Citrus Sinensis ID: 028129

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MAFAHYLTAVRPVPVVTSEQTKISILPLFTSSSSSSSSVSTQSLFSKARKLSLFPRFRRIGHKAKVKSPESEINSVAEAFTNFKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVVVIDERQKESLPEHENRLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHHccEEEEEEEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEcHHcccccEEEEEccccccccHHHHHHHHcccccEEEEcc
ccHHHHHHcccccccccccccccccccccccccccccccccccccccccHcccHHHHHHHHccccccccccHHHHHHHHHHHccEEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHcccHHHHHEEEccccccccEEEEEcHHHHccccEEEEEHHHHHcccccHHHHHHcccccEEEEcc
mafahyltavrpvpvvtseqtkisilplftssssssssvstQSLFSKARKlslfprfrrighkakvkspesEINSVAEAFTNFKHlllpitdqnpylsegtRQAAATTAALAKKYGADITVVVIDerqkeslpehENRLSSIRWHLSEGGFQEFRLLErlgegsskptaiigDVADELNLDLVIISMEAIHSKHVDanllaefipcpvlllpl
mafahyltavrpvpvvtsEQTKISILplftssssssssvSTQSLfskarklslfprfrrighkakvkspeseiNSVAEAFTNFKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVVVIDerqkeslpeheNRLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL
MAFAHYLTAVRPVPVVTSEQTKISILPlftssssssssvstqslfsKARKLSLFPRFRRIGHKAKVKSPESEINSVAEAFTNFKHLLLPITDQNPYLSEGTRQaaattaalaKKYGADITVVVIDERQKESLPEHENRLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL
**************************************************************************SVAEAFTNFKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVVVID***************SIRWHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLL**
*****YLTAVRPVP******************************************************************TNFKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVVVIDER********************EGGFQEFRLLERL**GSSKPTAIIGDVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL
MAFAHYLTAVRPVPVVTSEQTKISILPLF*****************KARKLSLFPRFRRIGHK*********INSVAEAFTNFKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVVVIDERQ*********RLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL
*AF*HYLTAVRPVPVVTS**TK***************************************H*AKVKSPESEINSVAEAFTNFKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVVVIDERQKESLPEHENRLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFAHYLTAVRPVPVVTSEQTKISILPLFTSSSSSSSSVSTQSLFSKARKLSLFPRFRRIGHKAKVKSPESEINSVAEAFTNFKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVVVIDERQKESLPEHENRLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
224133624219 predicted protein [Populus trichocarpa] 0.981 0.954 0.721 4e-79
356559252213 PREDICTED: uncharacterized protein LOC10 0.985 0.985 0.708 2e-73
255645668213 unknown [Glycine max] 0.985 0.985 0.708 4e-73
225431334211 PREDICTED: uncharacterized protein LOC10 0.990 1.0 0.723 3e-72
388502318206 unknown [Lotus japonicus] 0.948 0.980 0.672 5e-70
255580629212 conserved hypothetical protein [Ricinus 0.981 0.985 0.685 2e-69
449456841210 PREDICTED: uncharacterized protein LOC10 0.868 0.880 0.703 1e-67
357517939201 hypothetical protein MTR_8g075110 [Medic 0.938 0.995 0.621 2e-64
312283261210 unnamed protein product [Thellungiella h 0.779 0.790 0.698 2e-62
242045440196 hypothetical protein SORBIDRAFT_02g03144 0.887 0.964 0.625 1e-61
>gi|224133624|ref|XP_002327641.1| predicted protein [Populus trichocarpa] gi|222836726|gb|EEE75119.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  300 bits (767), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 182/223 (81%), Gaps = 14/223 (6%)

Query: 1   MAFAHYLTAVRPVPVVTSEQTKISILP----------LFTSSSSSSSSVSTQSLFSKARK 50
           MAFAHYL AV   P   S  TK ++            L  + + S  ++S+ SL +KARK
Sbjct: 1   MAFAHYLVAV---PTEPSNLTKAALFSTSPPPPPPPPLSFNKNHSDLTLSSTSLKTKARK 57

Query: 51  LSLFPRFRRIGHKAKVKSPESEINSVAEAFTNFKHLLLPITDQNPYLSEGTRQAAATTAA 110
           LS+FP+FRR G K K K+ ESE++  AEAFTNFKHLLLPITD NPYLSEGTRQAAAT AA
Sbjct: 58  LSIFPKFRRTGQKGKAKAKESEVSLAAEAFTNFKHLLLPITDTNPYLSEGTRQAAATAAA 117

Query: 111 LAKKYGADITVVVIDERQKESLPEHENRLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAI 170
           LAKKYGADITVVVIDERQKESLPEHE ++SSIRWHL+EGGFQEF+LLERLGEG SKPTAI
Sbjct: 118 LAKKYGADITVVVIDERQKESLPEHETQMSSIRWHLAEGGFQEFKLLERLGEG-SKPTAI 176

Query: 171 IGDVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL 213
           IG+VAD+L+LDLV+ISMEAIHSKHVDANLLAEFIPCPVLLLPL
Sbjct: 177 IGEVADDLSLDLVVISMEAIHSKHVDANLLAEFIPCPVLLLPL 219

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356559252|ref|XP_003547914.1| PREDICTED: uncharacterized protein LOC100785706 [Glycine max] Back     alignment and taxonomy information
>gi|255645668|gb|ACU23328.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225431334|ref|XP_002277779.1| PREDICTED: uncharacterized protein LOC100248935 [Vitis vinifera] gi|296084694|emb|CBI25836.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388502318|gb|AFK39225.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255580629|ref|XP_002531137.1| conserved hypothetical protein [Ricinus communis] gi|223529250|gb|EEF31222.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449456841|ref|XP_004146157.1| PREDICTED: uncharacterized protein LOC101219661 [Cucumis sativus] gi|449495078|ref|XP_004159728.1| PREDICTED: uncharacterized protein LOC101228414 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357517939|ref|XP_003629258.1| hypothetical protein MTR_8g075110 [Medicago truncatula] gi|355523280|gb|AET03734.1| hypothetical protein MTR_8g075110 [Medicago truncatula] gi|388493244|gb|AFK34688.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|312283261|dbj|BAJ34496.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|242045440|ref|XP_002460591.1| hypothetical protein SORBIDRAFT_02g031440 [Sorghum bicolor] gi|241923968|gb|EER97112.1| hypothetical protein SORBIDRAFT_02g031440 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
TAIR|locus:2156892210 AT5G66090 "AT5G66090" [Arabido 0.957 0.971 0.534 8e-53
TAIR|locus:2156892 AT5G66090 "AT5G66090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 547 (197.6 bits), Expect = 8.0e-53, P = 8.0e-53
 Identities = 117/219 (53%), Positives = 145/219 (66%)

Query:     1 MAFAHYLTAVRPVPVVTSEQTKISILPXXXXXXXXXXXXXXXXXXXKARKLSLFPRFRRI 60
             MA AH + AV  +   + + T    LP                   + + LSL    R +
Sbjct:     1 MASAHSIAAVSVLDAASKQAT----LPSSSSSSSALYPLSSLRSKPRQQLLSL----RSV 52

Query:    61 GHKAKVKSPESEINS------VAEAFTNFKHLLLPITDQNPYLSEGTRQXXXXXXXXXKK 114
               K +VK+   E  +      V +AF+N KHLLLP+ D+NPYLSEGTRQ         KK
Sbjct:    53 ALKGRVKAQAKEAEASPSPVGVGDAFSNVKHLLLPVIDRNPYLSEGTRQAAATTTSLAKK 112

Query:   115 YGADITVVVIDERQKESLPEHENRLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAIIGDV 174
             YGADITVVVIDE ++ES  EHE ++S+IRWHLSEGGF+EF+LLERLGEG  K TAIIG+V
Sbjct:   113 YGADITVVVIDEEKRESSSEHETQVSNIRWHLSEGGFEEFKLLERLGEGK-KATAIIGEV 171

Query:   175 ADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL 213
             ADEL ++LV++SMEAIHSK++DANLLAEFIPCPVLLLPL
Sbjct:   172 ADELKMELVVMSMEAIHSKYIDANLLAEFIPCPVLLLPL 210


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.136   0.387    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      213       185   0.00080  110 3  11 22  0.44    32
                                                     31  0.41    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  583 (62 KB)
  Total size of DFA:  140 KB (2087 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  15.99u 0.22s 16.21t   Elapsed:  00:00:01
  Total cpu time:  15.99u 0.22s 16.21t   Elapsed:  00:00:01
  Start:  Fri May 10 03:44:13 2013   End:  Fri May 10 03:44:14 2013
GO:0003674 "molecular_function" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009570 "chloroplast stroma" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00570047
hypothetical protein (219 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
pfam00582139 pfam00582, Usp, Universal stress protein family 1e-04
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 3e-04
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information 
 Score = 40.2 bits (94), Expect = 1e-04
 Identities = 29/150 (19%), Positives = 53/150 (35%), Gaps = 32/150 (21%)

Query: 83  FKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVV-VIDERQKESLPEHENRLSS 141
           +K +L+ +       SE + +A      LAK+ GA++ ++ VID     +  E       
Sbjct: 2   YKRILVAVDG-----SEESERALEWALELAKRRGAELILLHVIDPEPSGAASEALEEEEE 56

Query: 142 IRWHLSEGGFQEFRLLERLGEGSSK-------PTAIIGDVADELNLDLVIISMEAIHSKH 194
                 E   +        G    +       P   I +VA+E + DL+++         
Sbjct: 57  EELEEEEAEAEALAAAAEAGGVVVEVVVRGGDPAEAILEVAEEEDADLIVMG-------S 109

Query: 195 VDANLLAEFI------------PCPVLLLP 212
              + L   +            PCPVL++ 
Sbjct: 110 RGRSGLRRLLLGSVAEKVLRHAPCPVLVVR 139

The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity. Length = 139
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
PRK15456142 universal stress protein UspG; Provisional 99.86
PRK15005144 universal stress protein F; Provisional 99.85
PRK15118144 universal stress global response regulator UspA; P 99.84
PRK09982142 universal stress protein UspD; Provisional 99.83
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.81
PRK10116142 universal stress protein UspC; Provisional 99.8
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.78
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.77
PRK11175305 universal stress protein UspE; Provisional 99.75
cd01987124 USP_OKCHK USP domain is located between the N-term 99.74
PRK11175 305 universal stress protein UspE; Provisional 99.73
cd00293130 USP_Like Usp: Universal stress protein family. The 99.62
COG0589154 UspA Universal stress protein UspA and related nuc 99.55
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.53
PRK10490 895 sensor protein KdpD; Provisional 98.82
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 98.36
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 97.73
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 96.71
PRK12342 254 hypothetical protein; Provisional 96.08
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 96.05
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 95.9
PLN03159832 cation/H(+) antiporter 15; Provisional 95.85
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 95.76
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 95.7
PRK03359 256 putative electron transfer flavoprotein FixA; Revi 95.56
PLN03159 832 cation/H(+) antiporter 15; Provisional 95.15
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 94.11
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 93.54
cd01715168 ETF_alpha The electron transfer flavoprotein (ETF) 91.25
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 89.66
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 89.46
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 88.3
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 87.18
cd01714202 ETF_beta The electron transfer flavoprotein (ETF) 87.16
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 86.92
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 86.26
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 85.4
PLN00200 404 argininosuccinate synthase; Provisional 83.84
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 83.69
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 83.28
PRK13820 394 argininosuccinate synthase; Provisional 82.93
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 82.33
TIGR00268 252 conserved hypothetical protein TIGR00268. The N-te 82.25
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 81.2
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.86  E-value=1.1e-20  Score=146.98  Aligned_cols=120  Identities=19%  Similarity=0.268  Sum_probs=90.3

Q ss_pred             CCCcEEEEeeCCCCCCC--HHHHHHHHHHHHHHhhcCCEEEEEEEeCCCCCC------h--hhH--------HHHHHHHH
Q 028129           82 NFKHLLLPITDQNPYLS--EGTRQAAATTAALAKKYGADITVVVIDERQKES------L--PEH--------ENRLSSIR  143 (213)
Q Consensus        82 ~~k~ILV~vD~~~~~~S--~~s~~Al~~A~~LA~~~~a~L~ll~V~~~~~~~------~--~~~--------~~~l~~~~  143 (213)
                      ||++||+|+|     ||  +.+.+|+++|..+|+.. ++|+++|+.+.....      .  .+.        ++.++.+.
T Consensus         1 m~~~ILv~vD-----~S~~~~s~~al~~A~~la~~~-~~l~llhv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~   74 (142)
T PRK15456          1 MYKTIIMPVD-----VFEMELSDKAVRHAEFLAQDD-GVIHLLHVLPGSASLSLHRFAADVRRFEEHLQHEAEERLQTMV   74 (142)
T ss_pred             CCccEEEecc-----CCchhHHHHHHHHHHHHHhcC-CeEEEEEEecCcccccccccccchhhHHHHHHHHHHHHHHHHH
Confidence            6999999999     88  48999999999999874 699999887643210      0  111        11122222


Q ss_pred             HHHHhCCCCceeEEEEEcccCCchHHHHHHHHHHcCCcEEEEcccCCCCC----CchHHHHHhcCCCcEEEEc
Q 028129          144 WHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDLVIISMEAIHSK----HVDANLLAEFIPCPVLLLP  212 (213)
Q Consensus       144 ~~l~~~g~~~~~v~~~v~~G~~~p~~~Il~~A~e~~aDLIVmG~~g~~~~----Gs~~~~vl~~a~cPVLvVp  212 (213)
                      +.+...+.+   +...+..|+  |.++|+++|+++++||||||+||++..    |+++..++++++||||+||
T Consensus        75 ~~~~~~~~~---v~~~v~~G~--~~~~I~~~a~~~~~DLIVmG~~g~~~~~~llGS~a~~v~~~a~~pVLvV~  142 (142)
T PRK15456         75 SHFTIDPSR---IKQHVRFGS--VRDEVNELAEELGADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR  142 (142)
T ss_pred             HHhCCCCcc---eEEEEcCCC--hHHHHHHHHhhcCCCEEEEcCCCCCccceecCccHHHHHHcCCCCEEEeC
Confidence            222223333   777788896  999999999999999999999987422    8999999999999999997

>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>cd01715 ETF_alpha The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>cd01714 ETF_beta The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 8e-08
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 1e-06
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 3e-06
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 4e-06
3dlo_A155 Universal stress protein; unknown function, struct 4e-06
3fdx_A143 Putative filament protein / universal stress PROT; 4e-06
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 5e-06
3tnj_A150 Universal stress protein (USP); structural genomic 8e-06
3s3t_A146 Nucleotide-binding protein, universal stress PROT 1e-04
3fg9_A156 Protein of universal stress protein USPA family; A 1e-04
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 3e-04
2z08_A137 Universal stress protein family; uncharacterized c 6e-04
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
 Score = 48.8 bits (117), Expect = 8e-08
 Identities = 25/149 (16%), Positives = 56/149 (37%), Gaps = 30/149 (20%)

Query: 83  FKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVV-VIDERQKESLPEHENRLSS 141
           +KH+L+   D    LSE +         +AK++ A ++++ V            +  +SS
Sbjct: 2   YKHILVA-VD----LSEESPILLKKAVGIAKRHDAKLSIIHVDVNFSDLYTGLIDVNMSS 56

Query: 142 IRWHLSEGGFQEFR-LLERLG---------EGSSKPTAIIGDVADELNLDLVIISMEAIH 191
           ++  +S    +    L E +           G      ++ D  ++ ++DL++      H
Sbjct: 57  MQDRISTETQKALLDLAESVDYPISEKLSGSGD--LGQVLSDAIEQYDVDLLVT---GHH 111

Query: 192 SKHVDANLL---AEFI----PCPVLLLPL 213
                 + L      +       +L++PL
Sbjct: 112 QDF--WSKLMSSTRQVMNTIKIDMLVVPL 138
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.87
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.86
3dlo_A155 Universal stress protein; unknown function, struct 99.86
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.85
3fg9_A156 Protein of universal stress protein USPA family; A 99.84
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.84
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.84
2z08_A137 Universal stress protein family; uncharacterized c 99.84
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.83
3tnj_A150 Universal stress protein (USP); structural genomic 99.82
3fdx_A143 Putative filament protein / universal stress PROT; 99.82
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.8
3loq_A294 Universal stress protein; structural genomics, PSI 99.79
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.79
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.79
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.79
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.77
3olq_A319 Universal stress protein E; structural genomics, P 99.75
3olq_A 319 Universal stress protein E; structural genomics, P 99.75
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.75
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.74
3loq_A 294 Universal stress protein; structural genomics, PSI 99.72
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.71
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.69
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 95.48
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 94.5
1o97_C 264 Electron transferring flavoprotein beta-subunit; F 92.62
1efv_B 255 Electron transfer flavoprotein; electron transport 92.55
1efp_B 252 ETF, protein (electron transfer flavoprotein); ele 91.41
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 91.01
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 90.75
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 90.59
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 90.29
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 89.91
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 88.99
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 88.67
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 88.49
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 88.09
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 87.44
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 86.9
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 86.89
3grc_A140 Sensor protein, kinase; protein structure initiati 86.87
2lpm_A123 Two-component response regulator; transcription re 86.36
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 86.18
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 86.06
3cnb_A143 DNA-binding response regulator, MERR family; signa 85.97
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 85.94
3gt7_A154 Sensor protein; structural genomics, signal receiv 85.76
3cg4_A142 Response regulator receiver domain protein (CHEY-; 85.52
3i42_A127 Response regulator receiver domain protein (CHEY- 85.17
2zay_A147 Response regulator receiver protein; structural ge 84.76
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 84.66
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 84.31
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 84.15
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 84.03
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 83.66
3f6c_A134 Positive transcription regulator EVGA; structural 82.02
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 80.88
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 80.85
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 80.74
3nhm_A133 Response regulator; protein structure initiative I 80.63
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 80.54
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 80.32
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 80.22
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 80.08
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
Probab=99.87  E-value=2.9e-21  Score=147.93  Aligned_cols=122  Identities=15%  Similarity=0.338  Sum_probs=98.4

Q ss_pred             cCCCcEEEEeeCCCCCCCHHHHHHHHHHHHHHhhcCCEEEEEEEeCCCCCC-h--------------hhHHHHHHHHHHH
Q 028129           81 TNFKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVVVIDERQKES-L--------------PEHENRLSSIRWH  145 (213)
Q Consensus        81 ~~~k~ILV~vD~~~~~~S~~s~~Al~~A~~LA~~~~a~L~ll~V~~~~~~~-~--------------~~~~~~l~~~~~~  145 (213)
                      .||++||||+|     +|+.+..++++|..+|+..+++|+++|+.+..... .              .+.++.++.+.+.
T Consensus         3 ~~~~~ILv~~D-----~s~~s~~al~~A~~la~~~~a~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~   77 (146)
T 3s3t_A            3 ARYTNILVPVD-----SSDAAQAAFTEAVNIAQRHQANLTALYVVDDSAYHTPALDPVLSELLDAEAAHAKDAMRQRQQF   77 (146)
T ss_dssp             CCCCEEEEECC-----SSHHHHHHHHHHHHHHHHHTCEEEEEEEEECCCCCCGGGHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CccceEEEEcC-----CCHHHHHHHHHHHHHHHhcCCEEEEEEEecCccccccccccccHHHHHHHHHHHHHHHHHHHHH
Confidence            57999999999     89999999999999999999999999886543221 1              0122334444455


Q ss_pred             HHhCCC-CceeEEEEEcccCCchHHHHHH-HHHHcCCcEEEEcccCCCC-----CCchHHHHHhcCCCcEEEEc
Q 028129          146 LSEGGF-QEFRLLERLGEGSSKPTAIIGD-VADELNLDLVIISMEAIHS-----KHVDANLLAEFIPCPVLLLP  212 (213)
Q Consensus       146 l~~~g~-~~~~v~~~v~~G~~~p~~~Il~-~A~e~~aDLIVmG~~g~~~-----~Gs~~~~vl~~a~cPVLvVp  212 (213)
                      +.+.|+ +   ++..+..|+  +.++|++ +|++.++||||||+++++.     .|++...++++++||||+||
T Consensus        78 ~~~~g~~~---~~~~~~~g~--~~~~I~~~~a~~~~~dliV~G~~~~~~~~~~~~Gs~~~~vl~~~~~pVlvV~  146 (146)
T 3s3t_A           78 VATTSAPN---LKTEISYGI--PKHTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGSTTSYVVDHAPCNVIVIR  146 (146)
T ss_dssp             HTTSSCCC---CEEEEEEEC--HHHHHHHHHHHSTTCCEEEEESCCSSCTTTCSSCHHHHHHHHHCSSEEEEEC
T ss_pred             HHhcCCcc---eEEEEecCC--hHHHHHHHHHhhcCCCEEEECCCCCCCcceEEEcchHHHHhccCCCCEEEeC
Confidence            556677 5   666777896  9999999 9999999999999988632     28899999999999999997
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 213
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 0.001
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Universal stress protein A, UspA
species: Haemophilus influenzae [TaxId: 727]

 Score = 36.1 bits (82), Expect = 0.001
 Identities = 25/142 (17%), Positives = 55/142 (38%), Gaps = 16/142 (11%)

Query: 83  FKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITV-VVIDERQKESLPEHENRLSS 141
           +KH+L+ + D    LSE +         +AK++ A +++  V            +  +SS
Sbjct: 2   YKHILVAV-D----LSEESPILLKKAVGIAKRHDAKLSIIHVDVNFSDLYTGLIDVNMSS 56

Query: 142 IRWHLSEGGFQEFR-LLERLGEGSSKPTAIIGDVADELNLDLVIISMEAI-HSKHVDANL 199
           ++  +S    +    L E +    S+  +  GD+   L+  +    ++ +    H D   
Sbjct: 57  MQDRISTETQKALLDLAESVDYPISEKLSGSGDLGQVLSDAIEQYDVDLLVTGHHQDFWS 116

Query: 200 L----AEFI----PCPVLLLPL 213
                   +       +L++PL
Sbjct: 117 KLMSSTRQVMNTIKIDMLVVPL 138

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.88
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.84
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.84
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.83
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.81
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.77
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 95.84
d1efpb_246 Small, beta subunit of electron transfer flavoprot 95.38
d3clsd1192 Large, alpha subunit of electron transfer flavopro 94.33
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 93.62
d1efvb_ 252 Small, beta subunit of electron transfer flavoprot 92.28
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 91.87
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 91.79
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 91.68
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 91.54
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 91.25
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 90.28
d1s8na_ 190 Probable two-component system transcriptional regu 89.79
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 89.43
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 88.31
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 88.17
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 87.26
d1mb3a_123 Cell division response regulator DivK {Caulobacter 86.7
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 86.61
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 86.47
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 86.14
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 86.01
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 85.69
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 85.13
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 84.93
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 84.75
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 84.34
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 84.19
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 83.64
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 82.79
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 82.55
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 82.44
d1yioa2128 Response regulatory protein StyR, N-terminal domai 82.24
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 81.73
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 81.34
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.88  E-value=2e-22  Score=155.81  Aligned_cols=123  Identities=19%  Similarity=0.301  Sum_probs=97.6

Q ss_pred             cCCCcEEEEeeCCCCCCCHHHHHHHHHHHHHHhhcCCEEEEEEEeCCCCCC-------------h----h----------
Q 028129           81 TNFKHLLLPITDQNPYLSEGTRQAAATTAALAKKYGADITVVVIDERQKES-------------L----P----------  133 (213)
Q Consensus        81 ~~~k~ILV~vD~~~~~~S~~s~~Al~~A~~LA~~~~a~L~ll~V~~~~~~~-------------~----~----------  133 (213)
                      .||++||||+|     +|+.+.+++++|..+|+..+++|+++||.++....             .    +          
T Consensus         1 ~m~~~ILvavD-----~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   75 (160)
T d1mjha_           1 VMYKKILYPTD-----FSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKL   75 (160)
T ss_dssp             CCCCEEEEECC-----SCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHH
T ss_pred             CCcCeEEEEEC-----CCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHH
Confidence            38999999999     89999999999999999999999999875432110             0    0          


Q ss_pred             --hHHHHHHHHHHHHHhCCCCceeEEEEEcccCCchHHHHHHHHHHcCCcEEEEcccCCCC-----CCchHHHHHhcCCC
Q 028129          134 --EHENRLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAIIGDVADELNLDLVIISMEAIHS-----KHVDANLLAEFIPC  206 (213)
Q Consensus       134 --~~~~~l~~~~~~l~~~g~~~~~v~~~v~~G~~~p~~~Il~~A~e~~aDLIVmG~~g~~~-----~Gs~~~~vl~~a~c  206 (213)
                        +.++.++.+...+...|++   ++..+..|+  |.+.|+++|+++++||||||+++++.     -|+++..++++++|
T Consensus        76 ~~~~~~~l~~~~~~~~~~gv~---~~~~~~~G~--~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~  150 (160)
T d1mjha_          76 TEEAKNKMENIKKELEDVGFK---VKDIIVVGI--PHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNK  150 (160)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCE---EEEEEEEEC--HHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCS
T ss_pred             HHHHHHHHHHHHHHHHhcCCe---EEEEEEecc--HHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCC
Confidence              1112233333445566777   777888897  99999999999999999999998732     28999999999999


Q ss_pred             cEEEEcC
Q 028129          207 PVLLLPL  213 (213)
Q Consensus       207 PVLvVp~  213 (213)
                      |||+||.
T Consensus       151 pVlvV~~  157 (160)
T d1mjha_         151 PVLVVKR  157 (160)
T ss_dssp             CEEEECC
T ss_pred             CEEEEcC
Confidence            9999983
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure