Citrus Sinensis ID: 027808

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MAWCSLRSLNVPTIDMGALRTRSRLAAVGIGCASVAGSSVWRSSCKKHSTPFACLSTSAVSNLKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAALPNA
cccccccccccccccccccccccccccccccccccccccEEcccccccccccccccHHHHHHccccccccccccccccHHHHHEEccEEEEEccccccccccccccccccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccHHHHHHHHHHHccccccccHHHHHHcccccccEEEEEEEEcccc
ccccccccccccHHcHHHHHccccHHHccccccEEEEccccccccccccccccccccccHHHHHEEEccccccccccccccEEEEccEEEEccEccEccccccEEEEEEEEEEEEEEEEEEEEEcccccccEccccHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEccHHHHHHHHHHHHHHccccccEEEEEEccEcHHHccEEEEEEEEEccc
mawcslrslnvptidmgalRTRSRLAAVGIGCASVagssvwrssckkhstpfaclstsavSNLKEavvtnkapaalgpysqaikanNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYvfespfqtgkfvsdTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAkyfpspaparaTYQVAALPLDARVEIECIAALPNA
mawcslrslnvptidmgALRTRSRLAAVGIGCASVAGSSVWRSSCKKHSTPFACLSTSAVSNLKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQVLKNIGEILkasgadysSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAALPNA
MAWCSLRSLNVPTIDMGALRTRSRLAAVGIGCASVAGSSVWRSSCKKHSTPFACLSTSAVSNLKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAALPNA
**WCSLRSLNVPTIDMGALRTRSRLAAVGIGCASVAGSSVWRSSCKKHSTPFACLSTSAVSNLKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAA****
********LNV*TIDMGALRTRSRLAAVGIGCASVAGSSVWRSSCKKHS****************AVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAALPN*
MAWCSLRSLNVPTIDMGALRTRSRLAAVGIGCASVAGSSVWRSSCKKHSTPFACLSTSAVSNLKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAALPNA
*AWCSLRSLNVPTIDMGALRTRSRLAAVGIGCASVAGSSVWRSSCKKHSTPFACLSTSAVSNLKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAALPN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAWCSLRSLNVPTIDMGALRTRSRLAAVGIGCASVAGSSVWRSSCKKHSTPFACLSTSAVSNLKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAALPNA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
P52760135 Ribonuclease UK114 OS=Mus yes no 0.573 0.925 0.450 5e-31
P52758137 Ribonuclease UK114 OS=Hom yes no 0.564 0.897 0.437 6e-31
Q10121171 RutC family protein C23G1 no no 0.555 0.707 0.453 3e-30
P52759137 Ribonuclease UK114 OS=Rat yes no 0.573 0.912 0.437 1e-29
Q3T114137 Ribonuclease UK114 OS=Bos yes no 0.573 0.912 0.437 2e-29
P80601137 Ribonuclease UK114 OS=Cap N/A no 0.573 0.912 0.431 2e-28
Q9ZKQ6125 RutC family protein jhp_0 yes no 0.564 0.984 0.470 2e-27
O25598125 RutC family protein HP_09 yes no 0.564 0.984 0.470 2e-27
P55654126 RutC family protein y4sK yes no 0.564 0.976 0.430 1e-25
O58584126 RutC family protein PH085 yes no 0.564 0.976 0.390 3e-24
>sp|P52760|UK114_MOUSE Ribonuclease UK114 OS=Mus musculus GN=Hrsp12 PE=1 SV=3 Back     alignment and function desciption
 Score =  134 bits (337), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 95/153 (62%), Gaps = 28/153 (18%)

Query: 61  SNLKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTI 120
           S +++ + T KAPAA+GPYSQA++ +  +++SG +GL P                     
Sbjct: 3   SIIRKVISTTKAPAAIGPYSQAVQVDRTIYISGQVGLDPS-------------------- 42

Query: 121 YVFESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNE 180
                   +G+ V   + ++ +Q LKN+GEILKA+G D+++VVKTT+LLAD+ DF TVNE
Sbjct: 43  --------SGQLVPGGVVEEAKQALKNLGEILKAAGCDFNNVVKTTVLLADMNDFGTVNE 94

Query: 181 IYAKYFPSPAPARATYQVAALPLDARVEIECIA 213
           IY  YF    PARA YQVAALP  +RVEIE IA
Sbjct: 95  IYKTYFQGSLPARAAYQVAALPRGSRVEIEAIA 127
Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|P52758|UK114_HUMAN Ribonuclease UK114 OS=Homo sapiens GN=HRSP12 PE=1 SV=1 Back     alignment and function description
>sp|Q10121|YSD2_CAEEL RutC family protein C23G10.2 OS=Caenorhabditis elegans GN=C23G10.2 PE=3 SV=3 Back     alignment and function description
>sp|P52759|UK114_RAT Ribonuclease UK114 OS=Rattus norvegicus GN=Hrsp12 PE=1 SV=3 Back     alignment and function description
>sp|Q3T114|UK114_BOVIN Ribonuclease UK114 OS=Bos taurus GN=HRSP12 PE=2 SV=3 Back     alignment and function description
>sp|P80601|UK114_CAPHI Ribonuclease UK114 OS=Capra hircus GN=HRSP12 PE=1 SV=3 Back     alignment and function description
>sp|Q9ZKQ6|Y944_HELPJ RutC family protein jhp_0879 OS=Helicobacter pylori (strain J99) GN=jhp_0879 PE=3 SV=1 Back     alignment and function description
>sp|O25598|Y944_HELPY RutC family protein HP_0944 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0944 PE=3 SV=1 Back     alignment and function description
>sp|P55654|Y4SK_RHISN RutC family protein y4sK OS=Rhizobium sp. (strain NGR234) GN=NGR_a01620 PE=3 SV=1 Back     alignment and function description
>sp|O58584|Y854_PYRHO RutC family protein PH0854 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0854 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
449470455187 PREDICTED: ribonuclease UK114-like [Cucu 0.853 0.994 0.643 5e-70
449518761187 PREDICTED: ribonuclease UK114-like [Cucu 0.853 0.994 0.643 7e-70
194466266189 perchloric acid soluble translation inhi 0.853 0.984 0.632 2e-69
356567350187 PREDICTED: ribonuclease UK114-like [Glyc 0.853 0.994 0.634 2e-69
351725031188 uncharacterized protein LOC100527559 [Gl 0.848 0.984 0.632 8e-69
356527048187 PREDICTED: ribonuclease UK114-like [Glyc 0.848 0.989 0.626 2e-67
224061429201 predicted protein [Populus trichocarpa] 0.866 0.940 0.593 1e-66
225460977191 PREDICTED: ribonuclease UK114-like [Viti 0.853 0.973 0.663 1e-66
297737434188 unnamed protein product [Vitis vinifera] 0.853 0.989 0.663 2e-66
388505198188 unknown [Medicago truncatula] 0.848 0.984 0.627 3e-66
>gi|449470455|ref|XP_004152932.1| PREDICTED: ribonuclease UK114-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 161/216 (74%), Gaps = 30/216 (13%)

Query: 1   MAWCSLRSLNVPTIDMGALRTRSRLAAVGIGCASVAGSSVWRSS-CKKHSTPFACLSTSA 59
           MAWC+ R+ ++P  D+ ALR++S LA VG+GC SVAG+++WRSS   K   PFA L  S 
Sbjct: 1   MAWCAARTFHMPAFDVTALRSKSPLA-VGVGCVSVAGTTLWRSSSTSKRQIPFASLGIST 59

Query: 60  VSNLKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILT 119
            S++KEAV T+KAPAALGPYSQAIKANNL+FVSGVLGL PE                   
Sbjct: 60  SSSIKEAVQTDKAPAALGPYSQAIKANNLLFVSGVLGLNPE------------------- 100

Query: 120 IYVFESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVN 179
                    TGKFVSD +EDQTEQVLKN+GEILKA G+ YSSVVKTTI+LADLKDFK VN
Sbjct: 101 ---------TGKFVSDDVEDQTEQVLKNMGEILKAGGSSYSSVVKTTIMLADLKDFKKVN 151

Query: 180 EIYAKYFPSPAPARATYQVAALPLDARVEIECIAAL 215
           EIYAKYFPSPAPAR+TY+VA LPLDA+VEIECIA L
Sbjct: 152 EIYAKYFPSPAPARSTYEVARLPLDAKVEIECIATL 187

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449518761|ref|XP_004166404.1| PREDICTED: ribonuclease UK114-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|194466266|gb|ACF74362.1| perchloric acid soluble translation inhibitor protein [Arachis hypogaea] Back     alignment and taxonomy information
>gi|356567350|ref|XP_003551884.1| PREDICTED: ribonuclease UK114-like [Glycine max] Back     alignment and taxonomy information
>gi|351725031|ref|NP_001237846.1| uncharacterized protein LOC100527559 [Glycine max] gi|255632612|gb|ACU16656.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356527048|ref|XP_003532126.1| PREDICTED: ribonuclease UK114-like [Glycine max] Back     alignment and taxonomy information
>gi|224061429|ref|XP_002300475.1| predicted protein [Populus trichocarpa] gi|118485546|gb|ABK94625.1| unknown [Populus trichocarpa] gi|222847733|gb|EEE85280.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225460977|ref|XP_002280251.1| PREDICTED: ribonuclease UK114-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737434|emb|CBI26635.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388505198|gb|AFK40665.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2092374187 AT3G20390 "AT3G20390" [Arabido 0.403 0.470 0.840 9.8e-66
MGI|MGI:1095401135 Hrsp12 "heat-responsive protei 0.389 0.629 0.6 3.4e-32
UNIPROTKB|P52758137 HRSP12 "Ribonuclease UK114" [H 0.389 0.620 0.6 5.5e-32
UNIPROTKB|Q3T114137 HRSP12 "Ribonuclease UK114" [B 0.389 0.620 0.576 6.1e-31
UNIPROTKB|E1C7E1132 HRSP12 "Uncharacterized protei 0.385 0.636 0.607 2e-30
UNIPROTKB|F1S0M2137 HRSP12 "Uncharacterized protei 0.389 0.620 0.576 2.6e-30
TIGR_CMR|CHY_2460125 CHY_2460 "endoribonuclease L-P 0.394 0.688 0.476 5.2e-28
ZFIN|ZDB-GENE-040718-315135 hrsp12 "heat-responsive protei 0.362 0.585 0.544 7.4e-27
UNIPROTKB|H0YB34148 HRSP12 "Ribonuclease UK114" [H 0.389 0.574 0.6 1.2e-26
UNIPROTKB|Q8U308126 yjgF "Enamine/imine deaminase" 0.394 0.682 0.488 1e-25
TAIR|locus:2092374 AT3G20390 "AT3G20390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 390 (142.3 bits), Expect = 9.8e-66, Sum P(2) = 9.8e-66
 Identities = 74/88 (84%), Positives = 86/88 (97%)

Query:   128 QTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFP 187
             +TGKFVS+++EDQTEQVLKN+GEILKASGADYSSVVKTTI+LADL DFKTVNEIYAKYFP
Sbjct:   100 ETGKFVSESVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLADLADFKTVNEIYAKYFP 159

Query:   188 SPAPARATYQVAALPLDARVEIECIAAL 215
             +P+PAR+TYQVAALPL+A++EIECIA L
Sbjct:   160 APSPARSTYQVAALPLNAKIEIECIATL 187
GO:0004521 "endoribonuclease activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0005773 "vacuole" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009536 "plastid" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
MGI|MGI:1095401 Hrsp12 "heat-responsive protein 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P52758 HRSP12 "Ribonuclease UK114" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T114 HRSP12 "Ribonuclease UK114" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7E1 HRSP12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0M2 HRSP12 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2460 CHY_2460 "endoribonuclease L-PSP family protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-315 hrsp12 "heat-responsive protein 12" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H0YB34 HRSP12 "Ribonuclease UK114" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8U308 yjgF "Enamine/imine deaminase" [Pyrococcus furiosus DSM 3638 (taxid:186497)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
TIGR00004124 TIGR00004, TIGR00004, reactive intermediate/imine 1e-57
pfam01042120 pfam01042, Ribonuc_L-PSP, Endoribonuclease L-PSP 7e-49
COG0251130 COG0251, TdcF, Putative translation initiation inh 5e-42
cd00448107 cd00448, YjgF_YER057c_UK114_family, YjgF, YER057c, 2e-37
PRK11401129 PRK11401, PRK11401, putative endoribonuclease L-PS 5e-23
cd06150105 cd06150, YjgF_YER057c_UK114_like_2, This group of 1e-19
cd06154119 cd06154, YjgF_YER057c_UK114_like_6, This group of 2e-16
cd06155101 cd06155, eu_AANH_C_1, A group of hypothetical euka 3e-16
TIGR03610126 TIGR03610, RutC, pyrimidine utilization protein C 4e-15
cd02198111 cd02198, YjgH_like, YjgH belongs to a large family 6e-12
cd06151126 cd06151, YjgF_YER057c_UK114_like_3, This group of 2e-10
cd06152114 cd06152, YjgF_YER057c_UK114_like_4, YjgF, YER057c, 2e-09
cd06153114 cd06153, YjgF_YER057c_UK114_like_5, This group of 5e-04
>gnl|CDD|129116 TIGR00004, TIGR00004, reactive intermediate/imine deaminase Back     alignment and domain information 
 Score =  177 bits (452), Expect = 1e-57
 Identities = 66/152 (43%), Positives = 83/152 (54%), Gaps = 28/152 (18%)

Query: 64  KEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVF 123
           K+ + T+KAPAA+GPYSQA+K  N V+VSG + L P                        
Sbjct: 1   KKIISTDKAPAAIGPYSQAVKVGNTVYVSGQIPLDP------------------------ 36

Query: 124 ESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYA 183
                TG+ V   I +Q EQVL+N+  IL+A+G     VVKTT+ L DL DF  VNE+Y 
Sbjct: 37  ----STGELVGGDIAEQAEQVLENLKAILEAAGLSLDDVVKTTVFLTDLNDFAEVNEVYG 92

Query: 184 KYFPSPAPARATYQVAALPLDARVEIECIAAL 215
           +YF    PAR+  QVAALP    VEIE IA  
Sbjct: 93  QYFDEHYPARSAVQVAALPKGVLVEIEAIAVK 124

This protein was described initially as an inhibitor of protein synthesis intiation, then as an endoribonuclease active on single-stranded mRNA, endoribonuclease L-PSP. Members of this family, conserved in all domains of life and often with several members per bacterial genome, appear to catalyze a reaction that minimizes toxic by-products from reactions catalyzed by pyridoxal phosphate-dependent enzymes [Cellular processes, Other]. Length = 124
>gnl|CDD|216262 pfam01042, Ribonuc_L-PSP, Endoribonuclease L-PSP Back     alignment and domain information
>gnl|CDD|223329 COG0251, TdcF, Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100004 cd00448, YjgF_YER057c_UK114_family, YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|105214 PRK11401, PRK11401, putative endoribonuclease L-PSP; Provisional Back     alignment and domain information
>gnl|CDD|100007 cd06150, YjgF_YER057c_UK114_like_2, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|100011 cd06154, YjgF_YER057c_UK114_like_6, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|100012 cd06155, eu_AANH_C_1, A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains Back     alignment and domain information
>gnl|CDD|211850 TIGR03610, RutC, pyrimidine utilization protein C Back     alignment and domain information
>gnl|CDD|100005 cd02198, YjgH_like, YjgH belongs to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|100008 cd06151, YjgF_YER057c_UK114_like_3, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|100009 cd06152, YjgF_YER057c_UK114_like_4, YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|100010 cd06153, YjgF_YER057c_UK114_like_5, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
TIGR00004124 endoribonuclease L-PSP, putative. This protein was 100.0
COG0251130 TdcF Putative translation initiation inhibitor, yj 100.0
TIGR03610127 RutC pyrimidine utilization protein C. This protei 100.0
PRK11401129 putative endoribonuclease L-PSP; Provisional 100.0
PF01042121 Ribonuc_L-PSP: Endoribonuclease L-PSP; InterPro: I 100.0
cd06154119 YjgF_YER057c_UK114_like_6 This group of proteins b 100.0
cd06152114 YjgF_YER057c_UK114_like_4 YjgF, YER057c, and UK114 99.97
cd02198111 YjgH_like YjgH belongs to a large family of YjgF/Y 99.97
cd02199142 YjgF_YER057c_UK114_like_1 This group of proteins b 99.97
cd06150105 YjgF_YER057c_UK114_like_2 This group of proteins b 99.97
cd06156118 eu_AANH_C_2 A group of hypothetical eukaryotic pro 99.96
cd00448107 YjgF_YER057c_UK114_family YjgF, YER057c, and UK114 99.96
cd06153114 YjgF_YER057c_UK114_like_5 This group of proteins b 99.96
cd06155101 eu_AANH_C_1 A group of hypothetical eukaryotic pro 99.94
cd06151126 YjgF_YER057c_UK114_like_3 This group of proteins b 99.94
KOG2317138 consensus Putative translation initiation inhibito 99.94
PF14588148 YjgF_endoribonc: YjgF/chorismate_mutase-like, puta 99.77
>TIGR00004 endoribonuclease L-PSP, putative Back     alignment and domain information 
Probab=100.00  E-value=5.2e-34  Score=224.79  Aligned_cols=123  Identities=54%  Similarity=0.825  Sum_probs=116.1

Q ss_pred             cccccCCCCCCCCCCccEEEECCEEEEeeeccCCCCcccccccccccceeeeeeecccccCCcccCccccccHHHHHHHH
Q 027808           65 EAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQV  144 (218)
Q Consensus        65 ~~i~~~~~p~~~gpYS~av~~g~~vfvSGq~~~dp~~~~~~~~~~aG~~~~~~~~~~~~~~~~~tG~~~~~di~~Qt~~v  144 (218)
                      +.+.+++.|++.++|||++++|+++|+|||+++|++                            +|++.++|+++|++++
T Consensus         2 ~~~~~~~~~~~~~~ys~av~~g~~v~vSGq~~~~~~----------------------------~g~~~~~d~~~Q~~~~   53 (124)
T TIGR00004         2 KIISTDKAPAAIGPYSQAVKVGNTLFVSGQIPLDPS----------------------------TGELVGGDIAEQAEQV   53 (124)
T ss_pred             ceecCCCCCCCCCCCcceEEECCEEEEeeeCCCcCC----------------------------CCcCCCCCHHHHHHHH
Confidence            457788999999999999999999999999999997                            4666568999999999


Q ss_pred             HHHHHHHHHHcCCCccceEEEEEEecCCCCHHHHHHHHHHhCCCCCCceEEEEcCCCCCCceEEEEEEEEe
Q 027808          145 LKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAAL  215 (218)
Q Consensus       145 l~nI~~iL~~aG~~l~dVvkvtvyl~d~~df~~vnev~~e~F~~~~PArt~V~V~~Lp~~~lVEIEaiA~~  215 (218)
                      |+||+++|+++|++++||+++++|++|++||+.++++|.+||++++|+|++++|..|++|++||||++|++
T Consensus        54 ~~ni~~~L~~aG~~~~dvv~~~vyv~~~~~~~~~~~~~~~~f~~~~Pa~t~v~v~~L~~~~~vEIe~vA~~  124 (124)
T TIGR00004        54 LENLKAILEAAGLSLDDVVKTTVFLTDLNDFAEVNEVYGQYFDEPYPARSAVQVAALPKGVLVEIEAIAVK  124 (124)
T ss_pred             HHHHHHHHHHcCCCHHHEEEEEEEEeChHHHHHHHHHHHHHcCCCCCceEEEECccCCCCCEEEEEEEEEC
Confidence            99999999999999999999999999999999999999999999899999999999999999999999974

This protein was described initially as an inhibitor of protein synthesis intiation but is now viewed as an endoribonuclease active on single-stranded mRNA. The cleavage of mRNA is responsible for the inhibition of protein synthesis. A role in purine regulation has also been suggested.
>COG0251 TdcF Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03610 RutC pyrimidine utilization protein C Back     alignment and domain information
>PRK11401 putative endoribonuclease L-PSP; Provisional Back     alignment and domain information
>PF01042 Ribonuc_L-PSP: Endoribonuclease L-PSP; InterPro: IPR006175 This domain is found in endoribonuclease, that is active on single-stranded mRNA and inhibits protein synthesis by cleavage of mRNA [] Back     alignment and domain information
>cd06154 YjgF_YER057c_UK114_like_6 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06152 YjgF_YER057c_UK114_like_4 YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd02198 YjgH_like YjgH belongs to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd02199 YjgF_YER057c_UK114_like_1 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06150 YjgF_YER057c_UK114_like_2 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06156 eu_AANH_C_2 A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains Back     alignment and domain information
>cd00448 YjgF_YER057c_UK114_family YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06153 YjgF_YER057c_UK114_like_5 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06155 eu_AANH_C_1 A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains Back     alignment and domain information
>cd06151 YjgF_YER057c_UK114_like_3 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>KOG2317 consensus Putative translation initiation inhibitor UK114/IBM1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14588 YjgF_endoribonc: YjgF/chorismate_mutase-like, putative endoribonuclease; PDB: 2OTM_B 3D01_D Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1oni_A138 Crystal Structure Of A Human P14.5, A Translational 4e-32
1qah_A136 Crystal Structure Of Perchloric Acid Soluble Protei 1e-30
1nq3_A136 Crystal Structure Of The Mammalian Tumor Associated 2e-29
2csl_A124 Crystal Structure Of Ttha0137 From Thermus Thermoph 1e-26
3l7q_A125 Crystal Structure Of Aldr From Streptococcus Mutans 5e-26
2dyy_A126 Crystal Structure Of Putative Translation Initiatio 2e-25
1qd9_A124 Bacillus Subtilis Yabj Length = 124 1e-24
1xrg_A156 Conserved Hypothetical Protein From Clostridium The 3e-24
2b33_A140 Crystal Structure Of A Putative Endoribonuclease (t 3e-23
3k0t_A143 Crystal Structure Of Pspto -Psp Protein In Complex 3e-20
3m4s_A148 Crystal Structure Of A Putative Endoribonuclease L- 4e-20
3mqw_A148 Crystal Structure Of A Putative Endoribonuclease L- 4e-20
1x25_A128 Crystal Structure Of A Member Of Yjgf Family From S 7e-20
3m1x_A148 Crystal Structure Of A Putative Endoribonuclease L- 1e-19
3quw_A153 Crystal Structure Of Yeast Mmf1 Length = 153 4e-19
2uyj_A129 Crystal Structure Of E. Coli Tdcf With Bound Ethyle 4e-18
2uyn_A129 Crystal Structure Of E. Coli Tdcf With Bound 2-Keto 4e-18
1jd1_A129 Crystal Structure Of Yeo7_yeast Length = 129 4e-17
1qu9_A128 1.2 A Crystal Structure Of Yjgf Gene Product From E 4e-16
3vcz_A153 1.80 Angstrom Resolution Crystal Structure Of A Put 5e-16
3r0p_A127 Crystal Structure Of L-Psp Putative Endoribonucleas 8e-16
2cwj_A123 Crystal Structure Of Ape1501, A Putative Endonuclea 2e-15
1j7h_A130 Solution Structure Of Hi0719, A Hypothetical Protei 5e-15
3v4d_A134 Crystal Structure Of Rutc Protein A Member Of The Y 1e-09
3k12_A122 Crystal Structure Of An Uncharacterized Protein A6v 5e-09
3gtz_A124 Crystal Structure Of A Putative Translation Initiat 2e-04
3i7t_A149 Crystal Structure Of Rv2704, A Member Of Highly Con 4e-04
3kjj_A128 Crystal Structure Of Nmb1025, A Member Of Yjgf Prot 5e-04
>pdb|1ONI|A Chain A, Crystal Structure Of A Human P14.5, A Translational Inhibitor Reveals Different Mode Of Ligand Binding Near The Invariant Residues Of The Yjgf/uk114 Protein Family Length = 138 Back     alignment and structure 
Iteration: 1

 Score =  134 bits (337), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 94/151 (62%), Gaps = 28/151 (18%)
Query: 63  LKEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYV 122
           ++  + T KAP A+GPYSQA+  +  +++SG +G+ P                       
Sbjct: 6   IRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPS---------------------- 43
Query: 123 FESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIY 182
                 +G+ VS  + ++ +Q LKN+GEILKA+G D+++VVKTT+LLAD+ DF TVNEIY
Sbjct: 44  ------SGQLVSGGVAEEAKQALKNMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIY 97
Query: 183 AKYFPSPAPARATYQVAALPLDARVEIECIA 213
            +YF S  PARA YQVAALP  +R+EIE +A
Sbjct: 98  KQYFKSNFPARAAYQVAALPKGSRIEIEAVA 128
>pdb|1QAH|A Chain A, Crystal Structure Of Perchloric Acid Soluble Protein-A Translational Inhibitor Length = 136 Back     alignment and structure
>pdb|1NQ3|A Chain A, Crystal Structure Of The Mammalian Tumor Associated Antigen Uk114 Length = 136 Back     alignment and structure
>pdb|2CSL|A Chain A, Crystal Structure Of Ttha0137 From Thermus Thermophilus Hb8 Length = 124 Back     alignment and structure
>pdb|3L7Q|A Chain A, Crystal Structure Of Aldr From Streptococcus Mutans Length = 125 Back     alignment and structure
>pdb|2DYY|A Chain A, Crystal Structure Of Putative Translation Initiation Inhibitor Ph0854 From Pyrococcus Horikoshii Length = 126 Back     alignment and structure
>pdb|1QD9|A Chain A, Bacillus Subtilis Yabj Length = 124 Back     alignment and structure
>pdb|1XRG|A Chain A, Conserved Hypothetical Protein From Clostridium Thermocellum Cth-2968 Length = 156 Back     alignment and structure
>pdb|2B33|A Chain A, Crystal Structure Of A Putative Endoribonuclease (tm0215) From Thermotoga Maritima Msb8 At 2.30 A Resolution Length = 140 Back     alignment and structure
>pdb|3K0T|A Chain A, Crystal Structure Of Pspto -Psp Protein In Complex With D-Be From Pseudomonas Syringae Pv. Tomato Str. Dc3000 Length = 143 Back     alignment and structure
>pdb|3M4S|A Chain A, Crystal Structure Of A Putative Endoribonuclease L-Psp From Entamoeba Histolytica, Orthorhombic Form Length = 148 Back     alignment and structure
>pdb|3MQW|A Chain A, Crystal Structure Of A Putative Endoribonuclease L-Psp From Histolytica With Higher Solvent Content And An Ordered N-Te Length = 148 Back     alignment and structure
>pdb|1X25|A Chain A, Crystal Structure Of A Member Of Yjgf Family From Sulfolobus Tokodaii (st0811) Length = 128 Back     alignment and structure
>pdb|3M1X|A Chain A, Crystal Structure Of A Putative Endoribonuclease L-Psp From Entamoeba Histolytica, Rhomobohedral Form Length = 148 Back     alignment and structure
>pdb|3QUW|A Chain A, Crystal Structure Of Yeast Mmf1 Length = 153 Back     alignment and structure
>pdb|2UYJ|A Chain A, Crystal Structure Of E. Coli Tdcf With Bound Ethylene Glycol Length = 129 Back     alignment and structure
>pdb|2UYN|A Chain A, Crystal Structure Of E. Coli Tdcf With Bound 2-Ketobutyrate Length = 129 Back     alignment and structure
>pdb|1JD1|A Chain A, Crystal Structure Of Yeo7_yeast Length = 129 Back     alignment and structure
>pdb|1QU9|A Chain A, 1.2 A Crystal Structure Of Yjgf Gene Product From E. Coli Length = 128 Back     alignment and structure
>pdb|3VCZ|A Chain A, 1.80 Angstrom Resolution Crystal Structure Of A Putative Translation Initiation Inhibitor From Vibrio Vulnificus Cmcp6 Length = 153 Back     alignment and structure
>pdb|3R0P|A Chain A, Crystal Structure Of L-Psp Putative Endoribonuclease From Uncultured Organism Length = 127 Back     alignment and structure
>pdb|2CWJ|A Chain A, Crystal Structure Of Ape1501, A Putative Endonuclease From Aeropyrum Pernix Length = 123 Back     alignment and structure
>pdb|1J7H|A Chain A, Solution Structure Of Hi0719, A Hypothetical Protein From Haemophilus Influenzae Length = 130 Back     alignment and structure
>pdb|3V4D|A Chain A, Crystal Structure Of Rutc Protein A Member Of The Yjgf Family From E.Coli Length = 134 Back     alignment and structure
>pdb|3K12|A Chain A, Crystal Structure Of An Uncharacterized Protein A6v7t0 From Pseudomonas Aeruginosa Length = 122 Back     alignment and structure
>pdb|3GTZ|A Chain A, Crystal Structure Of A Putative Translation Initiation Inhibitor From Salmonella Typhimurium Length = 124 Back     alignment and structure
>pdb|3I7T|A Chain A, Crystal Structure Of Rv2704, A Member Of Highly Conserved YjgfYER057CUK114 FAMILY, FROM MYCOBACTERIUM TUBERCULOSIS Length = 149 Back     alignment and structure
>pdb|3KJJ|A Chain A, Crystal Structure Of Nmb1025, A Member Of Yjgf Protein Family, From Neisseria Meningitidis (Hexagonal Crystal Form) Length = 128 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3v4d_A134 Aminoacrylate peracid reductase RUTC; structural g 1e-67
2b33_A140 Protein synthesis inhibitor, putative; putative en 4e-67
3m1x_A148 Putative endoribonuclease L-PSP; structural genomi 8e-67
3r0p_A127 L-PSP putative endoribonuclease; hydrolase; 1.90A 3e-66
1xrg_A156 Putative translation initiation inhibitor, YJGF fa 4e-66
2dyy_A126 UPF0076 protein PH0854; putative translation initi 5e-66
1x25_A128 Hypothetical UPF0076 protein ST0811; YJGF-like pro 8e-66
3l7q_A125 Putative translation initiation inhibitor, ALDR R 1e-65
1qah_A136 Perchloric acid soluble protein; alpha-beta struct 2e-65
3quw_A153 Protein MMF1; chorismate mutase fold, intact mitoc 1e-64
1qd9_A124 Purine regulatory protein YABJ; perchloric acid so 1e-64
1jd1_A129 Hypothetical 13.9 kDa protein in FCY2-PET117 inter 1e-64
3k0t_A143 Endoribonuclease L-PSP, putative; glucose binding, 4e-64
2cwj_A123 Putative endonuclease; hydrolase, endoribonucrease 7e-64
2cvl_A124 TTHA0137, protein translation initiation inhibitor 9e-64
3lme_A138 Possible translation initiation inhibitor; structu 4e-62
3vcz_A153 Endoribonuclease L-PSP; virulence, pathogenesis, i 2e-61
1qu9_A128 YJGF protein; structural genomics; HET: CSP; 1.20A 2e-61
3lyb_A165 Putative endoribonuclease; structural genomics, PS 1e-59
1pf5_A131 Hypothetical protein YJGH; structural genomics, be 1e-52
3i7t_A149 RV2704, putative uncharacterized protein; siras, Y 1e-52
3i3f_A141 Hypothetical protein; structural genomics, niaid, 2e-48
2ig8_A144 Hypothetical protein PA3499; structural genomics, 3e-48
2ewc_A126 Conserved hypothetical protein; YJGF proteins fami 5e-46
3kjj_A128 NMB1025 protein; YJGF protein family, OPPF, struct 1e-45
3k12_A122 Uncharacterized protein A6V7T0; structural genomic 3e-45
3gtz_A124 Putative translation initiation inhibitor; structu 1e-43
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
3d01_A165 Uncharacterized protein; protein with unknown func 1e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
>3v4d_A Aminoacrylate peracid reductase RUTC; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 1.95A {Escherichia coli O6} Length = 134 Back     alignment and structure
 Score =  202 bits (517), Expect = 1e-67
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 28/153 (18%)

Query: 64  KEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVF 123
           K  ++   + A L P+     A+ +V+VSG L                            
Sbjct: 9   KSVIIPAGSSAPLAPFVPGTLADGVVYVSGTLAFDQH----------------------- 45

Query: 124 ESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYA 183
                     +D  + QT  VL+ I ++++ +G   + V   +I + D K++  +NEIYA
Sbjct: 46  -----NNVLFADDPKAQTRHVLETIRKVIETAGGTMADVTFNSIFITDWKNYAAINEIYA 100

Query: 184 KYFPSPAPARATYQVAALPLDARVEIECIAALP 216
           ++FP   PAR   Q   +  DA VEI  IA + 
Sbjct: 101 EFFPGDKPARFCIQCGLVKPDALVEIATIAHIA 133
>2b33_A Protein synthesis inhibitor, putative; putative endoribonuclease, STRU genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: d.79.1.1 Length = 140 Back     alignment and structure
>3m1x_A Putative endoribonuclease L-PSP; structural genomics, seattle structural genomics center for infectious disease, ssgcid, unknown function; HET: FLC; 1.20A {Entamoeba histolytica} PDB: 3m4s_A 3mqw_A* Length = 148 Back     alignment and structure
>3r0p_A L-PSP putative endoribonuclease; hydrolase; 1.90A {Uncultured organism} Length = 127 Back     alignment and structure
>1xrg_A Putative translation initiation inhibitor, YJGF family; conserved hypothetical protein, protein structure initiative, PSI; 2.20A {Clostridium thermocellum} SCOP: d.79.1.1 Length = 156 Back     alignment and structure
>2dyy_A UPF0076 protein PH0854; putative translation initiation inhibitor, trimer, structural genomics, NPPSFA; 2.60A {Pyrococcus horikoshii} Length = 126 Back     alignment and structure
>1x25_A Hypothetical UPF0076 protein ST0811; YJGF-like protein, archaea, structural genomics, UNK function; 2.00A {Sulfolobus tokodaii} SCOP: d.79.1.1 Length = 128 Back     alignment and structure
>3l7q_A Putative translation initiation inhibitor, ALDR R like protein; translation initiation inhibitor regulator-like; 2.50A {Streptococcus mutans} Length = 125 Back     alignment and structure
>1qah_A Perchloric acid soluble protein; alpha-beta structure; 1.80A {Rattus norvegicus} SCOP: d.79.1.1 PDB: 1oni_A 1nq3_A Length = 136 Back     alignment and structure
>3quw_A Protein MMF1; chorismate mutase fold, intact mitochondria maintenance, mitochondrial protein, protein binding; 1.75A {Saccharomyces cerevisiae} Length = 153 Back     alignment and structure
>1qd9_A Purine regulatory protein YABJ; perchloric acid soluble protein, purine regulation, YJGF/YER057C family, gene regulation; 1.70A {Bacillus subtilis} SCOP: d.79.1.1 Length = 124 Back     alignment and structure
>1jd1_A Hypothetical 13.9 kDa protein in FCY2-PET117 intergenic region; translation inhibitor, structural genomics, PSI; 1.70A {Saccharomyces cerevisiae} SCOP: d.79.1.1 Length = 129 Back     alignment and structure
>3k0t_A Endoribonuclease L-PSP, putative; glucose binding, ER stressor, sugar binding protein; HET: BGC; 2.10A {Pseudomonas syringae PV} Length = 143 Back     alignment and structure
>2cwj_A Putative endonuclease; hydrolase, endoribonucrease, structural GE NPPSFA, national project on protein structural and function analyses; 3.60A {Aeropyrum pernix} SCOP: d.79.1.1 Length = 123 Back     alignment and structure
>2cvl_A TTHA0137, protein translation initiation inhibitor; structural genomics, NPPSFA; 1.65A {Thermus thermophilus} SCOP: d.79.1.1 PDB: 2csl_A 2cw4_A Length = 124 Back     alignment and structure
>3lme_A Possible translation initiation inhibitor; structural genomics, RPA2473, PSI-2, protein structure initiative; 2.74A {Rhodopseudomonas palustris} Length = 138 Back     alignment and structure
>3vcz_A Endoribonuclease L-PSP; virulence, pathogenesis, infectious diseases, center for STR genomics of infectious diseases, csgid, translation; HET: GOL; 1.80A {Vibrio vulnificus} Length = 153 Back     alignment and structure
>1qu9_A YJGF protein; structural genomics; HET: CSP; 1.20A {Escherichia coli} SCOP: d.79.1.1 PDB: 1j7h_A 2uyk_A 2uyj_A 2uyn_A* 2uyp_A Length = 128 Back     alignment and structure
>3lyb_A Putative endoribonuclease; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.66A {Klebsiella pneumoniae} Length = 165 Back     alignment and structure
>1pf5_A Hypothetical protein YJGH; structural genomics, beta barrel, PSI, protein structure INI midwest center for structural genomics, MCSG; 2.50A {Escherichia coli} SCOP: d.79.1.1 Length = 131 Back     alignment and structure
>3i7t_A RV2704, putative uncharacterized protein; siras, YJGF/YER057C/UK114, homotrimer, quick SOAK NAI deriva unknown function; 1.93A {Mycobacterium tuberculosis} Length = 149 Back     alignment and structure
>3i3f_A Hypothetical protein; structural genomics, niaid, decode, infectious seattle structural genomics center for infectious disease, unknown function; 1.35A {Giardia lamblia} Length = 141 Back     alignment and structure
>2ig8_A Hypothetical protein PA3499; structural genomics, PSI-2, Pro structure initiative; 1.90A {Pseudomonas aeruginosa} Length = 144 Back     alignment and structure
>2ewc_A Conserved hypothetical protein; YJGF proteins family, COG025 putative translation initiation inhibitor; 2.15A {Streptococcus pyogenes} SCOP: d.79.1.1 Length = 126 Back     alignment and structure
>3kjj_A NMB1025 protein; YJGF protein family, OPPF, structural genomics, oxford protein production facility, UN function; 1.90A {Neisseria meningitidis serogroup B} PDB: 3kjk_A Length = 128 Back     alignment and structure
>3k12_A Uncharacterized protein A6V7T0; structural genomics, unknown function, PSI-2, protein struct initiative; 1.49A {Pseudomonas aeruginosa} Length = 122 Back     alignment and structure
>3gtz_A Putative translation initiation inhibitor; structural genomics, unknown function, PSI-2, protein struct initiative; 2.50A {Salmonella typhimurium} Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3d01_A Uncharacterized protein; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; HET: PG5; 1.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
3r0p_A127 L-PSP putative endoribonuclease; hydrolase; 1.90A 100.0
3quw_A153 Protein MMF1; chorismate mutase fold, intact mitoc 100.0
2dyy_A126 UPF0076 protein PH0854; putative translation initi 100.0
3l7q_A125 Putative translation initiation inhibitor, ALDR R 100.0
1jd1_A129 Hypothetical 13.9 kDa protein in FCY2-PET117 inter 100.0
1qah_A136 Perchloric acid soluble protein; alpha-beta struct 100.0
1x25_A128 Hypothetical UPF0076 protein ST0811; YJGF-like pro 100.0
3v4d_A134 Aminoacrylate peracid reductase RUTC; structural g 100.0
2b33_A140 Protein synthesis inhibitor, putative; putative en 100.0
3k0t_A143 Endoribonuclease L-PSP, putative; glucose binding, 100.0
2cvl_A124 TTHA0137, protein translation initiation inhibitor 100.0
1qd9_A124 Purine regulatory protein YABJ; perchloric acid so 100.0
1qu9_A128 YJGF protein; structural genomics; HET: CSP; 1.20A 100.0
3m1x_A148 Putative endoribonuclease L-PSP; structural genomi 100.0
2cwj_A123 Putative endonuclease; hydrolase, endoribonucrease 100.0
1xrg_A156 Putative translation initiation inhibitor, YJGF fa 100.0
3vcz_A153 Endoribonuclease L-PSP; virulence, pathogenesis, i 100.0
3lme_A138 Possible translation initiation inhibitor; structu 100.0
3lyb_A165 Putative endoribonuclease; structural genomics, PS 100.0
1pf5_A131 Hypothetical protein YJGH; structural genomics, be 100.0
2ig8_A144 Hypothetical protein PA3499; structural genomics, 100.0
3i7t_A149 RV2704, putative uncharacterized protein; siras, Y 100.0
3i3f_A141 Hypothetical protein; structural genomics, niaid, 99.98
2otm_A154 Hypothetical protein; structural genomics, joint c 99.97
3kjj_A128 NMB1025 protein; YJGF protein family, OPPF, struct 99.97
3d01_A165 Uncharacterized protein; protein with unknown func 99.97
2ewc_A126 Conserved hypothetical protein; YJGF proteins fami 99.97
3k12_A122 Uncharacterized protein A6V7T0; structural genomic 99.97
3gtz_A124 Putative translation initiation inhibitor; structu 99.97
>3r0p_A L-PSP putative endoribonuclease; hydrolase; 1.90A {Uncultured organism} SCOP: d.79.1.0 Back     alignment and structure
Probab=100.00  E-value=7.3e-37  Score=241.93  Aligned_cols=124  Identities=38%  Similarity=0.628  Sum_probs=119.1

Q ss_pred             ccccccCCCCCCCCCCccEEEECCEEEEeeeccCCCCcccccccccccceeeeeeecccccCCcccCccccccHHHHHHH
Q 027808           64 KEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQ  143 (218)
Q Consensus        64 ~~~i~~~~~p~~~gpYS~av~~g~~vfvSGq~~~dp~~~~~~~~~~aG~~~~~~~~~~~~~~~~~tG~~~~~di~~Qt~~  143 (218)
                      ++.|++++.|+|.|+|||++++||++|+|||+|+|++                            +|++..+|+++|+++
T Consensus         4 ~~~i~~~~~p~~~g~ys~av~~g~~l~vSGq~~~~~~----------------------------~g~~~~~d~~~Q~~~   55 (127)
T 3r0p_A            4 KAIIHSDNAPAAIGTYSQAVKVNNTVYLSGQIPLDPV----------------------------TMQLVEGDFAVQAHQ   55 (127)
T ss_dssp             CEEECCTTSCCCCSSCCSEEEETTEEEEEEECSBCTT----------------------------TSSBCSSCHHHHHHH
T ss_pred             ceEeCCCCCCCCCCCCCCeEEECCEEEEeccCCcCCC----------------------------CCcCCCCCHHHHHHH
Confidence            5679999999999999999999999999999999998                            677767899999999


Q ss_pred             HHHHHHHHHHHcCCCccceEEEEEEecCCCCHHHHHHHHHHhCCCCCCceEEEEcCCCCCCceEEEEEEEEe
Q 027808          144 VLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAAL  215 (218)
Q Consensus       144 vl~nI~~iL~~aG~~l~dVvkvtvyl~d~~df~~vnev~~e~F~~~~PArt~V~V~~Lp~~~lVEIEaiA~~  215 (218)
                      +|+||+++|+++|++++||+|+++|++|++||+.+|++|.+||++++|+|++++|+.||+|++||||++|++
T Consensus        56 ~l~ni~~~L~~ag~~l~~vvk~~vyl~d~~~~~~~~~v~~~~f~~~~Part~v~V~~L~~~~~VEIe~iA~~  127 (127)
T 3r0p_A           56 VFKNLRAVCEAAGGGLRDIVKLNVYLTDLANFPIVNEVMGQYFQAPYPARAAIGINQLPRASLIEADGIMVI  127 (127)
T ss_dssp             HHHHHHHHHHHTTSCGGGEEEEEEEESCGGGHHHHHHHHHHHCCSSCCEEEEEECSBCGGGCSEEEEEEEEC
T ss_pred             HHHHHHHHHHHhCCCHHHEEEEEEEEcCHHHHHHHHHHHHHHcCCCCCcEEEEEcccCCCCCEEEEEEEEEC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999975
>3quw_A Protein MMF1; chorismate mutase fold, intact mitochondria maintenance, mitochondrial protein, protein binding; 1.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2dyy_A UPF0076 protein PH0854; putative translation initiation inhibitor, trimer, structural genomics, NPPSFA; 2.60A {Pyrococcus horikoshii} Back     alignment and structure
>3l7q_A Putative translation initiation inhibitor, ALDR R like protein; translation initiation inhibitor regulator-like; 2.50A {Streptococcus mutans} SCOP: d.79.1.0 Back     alignment and structure
>1jd1_A Hypothetical 13.9 kDa protein in FCY2-PET117 intergenic region; translation inhibitor, structural genomics, PSI; 1.70A {Saccharomyces cerevisiae} SCOP: d.79.1.1 Back     alignment and structure
>1qah_A Perchloric acid soluble protein; alpha-beta structure; 1.80A {Rattus norvegicus} SCOP: d.79.1.1 PDB: 1oni_A 1nq3_A Back     alignment and structure
>1x25_A Hypothetical UPF0076 protein ST0811; YJGF-like protein, archaea, structural genomics, UNK function; 2.00A {Sulfolobus tokodaii} SCOP: d.79.1.1 Back     alignment and structure
>3v4d_A Aminoacrylate peracid reductase RUTC; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 1.95A {Escherichia coli O6} Back     alignment and structure
>2b33_A Protein synthesis inhibitor, putative; putative endoribonuclease, STRU genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: d.79.1.1 Back     alignment and structure
>3k0t_A Endoribonuclease L-PSP, putative; glucose binding, ER stressor, sugar binding protein; HET: BGC; 2.10A {Pseudomonas syringae PV} Back     alignment and structure
>2cvl_A TTHA0137, protein translation initiation inhibitor; structural genomics, NPPSFA; 1.65A {Thermus thermophilus} SCOP: d.79.1.1 PDB: 2csl_A 2cw4_A Back     alignment and structure
>1qd9_A Purine regulatory protein YABJ; perchloric acid soluble protein, purine regulation, YJGF/YER057C family, gene regulation; 1.70A {Bacillus subtilis} SCOP: d.79.1.1 Back     alignment and structure
>1qu9_A YJGF protein; structural genomics; HET: CSP; 1.20A {Escherichia coli} SCOP: d.79.1.1 PDB: 1j7h_A 2uyk_A 2uyj_A 2uyn_A* 2uyp_A Back     alignment and structure
>3m1x_A Putative endoribonuclease L-PSP; structural genomics, seattle structural genomics center for infectious disease, ssgcid, unknown function; HET: FLC; 1.20A {Entamoeba histolytica} PDB: 3m4s_A 3mqw_A* Back     alignment and structure
>2cwj_A Putative endonuclease; hydrolase, endoribonucrease, structural GE NPPSFA, national project on protein structural and function analyses; 3.60A {Aeropyrum pernix} SCOP: d.79.1.1 Back     alignment and structure
>1xrg_A Putative translation initiation inhibitor, YJGF family; conserved hypothetical protein, protein structure initiative, PSI; 2.20A {Clostridium thermocellum} SCOP: d.79.1.1 Back     alignment and structure
>3vcz_A Endoribonuclease L-PSP; virulence, pathogenesis, infectious diseases, center for STR genomics of infectious diseases, csgid, translation; HET: GOL; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3lme_A Possible translation initiation inhibitor; structural genomics, RPA2473, PSI-2, protein structure initiative; 2.74A {Rhodopseudomonas palustris} SCOP: d.79.1.0 Back     alignment and structure
>3lyb_A Putative endoribonuclease; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.66A {Klebsiella pneumoniae} Back     alignment and structure
>1pf5_A Hypothetical protein YJGH; structural genomics, beta barrel, PSI, protein structure INI midwest center for structural genomics, MCSG; 2.50A {Escherichia coli} SCOP: d.79.1.1 Back     alignment and structure
>2ig8_A Hypothetical protein PA3499; structural genomics, PSI-2, Pro structure initiative; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3i7t_A RV2704, putative uncharacterized protein; siras, YJGF/YER057C/UK114, homotrimer, quick SOAK NAI deriva unknown function; 1.93A {Mycobacterium tuberculosis} Back     alignment and structure
>3i3f_A Hypothetical protein; structural genomics, niaid, decode, infectious seattle structural genomics center for infectious disease, unknown function; 1.35A {Giardia lamblia} Back     alignment and structure
>2otm_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; 1.85A {Shewanella oneidensis} SCOP: d.79.1.1 Back     alignment and structure
>3kjj_A NMB1025 protein; YJGF protein family, OPPF, structural genomics, oxford protein production facility, UN function; 1.90A {Neisseria meningitidis serogroup B} PDB: 3kjk_A Back     alignment and structure
>3d01_A Uncharacterized protein; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; HET: PG5; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ewc_A Conserved hypothetical protein; YJGF proteins family, COG025 putative translation initiation inhibitor; 2.15A {Streptococcus pyogenes} SCOP: d.79.1.1 Back     alignment and structure
>3k12_A Uncharacterized protein A6V7T0; structural genomics, unknown function, PSI-2, protein struct initiative; 1.49A {Pseudomonas aeruginosa} Back     alignment and structure
>3gtz_A Putative translation initiation inhibitor; structural genomics, unknown function, PSI-2, protein struct initiative; 2.50A {Salmonella typhimurium} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1qaha_132 d.79.1.1 (A:) 14.5 kda translational inhibitor pro 3e-32
d2cwja1116 d.79.1.1 (A:4-119) Putative endonuclease APE1501 { 3e-31
d2b33a1126 d.79.1.1 (A:2-127) Putative protein synthesis inhi 1e-30
d1x25a1124 d.79.1.1 (A:1-124) Hypothetical protein ST0811 {Su 1e-30
d1xrga_125 d.79.1.1 (A:) Purine regulatory protein YabJ {Clos 2e-30
d1qu9a_127 d.79.1.1 (A:) Conserved 'hypothetical' protein Yjg 2e-29
d1qd9a_124 d.79.1.1 (A:) Purine regulatory protein YabJ {Baci 7e-29
d2cvla1124 d.79.1.1 (A:1-124) Putative translation intiation 7e-27
d1jd1a_126 d.79.1.1 (A:) Highdosage growth inhibitor YER057cp 3e-25
d2otma1152 d.79.1.1 (A:2-153) Hypothetical protein SO1960 {Sh 5e-24
d2ewca1120 d.79.1.1 (A:3-122) Hypothetical protein SPy2060 {S 3e-21
d1pf5a_130 d.79.1.1 (A:) Hypothetical protein YjgH {Escherich 1e-17
>d1qaha_ d.79.1.1 (A:) 14.5 kda translational inhibitor protein, L-PSP {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: YjgF-like
family: YjgF/L-PSP
domain: 14.5 kda translational inhibitor protein, L-PSP
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  111 bits (279), Expect = 3e-32
 Identities = 65/151 (43%), Positives = 90/151 (59%), Gaps = 28/151 (18%)

Query: 64  KEAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVF 123
           ++ + T+KAPAA+G YSQA+  +  ++VSG +G+ P                        
Sbjct: 5   RKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSG--------------------- 43

Query: 124 ESPFQTGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYA 183
                  + V   + ++ +Q LKN+GEILKA+G D+++VVKTT+LLAD+ DF TVNEIY 
Sbjct: 44  -------QLVPGGVAEEAKQALKNLGEILKAAGCDFTNVVKTTVLLADINDFGTVNEIYK 96

Query: 184 KYFPSPAPARATYQVAALPLDARVEIECIAA 214
            YF    PARA YQVAALP  +R+EIE IA 
Sbjct: 97  TYFQGNLPARAAYQVAALPKGSRIEIEAIAV 127
>d2cwja1 d.79.1.1 (A:4-119) Putative endonuclease APE1501 {Aeropyrum pernix [TaxId: 56636]} Length = 116 Back     information, alignment and structure
>d2b33a1 d.79.1.1 (A:2-127) Putative protein synthesis inhibitor TM0215 {Thermotoga maritima [TaxId: 2336]} Length = 126 Back     information, alignment and structure
>d1x25a1 d.79.1.1 (A:1-124) Hypothetical protein ST0811 {Sulfolobus tokodaii [TaxId: 111955]} Length = 124 Back     information, alignment and structure
>d1xrga_ d.79.1.1 (A:) Purine regulatory protein YabJ {Clostridium thermocellum [TaxId: 1515]} Length = 125 Back     information, alignment and structure
>d1qu9a_ d.79.1.1 (A:) Conserved 'hypothetical' protein YjgF {Escherichia coli [TaxId: 562]} Length = 127 Back     information, alignment and structure
>d1qd9a_ d.79.1.1 (A:) Purine regulatory protein YabJ {Bacillus subtilis [TaxId: 1423]} Length = 124 Back     information, alignment and structure
>d2cvla1 d.79.1.1 (A:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]} Length = 124 Back     information, alignment and structure
>d1jd1a_ d.79.1.1 (A:) Highdosage growth inhibitor YER057cp (YEO7_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 126 Back     information, alignment and structure
>d2otma1 d.79.1.1 (A:2-153) Hypothetical protein SO1960 {Shewanella oneidensis [TaxId: 70863]} Length = 152 Back     information, alignment and structure
>d2ewca1 d.79.1.1 (A:3-122) Hypothetical protein SPy2060 {Streptococcus pyogenes [TaxId: 1314]} Length = 120 Back     information, alignment and structure
>d1pf5a_ d.79.1.1 (A:) Hypothetical protein YjgH {Escherichia coli [TaxId: 562]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1qd9a_124 Purine regulatory protein YabJ {Bacillus subtilis 100.0
d2cvla1124 Putative translation intiation inhibitor TTHA0137 100.0
d2b33a1126 Putative protein synthesis inhibitor TM0215 {Therm 100.0
d1xrga_125 Purine regulatory protein YabJ {Clostridium thermo 100.0
d1x25a1124 Hypothetical protein ST0811 {Sulfolobus tokodaii [ 100.0
d1qaha_132 14.5 kda translational inhibitor protein, L-PSP {R 100.0
d1jd1a_126 Highdosage growth inhibitor YER057cp (YEO7_YEAST) 100.0
d1qu9a_127 Conserved 'hypothetical' protein YjgF {Escherichia 100.0
d2cwja1116 Putative endonuclease APE1501 {Aeropyrum pernix [T 100.0
d1pf5a_130 Hypothetical protein YjgH {Escherichia coli [TaxId 99.96
d2ewca1120 Hypothetical protein SPy2060 {Streptococcus pyogen 99.96
d2otma1152 Hypothetical protein SO1960 {Shewanella oneidensis 99.95
>d1qd9a_ d.79.1.1 (A:) Purine regulatory protein YabJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: YjgF-like
family: YjgF/L-PSP
domain: Purine regulatory protein YabJ
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=9.2e-36  Score=232.35  Aligned_cols=123  Identities=47%  Similarity=0.789  Sum_probs=117.4

Q ss_pred             cccccCCCCCCCCCCccEEEECCEEEEeeeccCCCCcccccccccccceeeeeeecccccCCcccCccccccHHHHHHHH
Q 027808           65 EAVVTNKAPAALGPYSQAIKANNLVFVSGVLGLVPEVCYVSLLSFIGTISCRILTIYVFESPFQTGKFVSDTIEDQTEQV  144 (218)
Q Consensus        65 ~~i~~~~~p~~~gpYS~av~~g~~vfvSGq~~~dp~~~~~~~~~~aG~~~~~~~~~~~~~~~~~tG~~~~~di~~Qt~~v  144 (218)
                      +.|++.++|+|.|||||++++|+++|+|||+|+|++                             +...++|+++|++++
T Consensus         2 ~~i~~~~aP~~~gpys~av~~g~~lfiSGq~~~d~~-----------------------------~~~~~~~~~~Q~~~~   52 (124)
T d1qd9a_           2 KAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPS-----------------------------GEMVNGDIKEQTHQV   52 (124)
T ss_dssp             EEECCTTSCCCCSSCBSEEEETTEEEECCBCSBCTT-----------------------------SCBCCSCHHHHHHHH
T ss_pred             ccccCCCCCCCcCCCcceEEECCEEEEEeeeccccc-----------------------------ceeecchhHHHHHHH
Confidence            468999999999999999999999999999999997                             455688999999999


Q ss_pred             HHHHHHHHHHcCCCccceEEEEEEecCCCCHHHHHHHHHHhCCCCCCceEEEEcCCCCCCceEEEEEEEEec
Q 027808          145 LKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIAALP  216 (218)
Q Consensus       145 l~nI~~iL~~aG~~l~dVvkvtvyl~d~~df~~vnev~~e~F~~~~PArt~V~V~~Lp~~~lVEIEaiA~~p  216 (218)
                      |+||+++|+++|++++||+|+++|++|++||+.++++|.+||++++|+|++++|+.||++++||||++|++.
T Consensus        53 l~ni~~iL~~aG~~~~div~~~v~~~d~~~~~~~~~~~~~~f~~~~Pa~t~v~v~~L~~~~~VEIe~iA~vk  124 (124)
T d1qd9a_          53 FSNLKAVLEEAGASFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEVIALVK  124 (124)
T ss_dssp             HHHHHHHHHHTTCCGGGEEEEEEEESCGGGHHHHHHHHHHHSSSCCCEEEEEECSBCGGGCSEEEEEEEECC
T ss_pred             HHHHHHHHHHcCCCcccCceEEEEeCCHHHHHHHHHHHHhhcCCCCCccEEEEECcCCCCCEEEEEEEEEeC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999873
>d2cvla1 d.79.1.1 (A:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b33a1 d.79.1.1 (A:2-127) Putative protein synthesis inhibitor TM0215 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xrga_ d.79.1.1 (A:) Purine regulatory protein YabJ {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1x25a1 d.79.1.1 (A:1-124) Hypothetical protein ST0811 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qaha_ d.79.1.1 (A:) 14.5 kda translational inhibitor protein, L-PSP {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jd1a_ d.79.1.1 (A:) Highdosage growth inhibitor YER057cp (YEO7_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qu9a_ d.79.1.1 (A:) Conserved 'hypothetical' protein YjgF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cwja1 d.79.1.1 (A:4-119) Putative endonuclease APE1501 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pf5a_ d.79.1.1 (A:) Hypothetical protein YjgH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ewca1 d.79.1.1 (A:3-122) Hypothetical protein SPy2060 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2otma1 d.79.1.1 (A:2-153) Hypothetical protein SO1960 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure