Confidence            765  554 5678999999999999999999665433   455699999999999999999999



The function of this family is unknown.

>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PF05711 TylF: Macrocin-O-methyltransferase (TylF); InterPro: IPR008884 This family consists of bacterial macrocin O-methyltransferase (TylF) proteins Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10310 PTS system galactitol-specific transporter subunit IIB; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>KOG2360 consensus Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 100.0
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 100.0
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.97
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.97
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.97
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.96
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.96
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.96
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.96
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.95
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.95
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.95
3cvo_A202 Methyltransferase-like protein of unknown functio; 99.94
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.94
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.92
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 99.88
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.68
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.61
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.6
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.56
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.56
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.54
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.54
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.52
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.52
2o07_A304 Spermidine synthase; structural genomics, structur 99.51
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.5
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.48
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.47
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.47
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.46
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 99.46
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.45
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.45
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.44
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.42
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.42
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.41
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.41
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.41
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.4
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.39
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.38
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.38
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.37
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.37
2b25_A336 Hypothetical protein; structural genomics, methyl 99.37
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.35
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.35
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.34
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.34
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.34
2i7c_A283 Spermidine synthase; transferase, structural genom 99.34
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.33
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.33
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.33
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.33
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.33
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.33
2pt6_A321 Spermidine synthase; transferase, structural genom 99.32
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.32
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.32
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.32
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.32
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.32
3ocj_A305 Putative exported protein; structural genomics, PS 99.32
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.31
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.31
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.3
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.3
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.29
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.29
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.28
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.28
3lpm_A259 Putative methyltransferase; structural genomics, p 99.28
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.28
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 99.27
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.27
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.27
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.26
3f4k_A257 Putative methyltransferase; structural genomics, P 99.26
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.26
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.26
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.25
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.24
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.24
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 99.24
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.24
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.24
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.23
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.22
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.22
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.22
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.22
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.22
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.21
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.21
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.21
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.21
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.21
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.2
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.2
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.2
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.19
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.19
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.19
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.19
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.18
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.18
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.18
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.17
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.17
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.17
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.16
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.16
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.16
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.16
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.15
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.15
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.15
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.15
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.14
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.14
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.13
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.12
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.12
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.12
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.12
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.11
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.11
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.11
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.1
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.1
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.1
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.09
3lcc_A235 Putative methyl chloride transferase; halide methy 99.09
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.09
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.08
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.08
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.08
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.07
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.07
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.07
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.07
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.07
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.06
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.06
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.05
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.05
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.05
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.05
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.05
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.05
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 99.04
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.04
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.04
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.04
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.03
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.03
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.03
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.02
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.01
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.01
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.01
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.0
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.0
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.0
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.99
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.99
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.99
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.99
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.99
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.99
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.98
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.98
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.97
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.97
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.97
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.96
2h00_A254 Methyltransferase 10 domain containing protein; st 98.96
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.94
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.94
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.93
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.93
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.93
3k6r_A278 Putative transferase PH0793; structural genomics, 98.92
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.91
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.91
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.91
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.91
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.91
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.9
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.9
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.9
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.89
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.89
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.89
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.88
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.88
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.87
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.86
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.86
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.86
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.86
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.86
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.85
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.84
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.84
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.84
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.84
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.84
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.83
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.83
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.82
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.82
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.82
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.81
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.81
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.79
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.79
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.77
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.74
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.74
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.74
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.73
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.71
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.7
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.69
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.69
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.69
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.68
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.66
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.66
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.64
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.64
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 98.62
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.62
3cc8_A230 Putative methyltransferase; structural genomics, j 98.61
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.59
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.58
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.57
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.55
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.53
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.49
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.46
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.45
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.42
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.4
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.39
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.39
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.35
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.35
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.33
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.32
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.32
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.32
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.31
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.27
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.27
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.25
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.22
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.21
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.2
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.16
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.12
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.1
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.09
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.08
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.06
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.04
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 98.04
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.02
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.02
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.01
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 97.97
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 97.96
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.9
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 97.84
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 97.65
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 97.59
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.57
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 97.54
2oo3_A283 Protein involved in catabolism of external DNA; st 97.44
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 97.36
3lkd_A 542 Type I restriction-modification system methyltrans 97.36
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.31
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 97.09
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 96.77
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 96.71
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 96.62
3khk_A 544 Type I restriction-modification system methylation 96.61
2zig_A297 TTHA0409, putative modification methylase; methylt 96.09
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 95.84
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 95.53
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 95.14
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 94.85
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 94.69
3gms_A340 Putative NADPH:quinone reductase; structural genom 94.67
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 94.65
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 94.36
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 94.31
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 94.3
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 94.2
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 94.15
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 94.03
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 94.01
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 93.97
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 93.94
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 93.9
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 93.82
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 93.79
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 93.56
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 93.55
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 93.54
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 93.53
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 93.5
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 93.37
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 93.36
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.31
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 93.29
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 93.28
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 93.26
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 93.25
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 93.19
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 93.14
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 93.11
4eye_A342 Probable oxidoreductase; structural genomics, niai 93.09
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 93.05
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 93.04
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 92.97
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 92.87
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 92.81
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 92.76
3kto_A136 Response regulator receiver protein; PSI-II,struct 92.74
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 92.63
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 92.61
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 92.53
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 92.45
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 92.4
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 92.37
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 92.26
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 92.17
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 92.05
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 91.98
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 91.89
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 91.85
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 91.85
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 91.83
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 91.67
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 91.65
3lte_A132 Response regulator; structural genomics, PSI, prot 91.59
2qxy_A142 Response regulator; regulation of transcription, N 91.54
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 91.41
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 91.4
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 91.32
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 91.22
3hdv_A136 Response regulator; PSI-II, structural genomics, P 91.18
3f6c_A134 Positive transcription regulator EVGA; structural 91.18
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 91.18
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 91.07
1id1_A153 Putative potassium channel protein; RCK domain, E. 91.02
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 90.98
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 90.94
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 90.92
3snk_A135 Response regulator CHEY-like protein; P-loop conta 90.88
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.88
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 90.8
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 90.78
3cg4_A142 Response regulator receiver domain protein (CHEY-; 90.74
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 90.73
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 90.71
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 90.68
2rjn_A154 Response regulator receiver:metal-dependent phosph 90.67
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 90.58
3i42_A127 Response regulator receiver domain protein (CHEY- 90.58
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 90.47
3fbg_A346 Putative arginate lyase; structural genomics, unkn 90.47
3gt7_A154 Sensor protein; structural genomics, signal receiv 90.45
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 90.43
2qr3_A140 Two-component system response regulator; structura 90.39
3lua_A140 Response regulator receiver protein; two-component 90.37
3cg0_A140 Response regulator receiver modulated diguanylate 90.35
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 90.29
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 90.22
3grc_A140 Sensor protein, kinase; protein structure initiati 90.17
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 90.16
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 90.08
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 90.04
3c85_A183 Putative glutathione-regulated potassium-efflux S 89.97
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 89.96
3krt_A456 Crotonyl COA reductase; structural genomics, prote 89.96
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 89.89
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 89.78
3eul_A152 Possible nitrate/nitrite response transcriptional 89.75
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 89.67
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 89.62
3a10_A116 Response regulator; phosphoacceptor, signaling pro 89.48
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 89.39
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 89.37
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 89.32
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 89.25
2zay_A147 Response regulator receiver protein; structural ge 89.24
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 89.18
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 89.18
3crn_A132 Response regulator receiver domain protein, CHEY-; 89.14
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 89.12
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 89.07
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 89.06
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 88.94
3ufb_A 530 Type I restriction-modification system methyltran 88.92
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 88.8
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 88.78
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 88.68
1lss_A140 TRK system potassium uptake protein TRKA homolog; 88.68
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 88.62
2gkg_A127 Response regulator homolog; social motility, recei 88.58
3cwq_A209 Para family chromosome partitioning protein; alpha 88.5
3cnb_A143 DNA-binding response regulator, MERR family; signa 88.25
3h5i_A140 Response regulator/sensory box protein/ggdef domai 88.19
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 88.19
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 88.12
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 87.99
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 87.93
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 87.92
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 87.9
2zig_A 297 TTHA0409, putative modification methylase; methylt 87.84
3cz5_A153 Two-component response regulator, LUXR family; str 87.77
1srr_A124 SPO0F, sporulation response regulatory protein; as 87.72
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 87.64
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 87.58
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 87.54
2qv0_A143 Protein MRKE; structural genomics, transcription, 87.49
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 87.46
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 87.15
2rdm_A132 Response regulator receiver protein; structural ge 87.12
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 87.11
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 86.96
3n0r_A286 Response regulator; sigma factor, receiver, two-co 86.95
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 86.9
3jte_A143 Response regulator receiver protein; structural ge 86.9
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 86.83
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 86.82
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 86.76
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 86.72
1yio_A208 Response regulatory protein; transcription regulat 86.7
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 86.66
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 86.65
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 86.6
4dad_A146 Putative pilus assembly-related protein; response 86.51
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 86.45
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 86.39
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 86.36
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 86.29
3c3m_A138 Response regulator receiver protein; structural ge 86.22
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 86.2
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 86.15
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 85.9
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 85.9
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 85.89
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 85.84
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 85.81
3cfy_A137 Putative LUXO repressor protein; structural genomi 85.8
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 85.75
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 85.53
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 85.51
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 85.49
1zgz_A122 Torcad operon transcriptional regulatory protein; 85.45
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 85.44
3cxt_A291 Dehydrogenase with different specificities; rossma 85.43
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 85.42
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 85.24
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 85.24
1mvo_A136 PHOP response regulator; phosphate regulon, transc 85.23
3rqi_A184 Response regulator protein; structural genomics, s 85.2
2lpm_A123 Two-component response regulator; transcription re 85.2
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 85.2
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 85.18
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 85.17
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 85.12
1s8n_A205 Putative antiterminator; RV1626, structural genomi 85.01
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 84.98
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 84.94
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 84.77
3rih_A293 Short chain dehydrogenase or reductase; structural 84.57
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 84.48
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 84.45
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 84.42
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 84.39
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 84.38
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 84.28
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 84.18
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 84.15
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 84.14
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 84.13
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 84.06
1mb3_A124 Cell division response regulator DIVK; signal tran 84.05
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 83.95
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 83.95
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 83.9
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 83.9
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
Probab=100.00  E-value=7.7e-34  Score=241.87  Aligned_cols=176  Identities=15%  Similarity=0.249  Sum_probs=146.4

Q ss_pred             hHHHHHHHHhhcccC---------------CCCcHHHHHHHHHHHHhcCCC---eEEEEccCcchHHHHHHHHHhcCCCC
Q 027409            8 DAASKAYIDTVKSCE---------------NIKESGVAELLSAMAAGWNAK---LIVEAWTHGGPITTSIGLAIAARHTC   69 (223)
Q Consensus         8 ~~a~~ayl~~l~~~~---------------~ii~p~~g~fL~~L~~~~~ak---~ILEIGT~~Gys~Stl~la~A~~~~~   69 (223)
                      ..+..+|+.++.+..               .+++|++++||..|++..+++   +|||||||+||  ++++||.+. +++
T Consensus         5 ~~~~~~y~~~~~~~~~~l~~~~~~a~~~~~p~i~~~~~~~l~~l~~~~~~~~~~~vLdiG~G~G~--~~~~la~~~-~~~   81 (221)
T 3dr5_A            5 FEYLRTYVESTTETDAAVARAREDAAEFGLPAPDEMTGQLLTTLAATTNGNGSTGAIAITPAAGL--VGLYILNGL-ADN   81 (221)
T ss_dssp             HHHHHHHHHTTSCCCHHHHHHHHHHHHTTCCCCCHHHHHHHHHHHHHSCCTTCCEEEEESTTHHH--HHHHHHHHS-CTT
T ss_pred             HHHHHHHHHHcCCCCHHHHHHHHHHHHcCCCCCCHHHHHHHHHHHHhhCCCCCCCEEEEcCCchH--HHHHHHHhC-CCC
Confidence            344567777765432               278999999999999999999   99999999999  899998764 457


Q ss_pred             cEEEEEeCCchHHHHHHHHHHhhcCce---EEEEecchHHHhcCC--CCccEEEEeCCCcccHHHHHHh-ccCCCceEEE
Q 027409           70 ARHVCIVPDERSRLAYVKAMYDVVGWV---SEVIVRQAEEVMGEL--KGVDFLVVDCTSKDFARVLRFA-RFSNKGAVLA  143 (223)
Q Consensus        70 g~i~TIE~d~e~~~~Ar~~~~~a~G~~---I~li~GdA~evL~~L--~~fDfVFIDa~K~~Y~~~f~~~-~~l~~GgvIV  143 (223)
                      |+|++||+++++++.|+++++++ |+.   |+++.|||.+.++.+  ++||+||+|+++.+|.++|+.+ +.|+|||+|+
T Consensus        82 ~~v~~vD~~~~~~~~a~~~~~~~-g~~~~~i~~~~gda~~~l~~~~~~~fD~V~~d~~~~~~~~~l~~~~~~LkpGG~lv  160 (221)
T 3dr5_A           82 TTLTCIDPESEHQRQAKALFREA-GYSPSRVRFLLSRPLDVMSRLANDSYQLVFGQVSPMDLKALVDAAWPLLRRGGALV  160 (221)
T ss_dssp             SEEEEECSCHHHHHHHHHHHHHT-TCCGGGEEEECSCHHHHGGGSCTTCEEEEEECCCTTTHHHHHHHHHHHEEEEEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHc-CCCcCcEEEEEcCHHHHHHHhcCCCcCeEEEcCcHHHHHHHHHHHHHHcCCCcEEE
Confidence            99999999999999999999999 875   999999999999887  4899999999999999999866 6779999999


Q ss_pred             EeCCCCCCc-cccccccc---------cccccCCCceEEEEeecCCceEEEEEcc
Q 027409          144 FKNAFQRST-SGLRWQGQ---------GVLDRGTRVVRSVFLPVGQGLDIVHVGS  188 (223)
Q Consensus       144 ~DNvl~~g~-~~~~~~~r---------~~v~~~~~~~~t~lLPiGDGl~vs~k~~  188 (223)
                      +||++++|. .+...+.+         ..++ .++++++++||+|||++++++-+
T Consensus       161 ~dn~~~~g~v~~~~~~~~~~~~~~~~~~~l~-~~~~~~~~~lp~gdGl~~~~~~~  214 (221)
T 3dr5_A          161 LADALLDGTIADQTRKDRDTQAARDADEYIR-SIEGAHVARLPLGAGLTVVTKAL  214 (221)
T ss_dssp             ETTTTGGGTCSCSSCCCHHHHHHHHHHHHHT-TCTTEEEEEESSTTCEEEEEECC
T ss_pred             EeCCCCCCcCCCCCCCChHHHHHHHHHHHHh-hCCCeeEEEeeccchHHHHHHHH
Confidence            999998764 11111110         1233 44779999999999999999864



>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 100.0
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 100.0
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 100.0
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.71
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.64
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.6
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 99.59
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.58
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.57
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.56
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.52
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.51
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.51
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.51
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.44
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.43
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.42
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.39
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.38
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.37
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.33
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.33
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.32
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.28
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.26
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.25
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.23
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.22
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 99.21
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.19
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.18
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.17
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.17
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.15
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.14
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.12
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.11
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.11
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.08
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.07
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.05
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 99.04
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.03
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.01
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.0
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.99
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.98
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.97
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.95
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.95
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.93
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.92
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.91
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.9
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.9
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.88
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.88
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.87
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.87
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.86
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.84
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.83
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.82
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.79
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.77
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.75
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.75
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.74
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.61
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.61
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.49
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.48
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.46
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.43
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.43
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.33
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.29
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.26
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.18
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.02
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.01
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.97
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.97
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 97.96
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.95
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.92
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.89
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 97.86
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.79
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.69
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.47
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.22
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.21
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.15
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 96.9
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.76
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 96.68
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.59
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.28
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 96.14
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.12
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.11
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.04
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.01
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.67
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.54
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.49
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.34
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.32
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.11
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 95.11
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.07
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.07
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.02
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.86
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 94.7
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.67
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 94.22
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.85
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 93.42
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 93.27
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 93.22
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 93.2
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.1
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 92.85
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 92.73
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 92.68
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.68
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 92.63
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 92.31
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 92.05
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 92.04
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 91.79
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 91.65
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 91.23
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 91.1
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 90.98
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 90.98
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 90.97
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 90.88
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.81
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 90.74
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 90.67
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.59
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 90.58
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 90.58
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 90.56
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 90.51
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 90.48
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 90.46
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 90.28
d1mb3a_123 Cell division response regulator DivK {Caulobacter 90.27
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 90.26
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 90.06
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 89.88
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.53
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 89.4
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 89.38
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 89.27
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 89.1
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 89.02
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.01
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 88.97
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 88.87
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 88.81
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 88.77
d1gc0a_ 392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 88.72
d1yioa2128 Response regulatory protein StyR, N-terminal domai 88.59
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 88.48
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 88.16
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.64
d1qkka_140 Transcriptional regulatory protein DctD, receiver 87.52
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 87.44
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 87.25
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 87.03
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 86.66
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 86.47
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 86.29
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 86.16
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 86.09
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 85.85
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 85.5
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 84.99
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 84.96
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 84.57
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.53
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 84.45
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 84.43
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 84.41
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 84.16
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 84.04
d1ibja_ 380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 83.66
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 83.61
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 83.55
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 83.48
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 83.4
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 83.21
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 83.05
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 83.05
d1y4ia1 397 Methionine gamma-lyase, MGL {Citrobacter freundii 82.76
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 82.6
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 82.54
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 82.5
d2oo3a1271 Uncharacterized protein LPG1296 {Legionella pneumo 81.81
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 81.73
d1cl1a_ 391 Cystathionine beta-lyase, CBL {Escherichia coli [T 81.49
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 81.49
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 81.43
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 81.35
d1i3ca_144 Response regulator for cyanobacterial phytochrome 81.04
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 80.82
d1s8na_190 Probable two-component system transcriptional regu 80.6
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 80.52
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 80.45
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 80.43
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 80.08
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: COMT-like
domain: Caffeoyl-CoA O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=100.00  E-value=1.9e-43  Score=304.14  Aligned_cols=159  Identities=17%  Similarity=0.205  Sum_probs=138.0

Q ss_pred             CCcHHHHHHHHHHHHhcCCCeEEEEccCcchHHHHHHHHHhcCCCCcEEEEEeCCchHHHHHHHHHHhhcCce--EEEEe
Q 027409           24 IKESGVAELLSAMAAGWNAKLIVEAWTHGGPITTSIGLAIAARHTCARHVCIVPDERSRLAYVKAMYDVVGWV--SEVIV  101 (223)
Q Consensus        24 ii~p~~g~fL~~L~~~~~ak~ILEIGT~~Gys~Stl~la~A~~~~~g~i~TIE~d~e~~~~Ar~~~~~a~G~~--I~li~  101 (223)
                      .++|++|+||++|+++.+||+||||||++||  ||+|||.|. +++|+|+|||.|+++++.|+++|+++ |+.  |+++.
T Consensus        42 ~~~~~~g~~L~~L~~~~~~k~iLEiGT~~Gy--Stl~la~al-~~~g~v~tie~~~~~~~~A~~~~~~~-g~~~~i~~~~  117 (227)
T d1susa1          42 TTSADEGQFLSMLLKLINAKNTMEIGVYTGY--SLLATALAI-PEDGKILAMDINKENYELGLPVIKKA-GVDHKIDFRE  117 (227)
T ss_dssp             SCCHHHHHHHHHHHHHHTCCEEEEECCGGGH--HHHHHHHHS-CTTCEEEEEESCCHHHHHHHHHHHHT-TCGGGEEEEE
T ss_pred             ccCHHHHHHHHHHHHhcCCCcEEEecchhhh--hHHHHHhhC-CCCcEEEEEeccchhHHHHHHHHHHh-ccccceeeee
Confidence            6899999999999999999999999999999  999999886 55899999999999999999999999 998  99999


Q ss_pred             cchHHHhcCC-------CCccEEEEeCCCcccHHHHHHh-ccCCCceEEEEeCCCCCCc--cc--ccccc-----c----
Q 027409          102 RQAEEVMGEL-------KGVDFLVVDCTSKDFARVLRFA-RFSNKGAVLAFKNAFQRST--SG--LRWQG-----Q----  160 (223)
Q Consensus       102 GdA~evL~~L-------~~fDfVFIDa~K~~Y~~~f~~~-~~l~~GgvIV~DNvl~~g~--~~--~~~~~-----r----  160 (223)
                      |||.++|+++       ++||||||||+|++|++||+.+ ++++|||+||+||++|+|.  +.  ...+.     +    
T Consensus       118 g~a~~~L~~l~~~~~~~~~fD~iFiDa~k~~y~~~~e~~~~ll~~gGiii~DNvl~~G~v~~~~~~~~~~~~~~~~~~i~  197 (227)
T d1susa1         118 GPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVL  197 (227)
T ss_dssp             SCHHHHHHHHHHCGGGTTCBSEEEECSCSTTHHHHHHHHHHHBCTTCCEEEETTTGGGGGGCCTTCCCCHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHhccccCCceeEEEeccchhhhHHHHHHHHhhcCCCcEEEEccCCCCCcccCCcccchHHHHHHHHHHHH
Confidence            9999999876       2699999999999999999977 4569999999999999874  11  00000     0    


Q ss_pred             ---cccccCCCceEEEEeecCCceEEEEEc
Q 027409          161 ---GVLDRGTRVVRSVFLPVGQGLDIVHVG  187 (223)
Q Consensus       161 ---~~v~~~~~~~~t~lLPiGDGl~vs~k~  187 (223)
                         ..++ .+|++++++||+|||++|++|.
T Consensus       198 ~~n~~i~-~d~r~~~~llPigDGl~i~~K~  226 (227)
T d1susa1         198 ELNKALA-VDPRIEICMLPVGDGITICRRI  226 (227)
T ss_dssp             HHHHHHH-HCTTBCCEEECSTTCEEEECBC
T ss_pred             HHHHHHh-cCCCEEEEEeecCCeeEEEEEC
Confidence               0233 3477999999999999999885



>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure