Citrus Sinensis ID: 028086
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 225439029 | 228 | PREDICTED: nudix hydrolase 26, chloropla | 0.995 | 0.934 | 0.677 | 1e-72 | |
| 296085800 | 247 | unnamed protein product [Vitis vinifera] | 0.925 | 0.801 | 0.705 | 2e-72 | |
| 224113401 | 163 | predicted protein [Populus trichocarpa] | 0.733 | 0.963 | 0.814 | 6e-72 | |
| 351723651 | 201 | uncharacterized protein LOC100499956 [Gl | 0.915 | 0.975 | 0.643 | 6e-72 | |
| 1888557 | 199 | diadenosine 5',5'''-P1,P4-tetraphosphate | 0.906 | 0.974 | 0.661 | 1e-71 | |
| 224097582 | 161 | predicted protein [Populus trichocarpa] | 0.728 | 0.968 | 0.807 | 5e-71 | |
| 356576388 | 199 | PREDICTED: nudix hydrolase 26, chloropla | 0.831 | 0.894 | 0.687 | 4e-70 | |
| 15228345 | 216 | nudix hydrolase 26 [Arabidopsis thaliana | 0.855 | 0.847 | 0.670 | 4e-70 | |
| 297829614 | 222 | hypothetical protein ARALYDRAFT_317863 [ | 0.855 | 0.824 | 0.668 | 5e-70 | |
| 449434516 | 196 | PREDICTED: nudix hydrolase 26, chloropla | 0.728 | 0.795 | 0.770 | 7e-70 |
| >gi|225439029|ref|XP_002263671.1| PREDICTED: nudix hydrolase 26, chloroplastic isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 278 bits (710), Expect = 1e-72, Method: Compositional matrix adjust.
Identities = 149/220 (67%), Positives = 169/220 (76%), Gaps = 7/220 (3%)
Query: 1 MALCLSRSFSSYSQLHLSSLLSRCKPNFTSPNYPHKLPKSTNLPLVHHQNQIC-SSSYSM 59
M LC R S L P S NYP K K TN PL+ ++ SSS SM
Sbjct: 4 MTLC-QRFLFCTSPFSHQRLQVVANPTLISWNYPCKFQKFTNQPLLCKRSHTAISSSSSM 62
Query: 60 DAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQN-----EDPKVAALRELKEETG 114
++PPEGYRRNVG+CLIN SKKIFAASRLDIPD+WQMPQ EDP+ AA+RELKEETG
Sbjct: 63 ESPPEGYRRNVGVCLINPSKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAMRELKEETG 122
Query: 115 VSSAEVLAEVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKS 174
V+SAEVLAEVPYW+TYDFPP+VRE+LK+QWG DWKGQ QKWFLLKFTGKEEEINLLGD++
Sbjct: 123 VASAEVLAEVPYWVTYDFPPQVRERLKNQWGSDWKGQVQKWFLLKFTGKEEEINLLGDET 182
Query: 175 EKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHLQ 214
K EFGEW WMSP+Q++E AVDFKKPVY+EV TVF PHLQ
Sbjct: 183 AKAEFGEWSWMSPDQVVELAVDFKKPVYREVLTVFAPHLQ 222
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296085800|emb|CBI31124.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224113401|ref|XP_002316484.1| predicted protein [Populus trichocarpa] gi|222865524|gb|EEF02655.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351723651|ref|NP_001238566.1| uncharacterized protein LOC100499956 [Glycine max] gi|255627971|gb|ACU14330.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|1888557|gb|AAC49902.1| diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase [Lupinus angustifolius] | Back alignment and taxonomy information |
|---|
| >gi|224097582|ref|XP_002310996.1| predicted protein [Populus trichocarpa] gi|222850816|gb|EEE88363.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356576388|ref|XP_003556314.1| PREDICTED: nudix hydrolase 26, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15228345|ref|NP_187673.1| nudix hydrolase 26 [Arabidopsis thaliana] gi|75308944|sp|Q9CAF2.1|NUD26_ARATH RecName: Full=Nudix hydrolase 26, chloroplastic; Short=AtNUDT26; AltName: Full=Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical); Flags: Precursor gi|12322789|gb|AAG51386.1|AC011560_18 putative diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; 27094-25792 [Arabidopsis thaliana] gi|13877849|gb|AAK44002.1|AF370187_1 putative diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase [Arabidopsis thaliana] gi|16323514|gb|AAL15251.1| putative diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase [Arabidopsis thaliana] gi|332641414|gb|AEE74935.1| nudix hydrolase 26 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297829614|ref|XP_002882689.1| hypothetical protein ARALYDRAFT_317863 [Arabidopsis lyrata subsp. lyrata] gi|297328529|gb|EFH58948.1| hypothetical protein ARALYDRAFT_317863 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449434516|ref|XP_004135042.1| PREDICTED: nudix hydrolase 26, chloroplastic-like [Cucumis sativus] gi|449531509|ref|XP_004172728.1| PREDICTED: nudix hydrolase 26, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| TAIR|locus:2075840 | 216 | NUDX26 "AT3G10620" [Arabidopsi | 0.855 | 0.847 | 0.685 | 4.8e-71 | |
| TAIR|locus:2164220 | 227 | NUDX27 "AT5G06340" [Arabidopsi | 0.808 | 0.762 | 0.578 | 2.4e-53 | |
| TAIR|locus:2202487 | 175 | NUDX25 "AT1G30110" [Arabidopsi | 0.700 | 0.857 | 0.556 | 6.9e-47 | |
| TIGR_CMR|SPO_3585 | 161 | SPO_3585 "hydrolase, NUDIX fam | 0.663 | 0.881 | 0.423 | 2.1e-29 | |
| TIGR_CMR|CBU_1551 | 228 | CBU_1551 "MutT/nudix family pr | 0.682 | 0.640 | 0.375 | 6.1e-23 | |
| UNIPROTKB|Q47Y27 | 171 | rppH "RNA pyrophosphohydrolase | 0.654 | 0.818 | 0.379 | 2.1e-20 | |
| TIGR_CMR|CPS_3625 | 171 | CPS_3625 "(di)nucleoside polyp | 0.654 | 0.818 | 0.379 | 2.1e-20 | |
| TIGR_CMR|CJE_0684 | 156 | CJE_0684 "(di)nucleoside polyp | 0.640 | 0.878 | 0.374 | 1.5e-19 | |
| UNIPROTKB|Q9KU53 | 172 | rppH "RNA pyrophosphohydrolase | 0.644 | 0.802 | 0.361 | 1.7e-18 | |
| TIGR_CMR|VC_0671 | 172 | VC_0671 "MutT/nudix family pro | 0.644 | 0.802 | 0.361 | 1.7e-18 |
| TAIR|locus:2075840 NUDX26 "AT3G10620" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 719 (258.2 bits), Expect = 4.8e-71, P = 4.8e-71
Identities = 133/194 (68%), Positives = 159/194 (81%)
Query: 32 NYPHKLPKSTNLPLVHH--QNQICSSSY----SMDAPPEGYRRNVGICLINSSKKIFAAS 85
NYP K K ++LP +H ++++ SSS SM++PPEGYRRNVG+CL+NSSKKIF AS
Sbjct: 23 NYPSKPIKFSSLPFLHRCRKSRVSSSSARCCSSMESPPEGYRRNVGVCLMNSSKKIFTAS 82
Query: 86 RLDIPDSWQMPQN-----EDPKVAALRELKEETGVSSAEVLAEVPYWLTYDFPPEVREKL 140
RLDIP +WQMPQ EDP+VA +RELKEETGV SAE+LAE P+W+TYDFPP+VREKL
Sbjct: 83 RLDIPSAWQMPQGGIDEGEDPRVAVMRELKEETGVHSAEILAEAPHWITYDFPPDVREKL 142
Query: 141 KHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKP 200
K +WG DWKGQAQKWFLLKFTGK+EEINLLGD +EKPEFGEW W SP+Q++E AV+FKKP
Sbjct: 143 KVRWGSDWKGQAQKWFLLKFTGKDEEINLLGDGTEKPEFGEWSWTSPDQVVENAVEFKKP 202
Query: 201 VYKEVFTVFTPHLQ 214
VYKEV + F HLQ
Sbjct: 203 VYKEVMSAFASHLQ 216
|
|
| TAIR|locus:2164220 NUDX27 "AT5G06340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202487 NUDX25 "AT1G30110" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_3585 SPO_3585 "hydrolase, NUDIX family, NudH subfamily" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1551 CBU_1551 "MutT/nudix family protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q47Y27 rppH "RNA pyrophosphohydrolase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3625 CPS_3625 "(di)nucleoside polyphosphate hydrolase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_0684 CJE_0684 "(di)nucleoside polyphosphate hydrolase" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KU53 rppH "RNA pyrophosphohydrolase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0671 VC_0671 "MutT/nudix family protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00033605001 | SubName- Full=Chromosome chr8 scaffold_68, whole genome shotgun sequence; (228 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00016858001 | • | 0.402 | |||||||||
| GSVIVG00030263001 | • | 0.400 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| cd03671 | 147 | cd03671, Ap4A_hydrolase_plant_like, Diadenosine te | 1e-70 | |
| PRK00714 | 156 | PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi | 3e-63 | |
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 4e-18 | |
| COG0494 | 161 | COG0494, MutT, NTP pyrophosphohydrolases including | 3e-14 | |
| cd02883 | 123 | cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup | 6e-10 | |
| cd03428 | 130 | cd03428, Ap4A_hydrolase_human_like, Diadenosine te | 2e-06 | |
| cd04664 | 129 | cd04664, Nudix_Hydrolase_7, Members of the Nudix h | 7e-06 | |
| cd03424 | 137 | cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase | 5e-05 | |
| cd03673 | 131 | cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate | 8e-05 | |
| cd03425 | 124 | cd03425, MutT_pyrophosphohydrolase, The MutT pyrop | 6e-04 | |
| PRK09438 | 148 | PRK09438, nudB, dihydroneopterin triphosphate pyro | 0.004 |
| >gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
Score = 211 bits (539), Expect = 1e-70
Identities = 74/152 (48%), Positives = 99/152 (65%), Gaps = 12/152 (7%)
Query: 65 GYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ-----NEDPKVAALRELKEETGV--SS 117
YR NVG+ L N K+F R+D P +WQ PQ EDP+ AALREL+EETG+ S
Sbjct: 1 PYRPNVGVVLFNEDGKVFVGRRIDTPGAWQFPQGGIDEGEDPEQAALRELEEETGLDPDS 60
Query: 118 AEVLAEVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKP 177
E++AE+P WL YD PPE++ K+ WGG ++GQ QKWFL +FTG + EI+L E P
Sbjct: 61 VEIIAEIPDWLRYDLPPELKLKI---WGGRYRGQEQKWFLFRFTGDDSEIDLNAP--EHP 115
Query: 178 EFGEWKWMSPEQILERAVDFKKPVYKEVFTVF 209
EF EW+W+ E++ + V FK+PVY+ V F
Sbjct: 116 EFDEWRWVPLEELPDLIVPFKRPVYEAVLKEF 147
|
Members of this family are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant enzymes fall into one group (represented by this subfamily) and fungi/animals/archaea enzymes fall into another. Bacterial enzymes are found in both subfamilies. Ap4A is a potential by-product of aminoacyl tRNA synthesis, and accumulation of Ap4A has been implicated in a range of biological events, such as DNA replication, cellular differentiation, heat shock, metabolic stress, and apoptosis. Ap4A hydrolase cleaves Ap4A asymmetrically into ATP and AMP. It is important in the invasive properties of bacteria and thus presents a potential target for the inhibition of such invasive bacteria. Besides the signature nudix motif (G[X5]E[X7]REUXEEXGU where U is Ile, Leu, or Val), Ap4A hydrolase is structurally similar to the other members of the nudix superfamily with some degree of variations. Several regions in the sequences are poorly defined and substrate and metal binding sites are only predicted based on kinetic studies. Length = 147 |
| >gnl|CDD|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240022 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239517 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >gnl|CDD|236516 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.92 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.91 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.84 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.78 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.77 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.76 | |
| PLN02325 | 144 | nudix hydrolase | 99.76 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.75 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.75 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.75 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.74 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.74 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.74 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.74 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.73 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.73 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.73 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.73 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.72 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.72 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.71 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.71 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.7 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.7 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.7 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.69 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.69 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.68 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.67 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.67 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.67 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.67 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.67 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.66 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.66 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.66 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.65 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.65 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.65 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.64 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.64 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.64 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.64 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.64 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.64 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.63 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.63 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.63 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.62 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.62 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.62 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.62 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.61 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 99.61 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.61 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.61 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.61 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.6 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.6 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.59 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.55 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.54 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.52 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 99.52 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.5 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.46 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.44 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.43 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.42 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.38 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 99.38 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 99.38 | |
| KOG2839 | 145 | consensus Diadenosine and diphosphoinositol polyph | 99.31 | |
| PLN02709 | 222 | nudix hydrolase | 99.28 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 99.28 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.28 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.27 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.25 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.16 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 99.14 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 99.11 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 99.11 | |
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 99.08 | |
| KOG3084 | 345 | consensus NADH pyrophosphatase I of the Nudix fami | 99.02 | |
| KOG0648 | 295 | consensus Predicted NUDIX hydrolase FGF-2 and rela | 98.96 | |
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 98.94 | |
| KOG3041 | 225 | consensus Nucleoside diphosphate-sugar hydrolase o | 98.89 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 98.81 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 98.8 | |
| KOG3069 | 246 | consensus Peroxisomal NUDIX hydrolase [Replication | 98.67 | |
| KOG0142 | 225 | consensus Isopentenyl pyrophosphate:dimethylallyl | 98.18 | |
| PLN02839 | 372 | nudix hydrolase | 98.07 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 97.86 | |
| KOG2937 | 348 | consensus Decapping enzyme complex, predicted pyro | 97.14 | |
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 96.15 | |
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 96.02 | |
| KOG4195 | 275 | consensus Transient receptor potential-related cha | 95.27 | |
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 94.85 | |
| KOG4548 | 263 | consensus Mitochondrial ribosomal protein L17 [Tra | 93.74 | |
| PRK13910 | 289 | DNA glycosylase MutY; Provisional | 91.51 | |
| KOG4313 | 306 | consensus Thiamine pyrophosphokinase [Nucleotide t | 90.82 | |
| TIGR01084 | 275 | mutY A/G-specific adenine glycosylase. This equiva | 88.46 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 85.01 | |
| COG1194 | 342 | MutY A/G-specific DNA glycosylase [DNA replication | 84.36 | |
| KOG1689 | 221 | consensus mRNA cleavage factor I subunit [RNA proc | 84.03 |
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
Probab=99.92 E-value=1.4e-23 Score=167.28 Aligned_cols=144 Identities=44% Similarity=0.824 Sum_probs=115.8
Q ss_pred CCccceEEEEEEecCCcEEEEeecCCCCCeecCCC-----CCHHHHHHHHHHHHhCCCc--ceeeeeccceEEecCCchh
Q 028086 64 EGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQN-----EDPKVAALRELKEETGVSS--AEVLAEVPYWLTYDFPPEV 136 (214)
Q Consensus 64 ~~~~~~v~vvI~~~~g~vLL~rR~~~~g~W~lPgG-----Es~~eAA~REl~EETGl~~--~~~l~~~~~~~~~~~p~~~ 136 (214)
..+|++|+++|+|.+|+|||++|.+.++.|++||| |++.+||.||++||||++. .++++....++.|++|...
T Consensus 5 ~~~~~~v~~~i~~~~g~vLL~~r~~~~~~w~~P~G~~~~gE~~~~aa~REl~EEtG~~~~~~~~~~~~~~~~~y~~~~~~ 84 (156)
T PRK00714 5 DGYRPNVGIILLNRQGQVFWGRRIGQGHSWQFPQGGIDPGETPEQAMYRELYEEVGLRPEDVEILAETRDWLRYDLPKRL 84 (156)
T ss_pred CCCCCeEEEEEEecCCEEEEEEEcCCCCeEECCcccCCCCcCHHHHHHHHHHHHhCCCccceEEEEEcCCeEEecCcHHH
Confidence 36899999999999999999999876699999999 9999999999999999984 4556666667788887654
Q ss_pred hhhhccccCCCccCceEEEEEEEEeCCcceeeccCCCCCcCceeeEEEeChhHHhhcCccCCHHHHHHHHHhhcccc
Q 028086 137 REKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHL 213 (214)
Q Consensus 137 ~~~l~~~~~~~~~~~~~~~fl~~~~~~~~~i~l~~~~~~~~E~~~~~Wv~~~el~~~~~~~~~~~~~~~l~~~~~~~ 213 (214)
.. . ..+.+.++..+||+++..+....+.++. .+++|+.+++|++++++.+++.++++.+++++++.|+..|
T Consensus 85 ~~---~-~~~~~~~~~~~~fl~~~~~~~~~~~l~~--~~~~E~~~~~W~~~del~~~~~~~~r~~~~~~~~~~~~~~ 155 (156)
T PRK00714 85 VR---R-SKGVYRGQKQKWFLLRLTGDDSEINLNT--TSHPEFDAWRWVSYWYPLDQVVPFKRDVYRRVLKEFARLL 155 (156)
T ss_pred hh---c-cCCcccCcEEEEEEEEecCCCccccCCC--CCCCCeeeeEeCCHHHHHHhchhhhHHHHHHHHHHHHHhh
Confidence 21 1 2345667788999999865444444421 1346999999999999999999999999999999998765
|
|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13910 DNA glycosylase MutY; Provisional | Back alignment and domain information |
|---|
| >KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01084 mutY A/G-specific adenine glycosylase | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 214 | ||||
| 1f3y_A | 165 | Solution Structure Of The Nudix Enzyme Diadenosine | 2e-71 | ||
| 2kdv_A | 164 | Solution Structure Of Rna Pyrophosphohydrolase Rpph | 2e-16 | ||
| 2kdw_A | 164 | Solution Structure Of Rpph Mutant E53a From Escheri | 7e-16 | ||
| 2o1c_A | 150 | Structure Of The E. Coli Dihydroneopterin Triphosph | 4e-04 |
| >pdb|1F3Y|A Chain A, Solution Structure Of The Nudix Enzyme Diadenosine Tetraphosphate Hydrolase From Lupinus Angustifolius L. Length = 165 | Back alignment and structure |
|
| >pdb|2KDV|A Chain A, Solution Structure Of Rna Pyrophosphohydrolase Rpph From Escherichia Coli Length = 164 | Back alignment and structure |
| >pdb|2KDW|A Chain A, Solution Structure Of Rpph Mutant E53a From Escherichia Coli Length = 164 | Back alignment and structure |
| >pdb|2O1C|A Chain A, Structure Of The E. Coli Dihydroneopterin Triphosphate Pyrophosphohydrolase Length = 150 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 2e-86 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 5e-73 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 1e-35 | |
| 1xsa_A | 153 | BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, | 2e-23 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 3e-22 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 5e-19 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 1e-10 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 5e-10 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 6e-09 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 2e-08 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 3e-08 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 5e-08 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 5e-08 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 8e-08 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 4e-07 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 7e-07 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 9e-07 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 4e-06 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 6e-06 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 8e-06 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 1e-05 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 1e-05 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 2e-05 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 3e-05 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 9e-05 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 1e-04 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 1e-04 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 1e-04 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 2e-04 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 2e-04 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 2e-04 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 2e-04 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 3e-04 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 3e-04 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 3e-04 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 4e-04 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 4e-04 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 4e-04 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 6e-04 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 7e-04 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 8e-04 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 8e-04 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 8e-04 |
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 | Back alignment and structure |
|---|
Score = 251 bits (643), Expect = 2e-86
Identities = 123/161 (76%), Positives = 143/161 (88%), Gaps = 5/161 (3%)
Query: 58 SMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ-----NEDPKVAALRELKEE 112
SMD+PPEGYRRNVGICL+N+ KKIFAASRLDIPD+WQMPQ EDP+ AA+REL+EE
Sbjct: 5 SMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREE 64
Query: 113 TGVSSAEVLAEVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGD 172
TGV+SAEV+AEVPYWLTYDFPP+VREKL QWG DWKGQAQKWFL KFTG+++EINLLGD
Sbjct: 65 TGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGD 124
Query: 173 KSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHL 213
SEKPEFGEW W++PEQ+++ V+FKKPVYKEV +VF PHL
Sbjct: 125 GSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL 165
|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.94 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.88 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.85 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.83 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.83 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.83 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.8 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.76 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.76 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.75 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.75 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.75 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.75 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.75 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.74 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.74 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.73 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.73 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.73 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.73 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.72 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.72 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.72 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.72 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.72 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.72 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.71 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.71 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.7 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.7 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.7 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.7 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.7 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.69 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.69 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.69 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.68 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.68 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.68 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.66 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.65 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.65 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.64 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.64 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.64 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.64 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.63 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.63 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.63 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.63 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.63 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.61 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.61 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 99.6 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.59 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.58 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.57 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.56 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.56 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.54 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.54 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.53 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.52 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 99.51 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.51 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 99.5 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.48 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.45 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.45 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.41 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 99.36 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 99.32 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 99.25 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 99.17 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.09 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 98.59 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 98.45 |
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
Probab=99.94 E-value=3.1e-26 Score=179.26 Aligned_cols=157 Identities=78% Similarity=1.417 Sum_probs=123.3
Q ss_pred cccCCCCCCccceEEEEEEecCCcEEEEeecCCCCCeecCCC-----CCHHHHHHHHHHHHhCCCcceeeeeccceEEec
Q 028086 57 YSMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQN-----EDPKVAALRELKEETGVSSAEVLAEVPYWLTYD 131 (214)
Q Consensus 57 ~~~~~~~~~~~~~v~vvI~~~~g~vLL~rR~~~~g~W~lPgG-----Es~~eAA~REl~EETGl~~~~~l~~~~~~~~~~ 131 (214)
.+|..++..+|++|+++|++.+|+|||++|...+|.|.+||| ||+++||+||++||||++...+......+..|.
T Consensus 4 ~~~~~~~~~~~~~v~~~i~~~~~~vLl~~r~~~~g~w~~PgG~ve~gE~~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~ 83 (165)
T 1f3y_A 4 GSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYD 83 (165)
T ss_dssp CCCSSCCSSCCCEEEEEEECTTSCEEEEEETTEEEEEECCEEECCTTCCHHHHHHHHHHHHHCCCSEEEEEECSSCCBCC
T ss_pred ccccCCccceeeeEEEEEECCCCcEEEEecCCCCCcEECCeeccCCCCCHHHHHHHHHHHhhCCChhhhhcccccceeee
Confidence 356677888999999999999999999999866699999999 999999999999999998655544433445566
Q ss_pred CCchhhhhhccccCCCccCceEEEEEEEEeCCcceeeccCCCCCcCceeeEEEeChhHHhhcCccCCHHHHHHHHHhhcc
Q 028086 132 FPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTP 211 (214)
Q Consensus 132 ~p~~~~~~l~~~~~~~~~~~~~~~fl~~~~~~~~~i~l~~~~~~~~E~~~~~Wv~~~el~~~~~~~~~~~~~~~l~~~~~ 211 (214)
++......+...+++.+.++..++|++.+.+...++.++++..+++|+.+++|++++++.+++.++++.+++++++.+.+
T Consensus 84 ~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~E~~~~~W~~~~el~~~~~~~~~~~~~~~~~~l~~ 163 (165)
T 1f3y_A 84 FPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAP 163 (165)
T ss_dssp CCHHHHHHHGGGSCSSCCSCBEEEEEEEECSCGGGCCCCCCSSSCCSEEEEEEECHHHHHHHBCGGGHHHHHHHHHHHGG
T ss_pred cCccccccccccccccccCceEEEEEEEecCCcccccccCCCCCCChhheeEEecHHHHHHHhhhhhHHHHHHHHHHhhh
Confidence 66654333444555566677788999998765444444322234669999999999999999999999999999999998
Q ss_pred cc
Q 028086 212 HL 213 (214)
Q Consensus 212 ~~ 213 (214)
+|
T Consensus 164 ~~ 165 (165)
T 1f3y_A 164 HL 165 (165)
T ss_dssp GC
T ss_pred cC
Confidence 76
|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 214 | ||||
| d1jkna_ | 165 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 6e-47 | |
| d1xsba_ | 153 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 8e-10 | |
| d2fvva1 | 135 | d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat | 9e-10 | |
| d1ryaa_ | 160 | d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD | 2e-09 | |
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 3e-08 | |
| d2a6ta2 | 151 | d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c | 1e-06 | |
| d2o5fa1 | 162 | d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D | 1e-06 | |
| d2fkba1 | 161 | d.113.1.2 (A:8-168) Hypothetical protein YfcD {Esc | 1e-06 | |
| d1q33a_ | 292 | d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr | 2e-06 | |
| d1vcda1 | 126 | d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t | 3e-06 | |
| d1ktga_ | 137 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 6e-05 | |
| d1k2ea_ | 152 | d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa | 1e-04 | |
| d1hzta_ | 153 | d.113.1.2 (A:) Isopentenyl diphosphate isomerase { | 2e-04 | |
| d2azwa1 | 147 | d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E | 4e-04 | |
| d1irya_ | 156 | d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha | 4e-04 | |
| d2b0va1 | 146 | d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N | 0.001 | |
| d1qtwa_ | 285 | c.1.15.1 (A:) Endonuclease IV {Escherichia coli [T | 0.003 |
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) species: Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]
Score = 150 bits (379), Expect = 6e-47
Identities = 123/161 (76%), Positives = 143/161 (88%), Gaps = 5/161 (3%)
Query: 58 SMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ-----NEDPKVAALRELKEE 112
SMD+PPEGYRRNVGICL+N+ KKIFAASRLDIPD+WQMPQ EDP+ AA+REL+EE
Sbjct: 5 SMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREE 64
Query: 113 TGVSSAEVLAEVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGD 172
TGV+SAEV+AEVPYWLTYDFPP+VREKL QWG DWKGQAQKWFL KFTG+++EINLLGD
Sbjct: 65 TGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGD 124
Query: 173 KSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHL 213
SEKPEFGEW W++PEQ+++ V+FKKPVYKEV +VF PHL
Sbjct: 125 GSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL 165
|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Length = 137 | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152 | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146 | Back information, alignment and structure |
|---|
| >d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]} Length = 285 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 100.0 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.85 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.8 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.78 | |
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.78 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.77 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.77 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.77 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.76 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.75 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.74 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.74 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.74 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.73 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.72 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.71 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.71 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.7 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.67 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.61 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.59 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 99.56 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.54 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.51 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.45 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 99.4 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 99.33 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 99.2 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 99.2 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 99.09 |
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) species: Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]
Probab=100.00 E-value=1.4e-32 Score=217.23 Aligned_cols=159 Identities=77% Similarity=1.395 Sum_probs=127.6
Q ss_pred cccccCCCCCCccceEEEEEEecCCcEEEEeecCCCCCeecCCC-----CCHHHHHHHHHHHHhCCCcceeeeeccceEE
Q 028086 55 SSYSMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQN-----EDPKVAALRELKEETGVSSAEVLAEVPYWLT 129 (214)
Q Consensus 55 ~~~~~~~~~~~~~~~v~vvI~~~~g~vLL~rR~~~~g~W~lPgG-----Es~~eAA~REl~EETGl~~~~~l~~~~~~~~ 129 (214)
+..||..+|.+||++|+++|+|++|+|||++|.+.+|.|++||| ||+++||+||++||||++...........+.
T Consensus 2 ~~~~~~~~~~~yR~~Vg~vI~n~~~~vLL~kR~~~~g~W~~PgG~ve~gEt~~~Aa~REl~EEtGl~~~~~~~~~~~~~~ 81 (165)
T d1jkna_ 2 PLGSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLT 81 (165)
T ss_dssp CCCCCSSCCSSEEEEEEEEEECTTSCEEEEEESSSTTCEECCEECCCTTCCHHHHHHHHHHHHTCCCSEEEEEECSSCEE
T ss_pred CCCccCCCCCCccccEEEEEEeCCCEEEEEEEcCCCCcccCccceEcCCCChhHHHHHHHHHhhcccccccccccccccc
Confidence 34689999999999999999999999999999987899999999 9999999999999999985332222222333
Q ss_pred ecCCchhhhhhccccCCCccCceEEEEEEEEeCCcceeeccCCCCCcCceeeEEEeChhHHhhcCccCCHHHHHHHHHhh
Q 028086 130 YDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVF 209 (214)
Q Consensus 130 ~~~p~~~~~~l~~~~~~~~~~~~~~~fl~~~~~~~~~i~l~~~~~~~~E~~~~~Wv~~~el~~~~~~~~~~~~~~~l~~~ 209 (214)
+.++..........+.+.+..+..++|.+.+.+.+.++++........|+++++|++++++.+.+.+|++.+|++++++|
T Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~E~~~~~W~~~~el~~~i~~fk~~v~~~~l~~f 161 (165)
T d1jkna_ 82 YDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVF 161 (165)
T ss_dssp EECCHHHHHHHHHHTCCCCSEEEECCEEEEECSCTTTCCSSCSSSSCCCEEEEEEECTTHHHHHSCGGGHHHHHHHHHHT
T ss_pred ccccceeeceeeeeecCCccceeeEEEEEEEeCCCceeecCCCCCCCCeeEEeEECCHHHHHHhcchhhHHHHHHHHHHH
Confidence 33444443333445566666777888899998776677665444566799999999999999999999999999999999
Q ss_pred cccc
Q 028086 210 TPHL 213 (214)
Q Consensus 210 ~~~~ 213 (214)
+|||
T Consensus 162 ~p~~ 165 (165)
T d1jkna_ 162 APHL 165 (165)
T ss_dssp GGGC
T ss_pred HhhC
Confidence 9997
|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|