Citrus Sinensis ID: 028115

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---

MGKAVIKAADAAGLELVPVSFGTEEESGQKVEVCGKEIQVHGLSDRESVLASVFDKYPNMIVVDYTVPAAVNGNAELYSKVGVPFVMGTTGGDRVRLHETIENSNVYAVISPQMGKQVVAFLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDTSGTAKAVISCFQKLGVSFDMDQIQMIRDPKQQLEMVGVPEEHLPGHAFHMYHLTSPDQT

cHHHHHHHHHHcccEEcccccccccccccccccccccEEEEccccHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHccccccccHHHHHcccccccccccccccccccEEEEEEEccccccc

cHHHHHHHHHHccccEEEEccccccccccEEEEcccEEEEEcccHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHHHccHHcccccEEEEEccccccccccHHHHHHHHHHHHccccccHHHHHHHccHHHHHHHccccHHHccccEEEEEEEEccccc

MGKAVIKAADaaglelvpvsfgteeesgqkveVCGKEiqvhglsdreSVLASvfdkypnmivVDYTvpaavngnaelyskvgvpfvmgttggdrvrlhetiensnvyavispQMGKQVVAFLAAMEIMAEqfpgafsgySLQVLEshqagkldtsgTAKAVISCFQKlgvsfdmdqiqmirdpkqqlemvgvpeehlpghafhmyhltspdqt

MGKAVikaadaaglelvpvsfgteeesgqkvEVCGKEIQVHGLSDRESVLASVFDKYPNMIVVDYTVPAAVNGNAELYSKVGVPFVMGTTGGDRVRLHETIENSNVYAVISPQMGKQVVAFLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDTSGTAKAVISCFQKLGVSFDMDQIQMIRDPKQQLEMVGVPEEHLPGHAFHMYHLTSPDQT

***********AGLELVPVSF********KVEVCGKEIQVHGLSDRESVLASVFDKYPNMIVVDYTVPAAVNGNAELYSKVGVPFVMGTTGGDRVRLHETIENSNVYAVISPQMGKQVVAFLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDTSGTAKAVISCFQKLGVSFDMDQIQMIRD******MVG*****L*GHAFHMY********

*GKAVIK*A*AAGLELVPVSFGTEEESGQKVEVCGKEIQVHGLSDRESVLASVFDKYPNMIVVDYTVPAAVNGNAELYSKVGVPFVMGTTGGDRVRLHETIENSNVYAVISPQMGKQVVAFLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDTSGTAKAVISCFQKLGVSFDMDQIQMIRDPKQQLEMVGVPEEHLPGHAFHMYHLTS****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		213	2.2.26 [Sep-21-2011]
O80574		347	4-hydroxy-tetrahydrodipic	yes	no	1.0	0.613	0.798	1e-101
Q8LB01		349	4-hydroxy-tetrahydrodipic	no	no	1.0	0.610	0.798	1e-101
Q67W29		343	Probable 4-hydroxy-tetrah	yes	no	1.0	0.620	0.718	3e-88
Q10P67		325	Probable 4-hydroxy-tetrah	no	no	1.0	0.655	0.661	1e-82
Q8THP0		263	4-hydroxy-tetrahydrodipic	yes	no	0.591	0.479	0.311	6e-07
Q2NHW0		273	4-hydroxy-tetrahydrodipic	yes	no	0.708	0.553	0.288	9e-07
Q3ISP9		246	4-hydroxy-tetrahydrodipic	yes	no	0.511	0.443	0.291	4e-06
Q8PXL6		263	4-hydroxy-tetrahydrodipic	yes	no	0.591	0.479	0.297	7e-06
Q57865		274	4-hydroxy-tetrahydrodipic	yes	no	0.441	0.343	0.323	8e-06
Q6LYR5		270	4-hydroxy-tetrahydrodipic	yes	no	0.718	0.566	0.303	1e-05

>sp\|O80574\|DAPB1_ARATH 4-hydroxy-tetrahydrodipicolinate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=DAPB1 PE=2 SV=2	Back alignment and function desciption

 Score =  367 bits (943), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/213 (79%), Positives = 197/213 (92%)

Query: 1   MGKAVIKAADAAGLELVPVSFGTEEESGQKVEVCGKEIQVHGLSDRESVLASVFDKYPNM 60
           MGKAVIKAAD+AG+ +VP+SFG+  E GQ+VEVCGKEI VHG ++RE VL+SVF+K+P +
Sbjct: 84  MGKAVIKAADSAGVNIVPISFGSAGEDGQRVEVCGKEITVHGPTEREKVLSSVFEKHPEL 143

Query: 61  IVVDYTVPAAVNGNAELYSKVGVPFVMGTTGGDRVRLHETIENSNVYAVISPQMGKQVVA 120
           IVVDYT+P+AVN NAELYSKVGVPFVMGTTGGDR +L+ET+E + +YAVISPQMGKQVVA
Sbjct: 144 IVVDYTIPSAVNDNAELYSKVGVPFVMGTTGGDRNKLYETVEEAKIYAVISPQMGKQVVA 203

Query: 121 FLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDTSGTAKAVISCFQKLGVSFDMDQIQMI 180
           FLAAMEIMAEQFPGAFSGYSL V+ESHQA KLD SGTAKAVISCFQ+LGVS+DMDQIQ+I
Sbjct: 204 FLAAMEIMAEQFPGAFSGYSLDVMESHQASKLDASGTAKAVISCFQELGVSYDMDQIQLI 263

Query: 181 RDPKQQLEMVGVPEEHLPGHAFHMYHLTSPDQT 213
           RDPKQQ+EMVGVPEEH+ GHAFH+YHLTSPD+T
Sbjct: 264 RDPKQQVEMVGVPEEHISGHAFHLYHLTSPDET 296

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 2EC: 6

>sp\|Q8LB01\|DAPB2_ARATH 4-hydroxy-tetrahydrodipicolinate reductase 2, chloroplastic OS=Arabidopsis thaliana GN=DAPB2 PE=2 SV=1	Back alignment and function description

>sp\|Q67W29\|DAPB1_ORYSJ Probable 4-hydroxy-tetrahydrodipicolinate reductase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=DAPB1 PE=2 SV=1	Back alignment and function description

>sp\|Q10P67\|DAPB2_ORYSJ Probable 4-hydroxy-tetrahydrodipicolinate reductase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=DAPB2 PE=2 SV=1	Back alignment and function description

>sp\|Q8THP0\|DAPB_METAC 4-hydroxy-tetrahydrodipicolinate reductase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dapB PE=3 SV=1	Back alignment and function description

>sp\|Q2NHW0\|DAPB_METST 4-hydroxy-tetrahydrodipicolinate reductase OS=Methanosphaera stadtmanae (strain DSM 3091) GN=dapB PE=3 SV=1	Back alignment and function description

>sp\|Q3ISP9\|DAPB_NATPD 4-hydroxy-tetrahydrodipicolinate reductase OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=dapB PE=3 SV=1	Back alignment and function description

>sp\|Q8PXL6\|DAPB_METMA 4-hydroxy-tetrahydrodipicolinate reductase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dapB PE=3 SV=1	Back alignment and function description

>sp\|Q57865\|DAPB_METJA 4-hydroxy-tetrahydrodipicolinate reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dapB PE=3 SV=2	Back alignment and function description

>sp\|Q6LYR5\|DAPB_METMP 4-hydroxy-tetrahydrodipicolinate reductase OS=Methanococcus maripaludis (strain S2 / LL) GN=dapB PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		213
363807337		344	uncharacterized protein LOC100807997 [Gl	1.0	0.619	0.835	1e-101
255585299		354	dihydrodipicolinate reductase, putative	1.0	0.601	0.816	1e-101
388496612		345	unknown [Medicago truncatula]	1.0	0.617	0.826	1e-101
297820840		349	dihydrodipicolinate reductase family pro	1.0	0.610	0.798	1e-100
225434245		349	PREDICTED: dihydrodipicolinate reductase	1.0	0.610	0.835	1e-100
255638009		344	unknown [Glycine max]	1.0	0.619	0.826	1e-100
356520326		344	PREDICTED: dihydrodipicolinate reductase	1.0	0.619	0.826	1e-100
296084376		410	unnamed protein product [Vitis vinifera]	1.0	0.519	0.835	1e-100
18406430		347	dihydrodipicolinate reductase 1 [Arabido	1.0	0.613	0.798	1e-99
18411368		349	dihydrodipicolinate reductase 2 [Arabido	1.0	0.610	0.798	1e-99

>gi\|363807337\|ref\|NP_001242117.1\| uncharacterized protein LOC100807997 [Glycine max] gi\|255671801\|gb\|ACU26533.1\| dihydrodipicolinate reductase [Glycine max]	Back alignment and taxonomy information

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/213 (83%), Positives = 194/213 (91%)

Query: 1   MGKAVIKAADAAGLELVPVSFGTEEESGQKVEVCGKEIQVHGLSDRESVLASVFDKYPNM 60
           MGKAVI AA+AAGL +VPVSFG EEESGQ  ++ GKE  VHG SDRESVLASV DKYPN+
Sbjct: 81  MGKAVINAAEAAGLNVVPVSFGCEEESGQTFQIGGKEFLVHGPSDRESVLASVLDKYPNL 140

Query: 61  IVVDYTVPAAVNGNAELYSKVGVPFVMGTTGGDRVRLHETIENSNVYAVISPQMGKQVVA 120
           IVVDYT+P AVNGNAELYSKVGVPFVMGTTGGDR  LH+T+ +SN+YAVISPQMGKQVVA
Sbjct: 141 IVVDYTIPDAVNGNAELYSKVGVPFVMGTTGGDRDLLHKTVLDSNIYAVISPQMGKQVVA 200

Query: 121 FLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDTSGTAKAVISCFQKLGVSFDMDQIQMI 180
           FLAAMEIMAEQFPGAFSGYSLQVLESHQA K+D SGTAKAVISCF KLGVS+DMDQI++I
Sbjct: 201 FLAAMEIMAEQFPGAFSGYSLQVLESHQASKVDASGTAKAVISCFNKLGVSYDMDQIKLI 260

Query: 181 RDPKQQLEMVGVPEEHLPGHAFHMYHLTSPDQT 213
           RDP+QQLEMVGVPE+HL GHAFHMYHLTSPD T
Sbjct: 261 RDPRQQLEMVGVPEKHLSGHAFHMYHLTSPDDT 293

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255585299\|ref\|XP_002533348.1\| dihydrodipicolinate reductase, putative [Ricinus communis] gi\|223526813\|gb\|EEF29033.1\| dihydrodipicolinate reductase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|388496612\|gb\|AFK36372.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|297820840\|ref\|XP_002878303.1\| dihydrodipicolinate reductase family protein [Arabidopsis lyrata subsp. lyrata] gi\|297324141\|gb\|EFH54562.1\| dihydrodipicolinate reductase family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|225434245\|ref\|XP_002280402.1\| PREDICTED: dihydrodipicolinate reductase 1, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255638009\|gb\|ACU19320.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|356520326\|ref\|XP_003528814.1\| PREDICTED: dihydrodipicolinate reductase 2, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|296084376\|emb\|CBI24764.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi|18406430|ref|NP_566006.1| dihydrodipicolinate reductase 1 [Arabidopsis thaliana] gi|75223205|sp|O80574.2|DAPB1_ARATH RecName: Full=4-hydroxy-tetrahydrodipicolinate reductase 1, chloroplastic; Short=HTPA reductase 1; Flags: Precursor gi|20197071|gb|AAC23412.2| expressed protein [Arabidopsis thaliana] gi|21536558|gb|AAM60890.1| unknown [Arabidopsis thaliana] gi|26452703|dbj|BAC43434.1| unknown protein [Arabidopsis thaliana] gi|30793829|gb|AAP40367.1| unknown protein [Arabidopsis thaliana] gi|330255270|gb|AEC10364.1| dihydrodipicolinate reductase 1 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi|18411368|ref|NP_567088.1| dihydrodipicolinate reductase 2 [Arabidopsis thaliana] gi|75245889|sp|Q8LB01.1|DAPB2_ARATH RecName: Full=4-hydroxy-tetrahydrodipicolinate reductase 2, chloroplastic; Short=HTPA reductase 2; Flags: Precursor gi|21593099|gb|AAM65048.1| unknown [Arabidopsis thaliana] gi|111074490|gb|ABH04618.1| At3g59890 [Arabidopsis thaliana] gi|332646461|gb|AEE79982.1| dihydrodipicolinate reductase 2 [Arabidopsis thaliana]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		213
TAIR\|locus:2080482		349	AT3G59890 [Arabidopsis thalian	1.0	0.610	0.798	1e-91
TAIR\|locus:2051854		347	AT2G44040 [Arabidopsis thalian	1.0	0.613	0.798	1.3e-91
TIGR_CMR\|CJE_0190		242	CJE_0190 "dihydrodipicolinate	0.704	0.619	0.240	3e-05
TIGR_CMR\|CBU_1709		239	CBU_1709 "dihydrodipicolinate	0.699	0.623	0.262	9e-05
UNIPROTKB\|Q9KPH7		269	dapB "4-hydroxy-tetrahydrodipi	0.699	0.553	0.274	0.00064
TIGR_CMR\|VC_2391		269	VC_2391 "dihydrodipicolinate r	0.699	0.553	0.274	0.00064

TAIR\|locus:2080482 AT3G59890 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 914 (326.8 bits), Expect = 1.0e-91, P = 1.0e-91
 Identities = 170/213 (79%), Positives = 197/213 (92%)

Query:     1 MGKAVIKAADAAGLELVPVSFGTEEESGQKVEVCGKEIQVHGLSDRESVLASVFDKYPNM 60
             MGKAVIKAAD+AG+ +VP SFG+ EE+GQ VEVCGKEI VHG ++RE VL+SVF+KYP +
Sbjct:    86 MGKAVIKAADSAGVNIVPTSFGSVEEAGQTVEVCGKEILVHGPTEREKVLSSVFEKYPEL 145

Query:    61 IVVDYTVPAAVNGNAELYSKVGVPFVMGTTGGDRVRLHETIENSNVYAVISPQMGKQVVA 120
             IVVDYT+P+AVN NAELY KVGVPFVMGTTGGDR RL++T+E S +YAVISPQMGKQVVA
Sbjct:   146 IVVDYTIPSAVNDNAELYGKVGVPFVMGTTGGDRTRLYKTVEESKIYAVISPQMGKQVVA 205

Query:   121 FLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDTSGTAKAVISCFQKLGVSFDMDQIQMI 180
             FLAAMEIM+EQFPGAF+GYSL+V+ESHQA KLD SGTAKAVISCFQKLGVS+DMDQIQ+I
Sbjct:   206 FLAAMEIMSEQFPGAFAGYSLEVMESHQASKLDASGTAKAVISCFQKLGVSYDMDQIQLI 265

Query:   181 RDPKQQLEMVGVPEEHLPGHAFHMYHLTSPDQT 213
             RDPKQQ+E+VGVPEEH+ GHAFH+YHLTSPD+T
Sbjct:   266 RDPKQQIEVVGVPEEHVSGHAFHLYHLTSPDKT 298

GO:0000166 "nucleotide binding" evidence=IEA

GO:0008839 "4-hydroxy-tetrahydrodipicolinate reductase" evidence=IEA;IGI;ISS

GO:0009089 "lysine biosynthetic process via diaminopimelate" evidence=IEA;ISS

GO:0009507 "chloroplast" evidence=ISM;IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0070402 "NADPH binding" evidence=IEA

TAIR\|locus:2051854 AT2G44040 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|CJE_0190 CJE_0190 "dihydrodipicolinate reductase" [Campylobacter jejuni RM1221 (taxid:195099)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_1709 CBU_1709 "dihydrodipicolinate reductase" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KPH7 dapB "4-hydroxy-tetrahydrodipicolinate reductase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_2391 VC_2391 "dihydrodipicolinate reductase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O80574	DAPB1_ARATH	1, ., 3, ., 1, ., 2, 6	0.7981	1.0	0.6138	yes	no
Q67W29	DAPB1_ORYSJ	1, ., 3, ., 1, ., 2, 6	0.7183	1.0	0.6209	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.3.1	0.921
3rd Layer	1.3.1.26	0.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh2_kg.5__2445__AT3G59890.1	annotation not avaliable (349 aa)
		(Arabidopsis lyrata)
Predicted Functional Partners:
	fgenesh2_kg.5__2554__AT3G60880.2	annotation not avaliable (365 aa)	•	•	•	0.702
	fgenesh2_kg.4__2741__AT2G45440.1	annotation not avaliable (365 aa)	•	•	•	0.697
	scaffold_502452.1	annotation not avaliable (362 aa)	•		•	0.576
	fgenesh2_kg.8__1097__AT5G52100.1	annotation not avaliable (298 aa)		•	•	0.490

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		213
PLN02775		286	PLN02775, PLN02775, Probable dihydrodipicolinate r	1e-138
TIGR02130		275	TIGR02130, dapB_plant, dihydrodipicolinate reducta	1e-123
pfam01113		122	pfam01113, DapB_N, Dihydrodipicolinate reductase,	2e-15
PRK00048		257	PRK00048, PRK00048, dihydrodipicolinate reductase;	1e-12
COG0289		266	COG0289, DapB, Dihydrodipicolinate reductase [Amin	3e-11
TIGR00036		266	TIGR00036, dapB, dihydrodipicolinate reductase	8e-10

>gnl\|CDD\|178374 PLN02775, PLN02775, Probable dihydrodipicolinate reductase	Back alignment and domain information

 Score =  388 bits (998), Expect = e-138
 Identities = 158/213 (74%), Positives = 180/213 (84%)

Query: 1   MGKAVIKAADAAGLELVPVSFGTEEESGQKVEVCGKEIQVHGLSDRESVLASVFDKYPNM 60
           MG AV +AA +AGL+LVPVSF      G  VEVCG E+++ G S+RE+VL+SV  +YPN+
Sbjct: 23  MGHAVAEAAVSAGLQLVPVSFTGPAGVGVTVEVCGVEVRLVGPSEREAVLSSVKAEYPNL 82

Query: 61  IVVDYTVPAAVNGNAELYSKVGVPFVMGTTGGDRVRLHETIENSNVYAVISPQMGKQVVA 120
           IVVDYT+P AVN NAELY K G+PFVMGTTGGDR RL + +E S VYAVI+PQMGKQVVA
Sbjct: 83  IVVDYTLPDAVNDNAELYCKNGLPFVMGTTGGDRDRLLKDVEESGVYAVIAPQMGKQVVA 142

Query: 121 FLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDTSGTAKAVISCFQKLGVSFDMDQIQMI 180
           F AAMEIMAEQFPGAFSGY+L+V+ESHQA KLDTSGTAKAVIS F+KLGVSFDMDQI++I
Sbjct: 143 FQAAMEIMAEQFPGAFSGYTLEVVESHQATKLDTSGTAKAVISSFRKLGVSFDMDQIELI 202

Query: 181 RDPKQQLEMVGVPEEHLPGHAFHMYHLTSPDQT 213
           RDPKQQLE VGVPEEHL GHAFH Y LTSPD T
Sbjct: 203 RDPKQQLEGVGVPEEHLNGHAFHTYRLTSPDGT 235

Length = 286

>gnl\|CDD\|131185 TIGR02130, dapB_plant, dihydrodipicolinate reductase	Back alignment and domain information

>gnl\|CDD\|216304 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus	Back alignment and domain information

>gnl\|CDD\|234595 PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|223366 COG0289, DapB, Dihydrodipicolinate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|129147 TIGR00036, dapB, dihydrodipicolinate reductase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		213
TIGR02130		275	dapB_plant dihydrodipicolinate reductase. This nar	100.0
PLN02775		286	Probable dihydrodipicolinate reductase	100.0
COG0289		266	DapB Dihydrodipicolinate reductase [Amino acid tra	100.0
TIGR00036		266	dapB dihydrodipicolinate reductase.	100.0
PRK00048		257	dihydrodipicolinate reductase; Provisional	100.0
PF01113		124	DapB_N: Dihydrodipicolinate reductase, N-terminus;	99.93
PF05173		132	DapB_C: Dihydrodipicolinate reductase, C-terminus;	99.85
PRK08374		336	homoserine dehydrogenase; Provisional	98.36
PRK13303		265	L-aspartate dehydrogenase; Provisional	98.34
PF03447		117	NAD_binding_3: Homoserine dehydrogenase, NAD bindi	97.65
PRK04207		341	glyceraldehyde-3-phosphate dehydrogenase; Provisio	97.33
PRK13304		265	L-aspartate dehydrogenase; Reviewed	97.32
PRK13302		271	putative L-aspartate dehydrogenase; Provisional	96.86
PRK13301		267	putative L-aspartate dehydrogenase; Provisional	96.72
PRK06270		341	homoserine dehydrogenase; Provisional	96.65
TIGR03855		229	NAD_NadX aspartate dehydrogenase. Members of this	96.04
COG1712		255	Predicted dinucleotide-utilizing enzyme [General f	95.79
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	95.67
PF13380		116	CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5	95.65
TIGR01921		324	DAP-DH diaminopimelate dehydrogenase. This model r	95.5
COG3804		350	Uncharacterized conserved protein related to dihyd	95.24
TIGR01019		286	sucCoAalpha succinyl-CoA synthetase, alpha subunit	94.75
PRK06349		426	homoserine dehydrogenase; Provisional	94.43
PLN00125		300	Succinyl-CoA ligase [GDP-forming] subunit alpha	94.41
PTZ00187		317	succinyl-CoA synthetase alpha subunit; Provisional	93.73
PF02629		96	CoA_binding: CoA binding domain; InterPro: IPR0037	93.63
PRK05678		291	succinyl-CoA synthetase subunit alpha; Validated	93.42
PRK08300		302	acetaldehyde dehydrogenase; Validated	93.27
PLN02819		1042	lysine-ketoglutarate reductase/saccharopine dehydr	93.09
TIGR03215		285	ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati	92.86
PF03435		386	Saccharop_dh: Saccharopine dehydrogenase ; InterPr	92.45
PRK11579		346	putative oxidoreductase; Provisional	92.18
TIGR03450		351	mycothiol_INO1 inositol 1-phosphate synthase, Acti	92.16
TIGR00715		256	precor6x_red precorrin-6x reductase. This enzyme w	91.89
PF00107		130	ADH_zinc_N: Zinc-binding dehydrogenase; InterPro:	90.93
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	90.61
PF01118		121	Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi	90.59
PRK05472		213	redox-sensing transcriptional repressor Rex; Provi	89.72
PRK06392		326	homoserine dehydrogenase; Provisional	89.16
COG0673		342	MviM Predicted dehydrogenases and related proteins	89.11
PRK08057		248	cobalt-precorrin-6x reductase; Reviewed	88.93
PF13407		257	Peripla_BP_4: Periplasmic binding protein domain;	88.77
smart00846		149	Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase,	88.53
PRK08955		334	glyceraldehyde-3-phosphate dehydrogenase; Validate	88.5
TIGR02717		447	AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP	86.93
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	86.79
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	86.58
TIGR01761		343	thiaz-red thiazolinyl imide reductase. This reduct	85.98
cd06305		273	PBP1_methylthioribose_binding_like Methylthioribos	85.67
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	85.01
COG2099		257	CobK Precorrin-6x reductase [Coenzyme metabolism]	84.99
TIGR01546		333	GAPDH-II_archae glyceraldehyde-3-phosphate dehydro	84.9
COG2344		211	AT-rich DNA-binding protein [General function pred	84.8
PF02571		249	CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro:	84.64
TIGR01532		325	E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas	84.6
cd02069		213	methionine_synthase_B12_BD B12 binding domain of m	84.17
COG1832		140	Predicted CoA-binding protein [General function pr	83.8
PF00072		112	Response_reg: Response regulator receiver domain;	83.68
COG0074		293	SucD Succinyl-CoA synthetase, alpha subunit [Energ	83.65
cd06347		334	PBP1_ABC_ligand_binding_like_12 Type I periplasmic	83.57
cd06301		272	PBP1_rhizopine_binding_like Periplasmic binding pr	82.59
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	82.24
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	82.11
PF10087		97	DUF2325: Uncharacterized protein conserved in bact	81.28
PLN02688		266	pyrroline-5-carboxylate reductase	81.09
PF00044		151	Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase,	80.74
PRK06813		346	homoserine dehydrogenase; Validated	80.65
cd06346		312	PBP1_ABC_ligand_binding_like_11 Type I periplasmic	80.3
cd06282		266	PBP1_GntR_like_2 Ligand-binding domain of putative	80.12
PF13727		175	CoA_binding_3: CoA-binding domain; PDB: 3NKL_B.	80.03

>TIGR02130 dapB_plant dihydrodipicolinate reductase	Back alignment and domain information

Probab=100.00  E-value=4.2e-57  Score=397.65  Aligned_cols=211  Identities=63%  Similarity=1.000  Sum_probs=189.5

Q ss_pred             ChHHHHHHHHhCCCeEEEE-ecCCCccccccc-cccCceeEeecCCchhHHHhhhhcCCCCEEEEEcCChHHHHHHHHHH
Q 028115            1 MGKAVIKAADAAGLELVPV-SFGTEEESGQKV-EVCGKEIQVHGLSDRESVLASVFDKYPNMIVVDYTVPAAVNGNAELY   78 (213)
Q Consensus         1 MG~~i~~~~~~~~~elv~~-~~~~~~~~g~~~-~~~~~~v~i~~~~~~~~~l~~~~~~~~d~VvIDFS~p~~~~~~~~~~   78 (213)
                      |||++++++.+++|+||++ +++.  ..++++ ++.+.++++.+++|+...++++...++|+|+||||+|+++++|+++|
T Consensus        12 MG~~v~~av~~~~~~Lv~~~~~~~--~~~~~~~~~~g~~v~v~~~~~~~~~l~~~~~~~~d~VvIDFT~P~~~~~n~~~~   89 (275)
T TIGR02130        12 MGKAVAEAADAAGLEIVPTSFGGE--EEAENEAEVAGKEILLHGPSEREARIGEVFAKYPELICIDYTHPSAVNDNAAFY   89 (275)
T ss_pred             HHHHHHHHHhcCCCEEEeeEcccc--ccccchhhhcccceeeeccccccccHHHHHhhcCCEEEEECCChHHHHHHHHHH
Confidence            9999999998899999998 5543  244454 55666788877777777777766555887899999999999999999


Q ss_pred             HhcCCCEEEEcCCCCHHHHHHHHHccCCcEEEccChhHHHHHHHHHHHHHHHhcCCCCCCCcEEEEeccCCCCCCchHHH
Q 028115           79 SKVGVPFVMGTTGGDRVRLHETIENSNVYAVISPQMGKQVVAFLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDTSGTA  158 (213)
Q Consensus        79 ~~~g~~~ViGTTG~~~~~~~~~~~~~~~~~v~a~N~SlGv~ll~~l~~~aa~~l~~~~~~~dieI~E~HH~~K~DaSGTA  158 (213)
                      .++|+|+|+|||||++++++++++++++|+|||||||+|+|+|++++++++++|+++|++||+||+|+||++|+|+||||
T Consensus        90 ~~~gv~~ViGTTG~~~~~~~~l~~~~~i~~l~apNfSiGv~ll~~~~~~aA~~~~~~f~~ydvEIiE~HH~~K~DaSGTA  169 (275)
T TIGR02130        90 GKHGIPFVMGTTGGDREALAKLVADAKHPAVIAPNMAKQIVAFLAAIEFLAEEFPGAFAGYKLEVMESHQASKADASGTA  169 (275)
T ss_pred             HHCCCCEEEcCCCCCHHHHHHHHHhcCCCEEEECcccHHHHHHHHHHHHHHHhhccccCCCCEEEEEcCCCCCCCCCHHH
Confidence            99999999999999999999999988899999999999999999999999999987889999999999999999999999


Q ss_pred             HHHHHHHHhcCCCcCcccccccCCCCCcccccCccCcccCCCceEEEEEeCCCCC
Q 028115          159 KAVISCFQKLGVSFDMDQIQMIRDPKQQLEMVGVPEEHLPGHAFHMYHLTSPDQT  213 (213)
Q Consensus       159 ~~la~~~~~~~~~~~~~~~~~~r~~~~~~r~g~i~geh~~G~~~htv~~~s~~~~  213 (213)
                      ++|++.++++++.|+|+++...|+++.++.+.++|++++.||++|||.|.|++++
T Consensus       170 ~~l~~~i~~~~~~~~~~~~~~~R~~~~~igi~siR~~~vgGh~~Htv~f~s~~e~  224 (275)
T TIGR02130       170 KAVIGCFQKLGFDYDMDDIEKIRDEKEQIERMGVPEEHLGGHAFHLYHLDSADGT  224 (275)
T ss_pred             HHHHHHHHHhCCccCcccccccCCCCCccceEEecCcccCCCccEEEEEecCCCe
Confidence            9999988778888999999999987778999999999999999999999999874

This narrow family includes genes from Arabidopsis and Fibrobacter succinogenes (which probably recieved the gene from a plant via lateral gene transfer). The sequences are distantly related to the dihydrodipicolinate reductases from archaea. In Fibrobacter this gene is the only candidate DHPR in the genome.

>PLN02775 Probable dihydrodipicolinate reductase	Back alignment and domain information

>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00036 dapB dihydrodipicolinate reductase	Back alignment and domain information

>PRK00048 dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]	Back alignment and domain information

>PF05173 DapB_C: Dihydrodipicolinate reductase, C-terminus; InterPro: IPR022663 This entry represents the C-terminal region of Dihydrodipicolinate reductase	Back alignment and domain information

>PRK08374 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PRK13303 L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway	Back alignment and domain information

>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK13304 L-aspartate dehydrogenase; Reviewed	Back alignment and domain information

>PRK13302 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK13301 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK06270 homoserine dehydrogenase; Provisional	Back alignment and domain information

>TIGR03855 NAD_NadX aspartate dehydrogenase	Back alignment and domain information

>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A	Back alignment and domain information

>TIGR01921 DAP-DH diaminopimelate dehydrogenase	Back alignment and domain information

>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown]	Back alignment and domain information

>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit	Back alignment and domain information

>PRK06349 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PLN00125 Succinyl-CoA ligase [GDP-forming] subunit alpha	Back alignment and domain information

>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional	Back alignment and domain information

>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases	Back alignment and domain information

>PRK05678 succinyl-CoA synthetase subunit alpha; Validated	Back alignment and domain information

>PRK08300 acetaldehyde dehydrogenase; Validated	Back alignment and domain information

>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase	Back alignment and domain information

>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating)	Back alignment and domain information

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase	Back alignment and domain information

>PRK11579 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR03450 mycothiol_INO1 inositol 1-phosphate synthase, Actinobacterial type	Back alignment and domain information

>TIGR00715 precor6x_red precorrin-6x reductase	Back alignment and domain information

>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate	Back alignment and domain information

>PRK05472 redox-sensing transcriptional repressor Rex; Provisional	Back alignment and domain information

>PRK06392 homoserine dehydrogenase; Provisional	Back alignment and domain information

>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]	Back alignment and domain information

>PRK08057 cobalt-precorrin-6x reductase; Reviewed	Back alignment and domain information

>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A	Back alignment and domain information

>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain	Back alignment and domain information

>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>TIGR01761 thiaz-red thiazolinyl imide reductase	Back alignment and domain information

>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism]	Back alignment and domain information

>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II	Back alignment and domain information

>COG2344 AT-rich DNA-binding protein [General function prediction only]	Back alignment and domain information

>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt	Back alignment and domain information

>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase	Back alignment and domain information

>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase	Back alignment and domain information

>COG1832 Predicted CoA-binding protein [General function prediction only]	Back alignment and domain information

>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []	Back alignment and domain information

>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion]	Back alignment and domain information

>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PLN02688 pyrroline-5-carboxylate reductase	Back alignment and domain information

>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate	Back alignment and domain information

>PRK06813 homoserine dehydrogenase; Validated	Back alignment and domain information

>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>PF13727 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		213
1p9l_A		245	Dihydrodipicolinate reductase; oxidoreductase, lys	2e-12
4f3y_A		272	DHPR, dihydrodipicolinate reductase; structural ge	5e-11
3qy9_A		243	DHPR, dihydrodipicolinate reductase; rossmann fold	1e-10
1dih_A		273	Dihydrodipicolinate reductase; oxidoreductase; HET	5e-10
1vm6_A		228	DHPR, dihydrodipicolinate reductase; TM1520, struc	1e-09
3ijp_A		288	DHPR, dihydrodipicolinate reductase; ssgcid, SBRI,	1e-09
2dc1_A		236	L-aspartate dehydrogenase; NAD, oxidoreductase; HE	4e-04

>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Length = 245	Back alignment and structure

 Score = 63.0 bits (154), Expect = 2e-12
 Identities = 39/164 (23%), Positives = 59/164 (35%), Gaps = 37/164 (22%)

Query: 1   MGKAVIKAADAA-GLELVPVSFGTEEESGQKVEVCGKEIQVHGLSDRESVLASVFDKYPN 59
           +G  +++A  AA  L L                            D    L+ + D    
Sbjct: 12  VGTTMVRAVAAADDLTLS------------------------AELDAGDPLSLLTDGNTE 47

Query: 60  MIVVDYTVPAAVNGNAELYSKVGVPFVMGTTG---GDRVRLHETIENS-NVYAVISPQMG 115
            +V+D+T P  V GN E     G+  V+GTTG       ++   +    N   +I+P   
Sbjct: 48  -VVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFA 106

Query: 116 KQVVAFLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLDT-SGTA 158
              V  +   +  A  F       S +V+E H   K D  SGTA
Sbjct: 107 IGAVLSMHFAKQAARFFD------SAEVIELHHPHKADAPSGTA 144

PyMOL of 1p9l

>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Length = 272	Back alignment and structure

>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Length = 243	Back alignment and structure

>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Length = 273	Back alignment and structure

>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Length = 228	Back alignment and structure

>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Length = 288	Back alignment and structure

>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Length = 236	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		213
3ijp_A		288	DHPR, dihydrodipicolinate reductase; ssgcid, SBRI,	100.0
4f3y_A		272	DHPR, dihydrodipicolinate reductase; structural ge	100.0
1vm6_A		228	DHPR, dihydrodipicolinate reductase; TM1520, struc	100.0
3qy9_A		243	DHPR, dihydrodipicolinate reductase; rossmann fold	100.0
1dih_A		273	Dihydrodipicolinate reductase; oxidoreductase; HET	100.0
1p9l_A		245	Dihydrodipicolinate reductase; oxidoreductase, lys	100.0
1oi7_A		288	Succinyl-COA synthetase alpha chain; SCS, ligase,	98.97
2yv2_A		297	Succinyl-COA synthetase alpha chain; COA-binding d	98.97
2yv1_A		294	Succinyl-COA ligase [ADP-forming] subunit alpha; C	98.97
2nu8_A		288	Succinyl-COA ligase [ADP-forming] subunit alpha; c	98.61
1f06_A		320	MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH	98.59
2dc1_A		236	L-aspartate dehydrogenase; NAD, oxidoreductase; HE	98.35
3mwd_B		334	ATP-citrate synthase; ATP-grAsp, phosphohistidine,	98.1
3bio_A		304	Oxidoreductase, GFO/IDH/MOCA family; structural ge	97.57
2fp4_A		305	Succinyl-COA ligase [GDP-forming] alpha-chain, mit	97.53
3ing_A		325	Homoserine dehydrogenase; NP_394635.1, structural	97.42
3ff4_A		122	Uncharacterized protein; structural genomics, PSI-	97.39
3upl_A		446	Oxidoreductase; rossmann fold, NADPH binding; 1.50	97.35
3euw_A		344	MYO-inositol dehydrogenase; protein structure init	97.23
3cea_A		346	MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore	97.15
3e9m_A		330	Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA,	97.15
3c1a_A		315	Putative oxidoreductase; ZP_00056571.1, oxidoreduc	97.13
3evn_A		329	Oxidoreductase, GFO/IDH/MOCA family; structural ge	97.11
1j5p_A		253	Aspartate dehydrogenase; TM1643, structural genomi	97.09
1ydw_A		362	AX110P-like protein; structural genomics, protein	97.02
4hkt_A		331	Inositol 2-dehydrogenase; structural genomics, nys	97.01
2d59_A		144	Hypothetical protein PH1109; COA binding, structur	96.93
2ho3_A		325	Oxidoreductase, GFO/IDH/MOCA family; streptococcus	96.92
3q2i_A		354	Dehydrogenase; rossmann fold, UDP-sugar binding, N	96.91
3ezy_A		344	Dehydrogenase; structural genomics, unknown functi	96.9
2glx_A		332	1,5-anhydro-D-fructose reductase; NADP(H) dependen	96.87
3db2_A		354	Putative NADPH-dependent oxidoreductase; two domai	96.83
3moi_A		387	Probable dehydrogenase; structural genomics, PSI2,	96.82
1tlt_A		319	Putative oxidoreductase (virulence factor MVIM HO;	96.78
3fhl_A		362	Putative oxidoreductase; NAD-binding domain, PSI-2	96.72
3do5_A		327	HOM, homoserine dehydrogenase; NP_069768.1, putati	96.71
3kux_A		352	Putative oxidoreductase; oxidoreductase family, cs	96.7
3mz0_A		344	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd;	96.67
1h6d_A		433	Precursor form of glucose-fructose oxidoreductase;	96.65
4ew6_A		330	D-galactose-1-dehydrogenase protein; nysgrc, PSI-b	96.63
1y81_A		138	Conserved hypothetical protein; hyperthermophIle,	96.56
3e82_A		364	Putative oxidoreductase; NAD, GFO/IDH/MOCA family,	96.55
3pff_A		829	ATP-citrate synthase; phosphohistidine, organic ac	96.54
3o9z_A		312	Lipopolysaccaride biosynthesis protein WBPB; oxido	96.49
3e18_A		359	Oxidoreductase; dehydrogenase, NAD-binding, struct	96.49
3rc1_A		350	Sugar 3-ketoreductase; sugar biosynthesis, TDP bin	96.43
3ec7_A		357	Putative dehydrogenase; alpha-beta, structural gen	96.42
3gdo_A		358	Uncharacterized oxidoreductase YVAA; structural ge	96.39
3i23_A		349	Oxidoreductase, GFO/IDH/MOCA family; structural ge	96.23
3f4l_A		345	Putative oxidoreductase YHHX; structural genomics,	96.2
1iuk_A		140	Hypothetical protein TT1466; structural genomics,	96.14
4ina_A		405	Saccharopine dehydrogenase; structural genomics, P	96.06
2ixa_A		444	Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver	95.99
3m2t_A		359	Probable dehydrogenase; PSI, SGXNY, structural gen	95.95
1zh8_A		340	Oxidoreductase; TM0312, structural genomics, JO ce	95.83
3ip3_A		337	Oxidoreductase, putative; structural genomics, PSI	95.83
3btv_A		438	Galactose/lactose metabolism regulatory protein GA	95.69
3c8m_A		331	Homoserine dehydrogenase; structural genomics, APC	95.68
3oa2_A		318	WBPB; oxidoreductase, sugar biosynthesis, dehydrog	95.46
3u3x_A		361	Oxidoreductase; structural genomics, PSI-biology,	95.46
2g0t_A		350	Conserved hypothetical protein; structural genomic	95.42
4had_A		350	Probable oxidoreductase protein; structural genomi	95.3
3dty_A		398	Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram	95.06
3uuw_A		308	Putative oxidoreductase with NAD(P)-binding rossm	94.94
2nvw_A		479	Galactose/lactose metabolism regulatory protein GA	94.92
3ohs_X		334	Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d	94.81
2duw_A		145	Putative COA-binding protein; ligand binding prote	94.64
3mtj_A		444	Homoserine dehydrogenase; rossmann-fold, PSI, MCSG	94.61
1b7g_O		340	Protein (glyceraldehyde 3-phosphate dehydrogenase;	94.55
3v5n_A		417	Oxidoreductase; structural genomics, PSI-biology,	94.5
3keo_A		212	Redox-sensing transcriptional repressor REX; DNA b	94.29
2p2s_A		336	Putative oxidoreductase; YP_050235.1, structural g	94.1
3oqb_A		383	Oxidoreductase; structural genomics, protein struc	94.0
1xea_A		323	Oxidoreductase, GFO/IDH/MOCA family; structural ge	93.85
1cf2_P		337	Protein (glyceraldehyde-3-phosphate dehydrogenase)	93.73
3nkl_A		141	UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo	93.72
2vt3_A		215	REX, redox-sensing transcriptional repressor REX;	93.59
3ic5_A		118	Putative saccharopine dehydrogenase; structural ge	93.28
2dt5_A		211	AT-rich DNA-binding protein; REX, NADH, NAD, rossm	93.18
2czc_A		334	Glyceraldehyde-3-phosphate dehydrogenase; glycolys	93.08
1lc0_A		294	Biliverdin reductase A; oxidoreductase, tetrapyrro	92.91
4gqa_A		412	NAD binding oxidoreductase; structural genomics, P	92.64
4fb5_A		393	Probable oxidoreductase protein; PSI-biology, nysg	92.61
2yxb_A		161	Coenzyme B12-dependent mutase; alpha/beta, structu	91.67
3lte_A		132	Response regulator; structural genomics, PSI, prot	90.94
2obn_A		349	Hypothetical protein; structural genomics, joint c	90.88
2ejw_A		332	HDH, homoserine dehydrogenase; NAD-dependent, oxid	90.37
2csu_A		457	457AA long hypothetical protein; structural genomi	89.73
3lua_A		140	Response regulator receiver protein; two-component	89.24
1nvm_B		312	Acetaldehyde dehydrogenase (acylating), 4-hydroxy-	89.1
3kto_A		136	Response regulator receiver protein; PSI-II,struct	88.79
3cnb_A		143	DNA-binding response regulator, MERR family; signa	88.78
2g1u_A		155	Hypothetical protein TM1088A; structural genomics,	88.05
3d1l_A		266	Putative NADP oxidoreductase BF3122; structural ge	88.01
1y80_A		210	Predicted cobalamin binding protein; corrinoid, fa	87.77
3abi_A		365	Putative uncharacterized protein PH1688; L-lysine	87.75
2zay_A		147	Response regulator receiver protein; structural ge	87.65
3cg0_A		140	Response regulator receiver modulated diguanylate	86.99
3dmy_A		480	Protein FDRA; predicted actyl-COA synthetase, nysg	86.87
3kht_A		144	Response regulator; PSI-II, 11023K, structural gen	86.8
2z2v_A		365	Hypothetical protein PH1688; L-lysine dehydrogenas	86.74
3gt7_A		154	Sensor protein; structural genomics, signal receiv	86.66
3e5r_O		337	PP38, glyceraldehyde-3-phosphate dehydrogenase, cy	86.38
2ph5_A		480	Homospermidine synthase; alpha-beta protein, struc	86.24
3c85_A		183	Putative glutathione-regulated potassium-efflux S	86.21
2qxy_A		142	Response regulator; regulation of transcription, N	86.17
4h3v_A		390	Oxidoreductase domain protein; structural genomics	85.98
3gl9_A		122	Response regulator; beta-sheet, surrounded by alph	85.91
3l49_A		291	ABC sugar (ribose) transporter, periplasmic substr	85.78
3t6k_A		136	Response regulator receiver; flavodoxin-like, stru	85.64
1u8f_O		335	GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l	85.4
1dbw_A		126	Transcriptional regulatory protein FIXJ; doubly wo	85.18
1k66_A		149	Phytochrome response regulator RCPB; CHEY homologu	84.81
4gmf_A		372	Yersiniabactin biosynthetic protein YBTU; rossmann	84.74
1srr_A		124	SPO0F, sporulation response regulatory protein; as	84.73
3f6p_A		120	Transcriptional regulatory protein YYCF; unphospho	84.48
2h9a_A		445	Carbon monoxide dehydrogenase corrinoid/iron- sulf	84.44
1k68_A		140	Phytochrome response regulator RCPA; phosphorylate	84.14
2rdm_A		132	Response regulator receiver protein; structural ge	83.81
2qzj_A		136	Two-component response regulator; 11017X, PSI-II,	83.71
3cfy_A		137	Putative LUXO repressor protein; structural genomi	83.56
3fwz_A		140	Inner membrane protein YBAL; TRKA-N domain, E.coli	83.22
1ff9_A		450	Saccharopine reductase; lysine biosynthesis, alpha	83.05
3cky_A		301	2-hydroxymethyl glutarate dehydrogenase; rossmann	83.02
3bul_A		579	Methionine synthase; transferase, reactivation con	82.96
2pl1_A		121	Transcriptional regulatory protein PHOP; CHEY-like	82.8
3m9w_A		313	D-xylose-binding periplasmic protein; xylose bindi	82.34
1jay_A		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma	82.31
3m6m_D		143	Sensory/regulatory protein RPFC; RPFF, REC, enoyl-	82.18
2rjn_A		154	Response regulator receiver:metal-dependent phosph	81.84
3snk_A		135	Response regulator CHEY-like protein; P-loop conta	81.83
3ezx_A		215	MMCP 1, monomethylamine corrinoid protein 1; N ter	81.59
2i2x_B		258	MTAC, methyltransferase 1; TIM barrel and helix bu	81.41
4djd_C		446	C/Fe-SP, corrinoid/iron-sulfur protein large subun	80.54
3cz5_A		153	Two-component response regulator, LUXR family; str	80.03
3llv_A		141	Exopolyphosphatase-related protein; NAD(P)-binding	80.02

>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae}	Back alignment and structure

Probab=100.00  E-value=5.1e-50  Score=354.51  Aligned_cols=199  Identities=19%  Similarity=0.232  Sum_probs=173.7

Q ss_pred             ChHHHHHHHH-hCCCeEEEEecCCC-ccccccc-cccC---ceeEeecCCchhHHHhhhhcCCCCEEEEEcCChHHHHHH
Q 028115            1 MGKAVIKAAD-AAGLELVPVSFGTE-EESGQKV-EVCG---KEIQVHGLSDRESVLASVFDKYPNMIVVDYTVPAAVNGN   74 (213)
Q Consensus         1 MG~~i~~~~~-~~~~elv~~~~~~~-~~~g~~~-~~~~---~~v~i~~~~~~~~~l~~~~~~~~d~VvIDFS~p~~~~~~   74 (213)
                      |||.+++++. +++++||+++++.+ ...|+|+ ++.|   .+++++  +|++++++     .+| |+||||.|+++.++
T Consensus        33 MGr~i~~~v~~~~~~eLvg~vd~~~~~~~G~d~gel~G~~~~gv~v~--~dl~~ll~-----~aD-VvIDFT~p~a~~~~  104 (288)
T 3ijp_A           33 MGRELITAIQRRKDVELCAVLVRKGSSFVDKDASILIGSDFLGVRIT--DDPESAFS-----NTE-GILDFSQPQASVLY  104 (288)
T ss_dssp             HHHHHHHHHHTCSSEEEEEEBCCTTCTTTTSBGGGGTTCSCCSCBCB--SCHHHHTT-----SCS-EEEECSCHHHHHHH
T ss_pred             HHHHHHHHHHhCCCCEEEEEEecCCccccccchHHhhccCcCCceee--CCHHHHhc-----CCC-EEEEcCCHHHHHHH
Confidence            8999999998 78999999999753 4567776 3433   467775  58887653     689 89999999999999


Q ss_pred             HHHHHhcCCCEEEEcCCCCHHHHHHHHHccC-CcEEEccChhHHHHHHHHHHHHHHHhcCCCCCCCcEEEEeccCCCCCC
Q 028115           75 AELYSKVGVPFVMGTTGGDRVRLHETIENSN-VYAVISPQMGKQVVAFLAAMEIMAEQFPGAFSGYSLQVLESHQAGKLD  153 (213)
Q Consensus        75 ~~~~~~~g~~~ViGTTG~~~~~~~~~~~~~~-~~~v~a~N~SlGv~ll~~l~~~aa~~l~~~~~~~dieI~E~HH~~K~D  153 (213)
                      +++|+++|+|+|+|||||+++++++|.++++ +|+|||||||+|||+|+++++++|++|+   ++||+||+|+||++|+|
T Consensus       105 ~~~~l~~Gv~vViGTTG~~~e~~~~L~~aa~~~~~~~a~N~SiGv~ll~~l~~~aa~~l~---~~~dieIiE~HH~~K~D  181 (288)
T 3ijp_A          105 ANYAAQKSLIHIIGTTGFSKTEEAQIADFAKYTTIVKSGNMSLGVNLLANLVKRAAKALD---DDFDIEIYEMHHANKVD  181 (288)
T ss_dssp             HHHHHHHTCEEEECCCCCCHHHHHHHHHHHTTSEEEECSCCCHHHHHHHHHHHHHHHHSC---TTSEEEEEEEECTTCCC
T ss_pred             HHHHHHcCCCEEEECCCCCHHHHHHHHHHhCcCCEEEECCCcHHHHHHHHHHHHHHHhcC---CCCCEEEEEccCCCCCC
Confidence            9999999999999999999998888888776 9999999999999999999999999997   68999999999999999


Q ss_pred             c-hHHHHHHHHHH-HhcCCC------cCcccccccCCCCCcccccCccCcccCCCceEEEEEeCCCCC
Q 028115          154 T-SGTAKAVISCF-QKLGVS------FDMDQIQMIRDPKQQLEMVGVPEEHLPGHAFHMYHLTSPDQT  213 (213)
Q Consensus       154 a-SGTA~~la~~~-~~~~~~------~~~~~~~~~r~~~~~~r~g~i~geh~~G~~~htv~~~s~~~~  213 (213)
                      + ||||++|++.+ +++++.      ++|+++.+.|. .+.+++-++|++.++|  .|+|.|.+++++
T Consensus       182 aPSGTA~~la~~i~~~~~~~~~~~~~~~r~g~~g~r~-~~~i~i~s~R~g~ivg--~h~V~f~~~~e~  246 (288)
T 3ijp_A          182 SPSGTALLLGQAAAEGRNIMLKNVSVNGRSGHTGKRE-KGTIGFACSRGGTVIG--DHSITFAGENER  246 (288)
T ss_dssp             SSCHHHHHHHHHHHHHTTSCHHHHEEECGGGCCSCCC-TTCEEEEEEECTTCCE--EEEEEEEETTEE
T ss_pred             CCCHHHHHHHHHHHHHhCCCcccccccccccccCCcC-CCCccEEEEECCCCCE--EEEEEecCCCcE
Confidence            9 99999999966 667754      47888888886 4678888888899999  999999999864

PyMOL of 3ijp

>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis}	Back alignment and structure

>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3	Back alignment and structure

>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus}	Back alignment and structure

>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A*	Back alignment and structure

>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A*	Back alignment and structure

>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1	Back alignment and structure

>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix}	Back alignment and structure

>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii}	Back alignment and structure

>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A*	Back alignment and structure

>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A*	Back alignment and structure

>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus}	Back alignment and structure

>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B*	Back alignment and structure

>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis}	Back alignment and structure

>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A*	Back alignment and structure

>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum}	Back alignment and structure

>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A*	Back alignment and structure

>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum}	Back alignment and structure

>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis}	Back alignment and structure

>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum}	Back alignment and structure

>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V}	Back alignment and structure

>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A*	Back alignment and structure

>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A	Back alignment and structure

>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti}	Back alignment and structure

>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A*	Back alignment and structure

>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A*	Back alignment and structure

>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima}	Back alignment and structure

>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens}	Back alignment and structure

>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2}	Back alignment and structure

>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica}	Back alignment and structure

>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5	Back alignment and structure

>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus}	Back alignment and structure

>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis}	Back alignment and structure

>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A*	Back alignment and structure

>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A*	Back alignment and structure

>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli}	Back alignment and structure

>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8	Back alignment and structure

>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens}	Back alignment and structure

>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A*	Back alignment and structure

>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua}	Back alignment and structure

>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A*	Back alignment and structure

>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium}	Back alignment and structure

>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A	Back alignment and structure

>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A	Back alignment and structure

>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12}	Back alignment and structure

>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A	Back alignment and structure

>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes}	Back alignment and structure

>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A*	Back alignment and structure

>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum}	Back alignment and structure

>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5	Back alignment and structure

>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima}	Back alignment and structure

>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A	Back alignment and structure

>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A*	Back alignment and structure

>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa}	Back alignment and structure

>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti}	Back alignment and structure

>2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10	Back alignment and structure

>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli}	Back alignment and structure

>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV}	Back alignment and structure

>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile}	Back alignment and structure

>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A	Back alignment and structure

>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X	Back alignment and structure

>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae}	Back alignment and structure

>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans}	Back alignment and structure

>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1	Back alignment and structure

>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A*	Back alignment and structure

>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum}	Back alignment and structure

>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5	Back alignment and structure

>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1	Back alignment and structure

>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri}	Back alignment and structure

>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A*	Back alignment and structure

>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi}	Back alignment and structure

>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A*	Back alignment and structure

>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1	Back alignment and structure

>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A*	Back alignment and structure

>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae}	Back alignment and structure

>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli}	Back alignment and structure

>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix}	Back alignment and structure

>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri}	Back alignment and structure

>2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis}	Back alignment and structure

>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus}	Back alignment and structure

>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1	Back alignment and structure

>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum}	Back alignment and structure

>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1	Back alignment and structure

>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0	Back alignment and structure

>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea}	Back alignment and structure

>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A*	Back alignment and structure

>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis}	Back alignment and structure

>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica}	Back alignment and structure

>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii}	Back alignment and structure

>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans}	Back alignment and structure

>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, STRU genomics, protein structure initiative; 2.07A {Escherichia coli}	Back alignment and structure

>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0	Back alignment and structure

>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB}	Back alignment and structure

>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O	Back alignment and structure

>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp}	Back alignment and structure

>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima}	Back alignment and structure

>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida}	Back alignment and structure

>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C	Back alignment and structure

>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides}	Back alignment and structure

>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0	Back alignment and structure

>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1	Back alignment and structure

>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A*	Back alignment and structure

>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1	Back alignment and structure

>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A*	Back alignment and structure

>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E	Back alignment and structure

>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A	Back alignment and structure

>2h9a_A Carbon monoxide dehydrogenase corrinoid/iron- sulfur protein, gamma subunit; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_A*	Back alignment and structure

>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1	Back alignment and structure

>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae}	Back alignment and structure

>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile}	Back alignment and structure

>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12}	Back alignment and structure

>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A	Back alignment and structure

>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri}	Back alignment and structure

>3bul_A Methionine synthase; transferase, reactivation conformation, cobalamin, intermodular interactions, amino-acid biosynthesis, cobalt; HET: B12; 2.30A {Escherichia coli} SCOP: a.46.1.1 c.23.6.1 d.173.1.1 PDB: 3iv9_A* 3iva_A* 1k7y_A* 1k98_A* 1bmt_A*	Back alignment and structure

>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A	Back alignment and structure

>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A*	Back alignment and structure

>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A*	Back alignment and structure

>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV}	Back alignment and structure

>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis}	Back alignment and structure

>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti}	Back alignment and structure

>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri}	Back alignment and structure

>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri}	Back alignment and structure

>4djd_C C/Fe-SP, corrinoid/iron-sulfur protein large subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_C* 4djf_C*	Back alignment and structure

>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP}	Back alignment and structure

>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		213
d1yl7a1		135	c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate re	6e-07
d1vm6a3		128	c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate red	2e-06
d1diha1		162	c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate re	1e-05

>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Dihydrodipicolinate reductase
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 44.7 bits (105), Expect = 6e-07
 Identities = 32/151 (21%), Positives = 54/151 (35%), Gaps = 31/151 (20%)

Query: 1   MGKAVIKAADAAGLELVPVSFGTEEESGQKVEVCGKEIQVHGLSDRESVLASVFDKYPNM 60
           +G  +++A  AA                        ++ +    D    L+ + D     
Sbjct: 11  VGATMVRAVAAA-----------------------DDLTLSAELDAGDPLSLLTDGNTE- 46

Query: 61  IVVDYTVPAAVNGNAELYSKVGVPFVMGTTGGDRVRLHE----TIENSNVYAVISPQMGK 116
           +V+D+T P  V GN E     G+  V+GTTG    R  +     +   N   +I+P    
Sbjct: 47  VVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFTS 106

Query: 117 QVVAFLAAMEIMAEQFPGAFSGYSLQVLESH 147
            V   L A+  +AE+         L+ L   
Sbjct: 107 FVPGVLLAVRRIAER---PGLTVGLEPLLDL 134

PyMOL of d1yl7a1

>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Length = 128	Back information, alignment and structure

>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Length = 162	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		213
d1yl7a1		135	Dihydrodipicolinate reductase {Mycobacterium tuber	100.0
d1diha1		162	Dihydrodipicolinate reductase {Escherichia coli [T	100.0
d1vm6a3		128	Dihydrodipicolinate reductase {Thermotoga maritima	99.95
d1vm6a2		86	Dihydrodipicolinate reductase {Thermotoga maritima	99.87
d1diha2		110	Dihydrodipicolinate reductase {Escherichia coli [T	99.87
d1yl7a2		109	Dihydrodipicolinate reductase {Mycobacterium tuber	99.84
d1j5pa4		132	Hypothetical protein TM1643 {Thermotoga maritima [	98.21
d1f06a1		170	Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb	97.41
d1ydwa1		184	Probable oxidoreductase At4g09670 {Thale cress (Ar	96.87
d1y81a1		116	Hypothetical protein PF0725 {Pyrococcus furiosus [	96.57
d1h6da1		221	Glucose-fructose oxidoreductase, N-terminal domain	96.11
d2dt5a2		126	Transcriptional repressor Rex, C-terminal domain {	96.02
d1iuka_		136	Hypothetical protein TT1466 {Thermus thermophilus	96.01
d1tlta1		164	Virulence factor MviM {Escherichia coli [TaxId: 56	95.42
d2d59a1		139	Hypothetical protein PH1109 {Pyrococcus horikoshii	95.39
d1xeaa1		167	Putative oxidoreductase VCA1048 {Vibrio cholerae [	95.05
d1zh8a1		181	Hypothetical protein TM0312 {Thermotoga maritima [	94.81
d1b7go1		178	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	94.33
d1oi7a1		121	Succinyl-CoA synthetase, alpha-chain, N-terminal (	93.93
d2csua1		129	Acetate-CoA ligase alpha chain, AcdA, N-terminal d	93.76
d2nu7a1		119	Succinyl-CoA synthetase, alpha-chain, N-terminal (	93.51
d1euca1		130	Succinyl-CoA synthetase, alpha-chain, N-terminal (	92.96
d2nvwa1		237	Galactose/lactose metabolism regulatory protein GA	92.69
d3bula2		156	Methionine synthase, C-terminal domain {Escherichi	92.61
d2czca2		172	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	92.31
d1xhfa1		121	Aerobic respiration control protein ArcA, N-termin	90.75
d1cf2o1		171	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	89.66
d1zh2a1		119	Transcriptional regulatory protein KdpE, N-termina	89.23
d1ko7a1		129	HPr kinase/phoshatase HprK N-terminal domain {Stap	88.7
d1e5qa1		182	Saccharopine reductase {Rice blast fungus (Magnapo	86.23
d2f1ka2		165	Prephenate dehydrogenase TyrA {Synechocystis sp. p	85.98
d7reqa2		168	Methylmalonyl-CoA mutase alpha subunit, C-terminal	85.82
d1lc0a1		172	Biliverdin reductase {Rat (Rattus norvegicus) [Tax	85.73
d2a9pa1		117	DNA-binding response regulator MicA, N-terminal do	85.5
d1i36a2		152	Conserved hypothetical protein MTH1747 {Archaeon M	85.31
d1u0sy_		118	CheY protein {Thermotoga maritima [TaxId: 2336]}	85.13
d1zgza1		120	TorCAD operon transcriptional regulator TorD, N-te	85.0
d1lssa_		132	Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax	84.46
d1mvoa_		121	PhoP receiver domain {Bacillus subtilis [TaxId: 14	84.27
d1s8na_		190	Probable two-component system transcriptional regu	84.11
d1vpda2		161	Hydroxyisobutyrate dehydrogenase {Salmonella typhi	82.96
d2pl1a1		119	PhoP receiver domain {Escherichia coli [TaxId: 562	82.59
d2fvya1		305	Galactose/glucose-binding protein {Escherichia col	82.52
d1jyea_		271	Lac-repressor (lacR) core (C-terminal domain) {Esc	81.92
d2pgda2		176	6-phosphogluconate dehydrogenase {Sheep (Ovis orie	81.2
d1guda_		288	D-allose-binding protein {Escherichia coli [TaxId:	81.06
d1jqba2		174	Bacterial secondary alcohol dehydrogenase {Clostri	80.93
d1dbwa_		123	Transcriptional regulatory protein FixJ, receiver	80.26
d1mb3a_		123	Cell division response regulator DivK {Caulobacter	80.18

>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Dihydrodipicolinate reductase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=1e-36  Score=240.72  Aligned_cols=120  Identities=25%  Similarity=0.309  Sum_probs=104.4

Q ss_pred             ChHHHHHHHH-hCCCeEEEEecCCCccccccccccCceeEeecCCchhHHHhhhhcCCCCEEEEEcCChHHHHHHHHHHH
Q 028115            1 MGKAVIKAAD-AAGLELVPVSFGTEEESGQKVEVCGKEIQVHGLSDRESVLASVFDKYPNMIVVDYTVPAAVNGNAELYS   79 (213)
Q Consensus         1 MG~~i~~~~~-~~~~elv~~~~~~~~~~g~~~~~~~~~v~i~~~~~~~~~l~~~~~~~~d~VvIDFS~p~~~~~~~~~~~   79 (213)
                      |||+|++++. +++++|+++++...                    ++..    +...++| |+||||+|+++.+++++|+
T Consensus        11 MG~~i~~~i~~~~~~~l~~~~d~~~--------------------~~~~----~~~~~~D-vvIDFS~p~~~~~~~~~~~   65 (135)
T d1yl7a1          11 VGATMVRAVAAADDLTLSAELDAGD--------------------PLSL----LTDGNTE-VVIDFTHPDVVMGNLEFLI   65 (135)
T ss_dssp             HHHHHHHHHHHSTTSEEEEEECTTC--------------------CTHH----HHTTTCS-EEEECCCTTTHHHHHHHHH
T ss_pred             HHHHHHHHHHhCCCCEEEEEEecCC--------------------chhh----hccccCC-EEEEcccHHHHHHHHHHHH
Confidence            9999999987 78999999987542                    1111    1224689 9999999999999999999


Q ss_pred             hcCCCEEEEcCCCCHHHHHHHHH---ccC-CcEEEccChhHHHHHHHHHHHHHHHhcCCCCCCCcEEEEeccC
Q 028115           80 KVGVPFVMGTTGGDRVRLHETIE---NSN-VYAVISPQMGKQVVAFLAAMEIMAEQFPGAFSGYSLQVLESHQ  148 (213)
Q Consensus        80 ~~g~~~ViGTTG~~~~~~~~~~~---~~~-~~~v~a~N~SlGv~ll~~l~~~aa~~l~~~~~~~dieI~E~HH  148 (213)
                      ++|+|+|+|||||+++|++.+.+   +++ +|++||||||+|||+|+++++++++.+.   ++||+||+|.||
T Consensus        66 ~~~~~~ViGTTG~~~~~~~~l~~~~~~~~~ipil~apNfSlGvnll~~l~~~aa~~l~---~~~diEiIe~hH  135 (135)
T d1yl7a1          66 DNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFTSFVPGVLLAVRRIAERPG---LTVGLEPLLDLH  135 (135)
T ss_dssp             HTTCEEEECCCCCCHHHHHHHHHHHHSCTTCEEEECSCCGGGHHHHHHHHHHGGGSCE---EEESSGGGSCCC
T ss_pred             hcCCCEEEeccccchhHHHHHHHHHHhcCCCCEEEcCCccHHHHHHHHHHHHHHHhcc---ccCCeeehhhcC
Confidence            99999999999999998888876   344 9999999999999999999999999875   578999999999

PyMOL of d1yl7a1

>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1vm6a2 d.81.1.3 (A:97-182) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1diha2 d.81.1.3 (A:131-240) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yl7a2 d.81.1.3 (A:106-214) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]}	Back information, alignment and structure

>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}	Back information, alignment and structure

>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]}	Back information, alignment and structure

>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]}	Back information, alignment and structure

>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ko7a1 c.98.2.1 (A:1-129) HPr kinase/phoshatase HprK N-terminal domain {Staphylococcus xylosus [TaxId: 1288]}	Back information, alignment and structure

>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}	Back information, alignment and structure

>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}	Back information, alignment and structure

>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}	Back information, alignment and structure

>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure