Citrus Sinensis ID: 028267
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| 255559765 | 535 | dead box ATP-dependent RNA helicase, put | 0.938 | 0.370 | 0.665 | 5e-70 | |
| 225439904 | 524 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.890 | 0.358 | 0.663 | 2e-67 | |
| 297741568 | 523 | unnamed protein product [Vitis vinifera] | 0.886 | 0.357 | 0.658 | 2e-65 | |
| 147784525 | 554 | hypothetical protein VITISV_032421 [Viti | 0.872 | 0.332 | 0.643 | 8e-64 | |
| 449440077 | 616 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.943 | 0.323 | 0.611 | 1e-63 | |
| 224127806 | 531 | predicted protein [Populus trichocarpa] | 0.919 | 0.365 | 0.601 | 1e-58 | |
| 297833736 | 539 | hypothetical protein ARALYDRAFT_478294 [ | 0.919 | 0.359 | 0.584 | 1e-57 | |
| 356505198 | 537 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.943 | 0.370 | 0.560 | 4e-54 | |
| 6682259 | 545 | putative RNA helicase [Arabidopsis thali | 0.943 | 0.365 | 0.581 | 4e-53 | |
| 22330935 | 541 | DEAD-box ATP-dependent RNA helicase 57 [ | 0.933 | 0.364 | 0.577 | 3e-52 |
| >gi|255559765|ref|XP_002520902.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223540033|gb|EEF41611.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 269 bits (688), Expect = 5e-70, Method: Compositional matrix adjust.
Identities = 135/203 (66%), Positives = 164/203 (80%), Gaps = 5/203 (2%)
Query: 1 MEKGASFLFAGVSFDKKKFVTDFARFKENKESENLA--DDFSFVEGEKTDPEKAMVSFVK 58
MEKG SFLFAG++F+KKKF TDF+RFKE KE + A DD +E K++P++ VS VK
Sbjct: 1 MEKGTSFLFAGITFNKKKFATDFSRFKEKKECNDNAQTDDLRLLEAGKSEPDQVHVS-VK 59
Query: 59 KRKRKSIAG-ETVEGFNVFKSSKQLVPAVDKEKEKVE-DGPSKAKKELNKQIERDAVFRK 116
KRKRK++A E VEGFNVFKSSK + +++ ++ E D P + KELNKQIERDA+ RK
Sbjct: 60 KRKRKNVASSEKVEGFNVFKSSKSVALPSNQQNDQDEIDQPFRKNKELNKQIERDALLRK 119
Query: 117 KYNIHVSGANVPSPLRTFVKLSSRFGCESYLLRNLAELGYKEPTPIQRQAIPVLLSDREC 176
++IHVSG N+PSPL+ F +LSSR+GCESYLL NL ELG+KEPTPIQRQAIPVLLS REC
Sbjct: 120 HFHIHVSGNNIPSPLQNFSELSSRYGCESYLLHNLVELGFKEPTPIQRQAIPVLLSGREC 179
Query: 177 FACAPTGSGKTLAFLCPMLMKLR 199
FACAPTGSGKTLAF+CPMLMKL+
Sbjct: 180 FACAPTGSGKTLAFVCPMLMKLK 202
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225439904|ref|XP_002279705.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 57 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297741568|emb|CBI32700.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147784525|emb|CAN61726.1| hypothetical protein VITISV_032421 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449440077|ref|XP_004137811.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 57-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224127806|ref|XP_002329182.1| predicted protein [Populus trichocarpa] gi|222870963|gb|EEF08094.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297833736|ref|XP_002884750.1| hypothetical protein ARALYDRAFT_478294 [Arabidopsis lyrata subsp. lyrata] gi|297330590|gb|EFH61009.1| hypothetical protein ARALYDRAFT_478294 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356505198|ref|XP_003521379.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 57-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|6682259|gb|AAF23311.1|AC016661_36 putative RNA helicase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22330935|ref|NP_187583.2| DEAD-box ATP-dependent RNA helicase 57 [Arabidopsis thaliana] gi|75328099|sp|Q84TG1.1|RH57_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 57 gi|29028778|gb|AAO64768.1| At3g09720 [Arabidopsis thaliana] gi|110742885|dbj|BAE99340.1| RNA helicase like protein [Arabidopsis thaliana] gi|332641282|gb|AEE74803.1| DEAD-box ATP-dependent RNA helicase 57 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| TAIR|locus:2075034 | 541 | AT3G09720 [Arabidopsis thalian | 0.933 | 0.364 | 0.597 | 1.7e-57 | |
| UNIPROTKB|A5D7C1 | 596 | DDX52 "Probable ATP-dependent | 0.706 | 0.25 | 0.409 | 9.6e-26 | |
| MGI|MGI:1925644 | 598 | Ddx52 "DEAD (Asp-Glu-Ala-Asp) | 0.663 | 0.234 | 0.424 | 1e-25 | |
| UNIPROTKB|Q9Y2R4 | 599 | DDX52 "Probable ATP-dependent | 0.658 | 0.232 | 0.416 | 1e-24 | |
| UNIPROTKB|E2RB54 | 601 | DDX52 "Uncharacterized protein | 0.872 | 0.306 | 0.377 | 9.9e-23 | |
| DICTYBASE|DDB_G0274325 | 668 | ddx52 "DEAD/DEAH box helicase" | 0.791 | 0.25 | 0.36 | 1.6e-22 | |
| UNIPROTKB|J9P4L6 | 598 | DDX52 "Uncharacterized protein | 0.658 | 0.232 | 0.419 | 3.4e-22 | |
| RGD|621743 | 598 | Ddx52 "DEAD (Asp-Glu-Ala-Asp) | 0.668 | 0.235 | 0.4 | 3.4e-22 | |
| UNIPROTKB|I3LJA0 | 507 | DDX52 "Uncharacterized protein | 0.540 | 0.224 | 0.433 | 2.6e-21 | |
| ZFIN|ZDB-GENE-060623-1 | 606 | ddx52 "DEAD (Asp-Glu-Ala-Asp) | 0.900 | 0.313 | 0.341 | 4.3e-21 |
| TAIR|locus:2075034 AT3G09720 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 591 (213.1 bits), Expect = 1.7e-57, P = 1.7e-57
Identities = 123/206 (59%), Positives = 154/206 (74%)
Query: 1 MEKGASFLFAGVSFDKKKFVTDFARFKENKESE--NLADDFSFVEGEKTD-PE--KAMVS 55
MEK + FLF G +F+KKKF DFA+FK + E + N +F E E T+ PE K +VS
Sbjct: 1 MEKSSYFLFGGTNFNKKKFAPDFAKFKNSTEDDDSNKKVNFFVEEEEDTEQPEAEKVIVS 60
Query: 56 FVKKRKRKSIAGETVEGFNVFKSSKQLVPAVDKEKEKVEDGP--SKAKKELNKQIERDAV 113
KKRKR+S VEGF+VFKSSK+ A K +E++ KKELN+Q+ERDA+
Sbjct: 61 S-KKRKRRSSNSVPVEGFDVFKSSKK-ARAKGKAEEQITKNEIVENPKKELNRQMERDAL 118
Query: 114 FRKKYNIHVSGANVPSPLRTFVKLSSRFGCESYLLRNLAELGYKEPTPIQRQAIPVLLSD 173
RK+Y+IHVSG N+P PL++F +LSSR+GCE Y+LRNLAELG+KEPTPIQRQAIP+LLS
Sbjct: 119 SRKQYSIHVSGNNIPPPLKSFAELSSRYGCEGYILRNLAELGFKEPTPIQRQAIPILLSG 178
Query: 174 RECFACAPTGSGKTLAFLCPMLMKLR 199
RECFACAPTGSGKT AF+CPML+KL+
Sbjct: 179 RECFACAPTGSGKTFAFICPMLIKLK 204
|
|
| UNIPROTKB|A5D7C1 DDX52 "Probable ATP-dependent RNA helicase DDX52" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1925644 Ddx52 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 52" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y2R4 DDX52 "Probable ATP-dependent RNA helicase DDX52" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RB54 DDX52 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0274325 ddx52 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P4L6 DDX52 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|621743 Ddx52 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 52" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LJA0 DDX52 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060623-1 ddx52 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 52" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| cd00268 | 203 | cd00268, DEADc, DEAD-box helicases | 2e-20 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 4e-19 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 1e-16 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 8e-16 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 1e-15 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 6e-14 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 3e-13 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-12 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 2e-11 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 2e-10 | |
| COG1201 | 814 | COG1201, Lhr, Lhr-like helicases [General function | 7e-09 | |
| PRK13767 | 876 | PRK13767, PRK13767, ATP-dependent helicase; Provis | 6e-07 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 1e-06 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 3e-05 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 2e-04 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 3e-04 | |
| COG1204 | 766 | COG1204, COG1204, Superfamily II helicase [General | 4e-04 | |
| COG1199 | 654 | COG1199, DinG, Rad3-related DNA helicases [Transcr | 0.001 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 0.002 | |
| TIGR00614 | 470 | TIGR00614, recQ_fam, ATP-dependent DNA helicase, R | 0.003 |
| >gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases | Back alignment and domain information |
|---|
Score = 84.5 bits (210), Expect = 2e-20
Identities = 31/54 (57%), Positives = 38/54 (70%)
Query: 145 SYLLRNLAELGYKEPTPIQRQAIPVLLSDRECFACAPTGSGKTLAFLCPMLMKL 198
LLR + LG+++PTPIQ +AIP LLS R+ A TGSGKT AFL P+L KL
Sbjct: 8 PELLRGIYALGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEKL 61
|
A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 99.85 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.78 | |
| PTZ00110 | 545 | helicase; Provisional | 99.77 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 99.7 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 99.7 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 99.7 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 99.7 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 99.68 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.66 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 99.65 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.65 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 99.64 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 99.62 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 99.62 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.61 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.61 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.59 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 99.58 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 99.58 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.57 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.57 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.57 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 99.54 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 99.54 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 99.53 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.51 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 99.51 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.49 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 99.48 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 99.45 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 99.43 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 99.42 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.4 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 99.4 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 99.32 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.32 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.29 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.24 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 99.23 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.22 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 99.17 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 99.09 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.08 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.01 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.01 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 98.97 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 98.93 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 98.91 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 98.88 | |
| KOG0349 | 725 | consensus Putative DEAD-box RNA helicase DDX1 [RNA | 98.84 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 98.64 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 98.63 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 98.52 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 98.48 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 98.45 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 98.45 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 98.36 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 98.34 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.3 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.28 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 98.27 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 98.26 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 98.26 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 98.02 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 97.98 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 97.94 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 97.88 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 97.86 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 97.76 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 97.76 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 97.72 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 97.7 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 97.44 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.31 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 97.29 | |
| KOG0352 | 641 | consensus ATP-dependent DNA helicase [Replication, | 97.29 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 97.23 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 97.18 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.16 | |
| KOG0353 | 695 | consensus ATP-dependent DNA helicase [General func | 97.08 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 96.99 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 96.95 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 96.79 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 96.79 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 96.56 | |
| KOG0351 | 941 | consensus ATP-dependent DNA helicase [Replication, | 96.54 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 96.43 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 96.41 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.29 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 95.99 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 95.9 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 95.85 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.5 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 95.07 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 94.91 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 94.61 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 94.39 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 94.26 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 94.13 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 93.96 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 93.8 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 93.8 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 93.57 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 92.69 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 92.54 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 92.36 | |
| KOG1133 | 821 | consensus Helicase of the DEAD superfamily [Replic | 92.3 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 92.17 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 92.17 | |
| KOG1132 | 945 | consensus Helicase of the DEAD superfamily [Replic | 92.07 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 91.86 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 91.68 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 91.62 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 91.48 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 91.46 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 91.22 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 91.05 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 90.97 | |
| PRK13764 | 602 | ATPase; Provisional | 90.97 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 90.61 | |
| KOG0947 | 1248 | consensus Cytoplasmic exosomal RNA helicase SKI2, | 90.55 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 90.37 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 90.29 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 90.25 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 90.22 | |
| PRK08181 | 269 | transposase; Validated | 90.21 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 90.15 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 90.15 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 89.94 | |
| PRK13850 | 670 | type IV secretion system protein VirD4; Provisiona | 89.71 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 89.2 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 88.97 | |
| KOG0950 | 1008 | consensus DNA polymerase theta/eta, DEAD-box super | 88.93 | |
| PRK13897 | 606 | type IV secretion system component VirD4; Provisio | 88.87 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 88.63 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 88.25 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 87.94 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 87.93 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 87.81 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 87.71 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 87.65 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 87.6 | |
| PRK13880 | 636 | conjugal transfer coupling protein TraG; Provision | 87.53 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 87.43 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 87.26 | |
| PRK13876 | 663 | conjugal transfer coupling protein TraG; Provision | 86.76 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 86.68 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 86.58 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 85.77 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 85.62 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 85.49 | |
| TIGR02767 | 623 | TraG-Ti Ti-type conjugative transfer system protie | 85.15 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 84.95 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 84.81 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 84.47 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 84.38 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 84.32 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 84.32 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 84.12 | |
| TIGR02759 | 566 | TraD_Ftype type IV conjugative transfer system cou | 84.05 | |
| PRK13700 | 732 | conjugal transfer protein TraD; Provisional | 83.86 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 83.77 | |
| PRK06526 | 254 | transposase; Provisional | 83.71 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 82.51 | |
| PRK13822 | 641 | conjugal transfer coupling protein TraG; Provision | 82.42 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 81.79 | |
| PRK08116 | 268 | hypothetical protein; Validated | 81.62 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 81.42 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 81.28 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 81.0 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 80.38 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 80.32 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 80.26 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 80.12 |
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=99.85 E-value=1.6e-21 Score=182.48 Aligned_cols=198 Identities=36% Similarity=0.488 Sum_probs=137.1
Q ss_pred CCCcccccccccccccccchhhHHhhhhchhccccccccccc-cCCCCC--c-hhhhhhhhhhhhccccccCcccCcccc
Q 028267 1 MEKGASFLFAGVSFDKKKFVTDFARFKENKESENLADDFSFV-EGEKTD--P-EKAMVSFVKKRKRKSIAGETVEGFNVF 76 (211)
Q Consensus 1 ~~~~~~~l~~g~~f~~~~~~~d~~~~~~~k~~~~~~~~~~~~-~~~~~~--~-~~~~~~~~kkkk~k~~~~~~~e~~~~~ 76 (211)
|.+-+..||+|+.|.++.|......|.-..+........... ..+..+ . ........+.+.+.+......++....
T Consensus 1 ~~~~f~~it~g~~~~~~~~~k~~~~~~~~lk~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ed~~~~ 80 (593)
T KOG0344|consen 1 MCKRFRSITLGDSRKKESFPKKYAESSSILKTLTDNSKEPLPMHGEWFDPDNLAEPLKSEEKEKLQNSDSSSPLEDIDRR 80 (593)
T ss_pred CCCcccceecccccccccCCCcchhhhhhccCCccccccccccccccccccccccchhhccchhhhcccchhhhhhhhhc
Confidence 667889999999999999998888887776555543322211 111111 1 111112223344444444444554444
Q ss_pred cCcccCCcccccccccccCCCchhHHHhhhhHHHHHHHHhhcCceeccCCCCCCchhhhhhcccCCCCHHHHHHHHHcCC
Q 028267 77 KSSKQLVPAVDKEKEKVEDGPSKAKKELNKQIERDAVFRKKYNIHVSGANVPSPLRTFVKLSSRFGCESYLLRNLAELGY 156 (211)
Q Consensus 77 ~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~i~v~g~~~p~p~~~f~~l~~~~~l~~~ll~~l~~~g~ 156 (211)
..++..+....++ ..+.... ..+... ..+.....|..+.+++.|.++|.|+.+|.++..+|.+++.|+++|...||
T Consensus 81 ~~~k~~~~~~e~~--~~~~~~~-~~k~~~-~~~~~~~~Rk~~k~~v~G~~~~~~l~~f~~lt~~~~~~~~ll~nl~~~~F 156 (593)
T KOG0344|consen 81 GSSKKTKPKMEEK--LSEDVIA-AKKKLQ-TSEKLLGIRKSNKINVDGFHLPPPLLSFSDLTYDYSMNKRLLENLQELGF 156 (593)
T ss_pred ccccccCchhhhh--ccccHHH-HHHHHh-hhcccccchhcceeeccCCCCCCccccccccchhhhhcHHHHHhHhhCCC
Confidence 4443222211111 1111111 111111 13555678899999999999999999999999999999999999999999
Q ss_pred CCCcHHHHHHHhhHhcCCcEEEEcCCCchhHHHhHHHHHHHHhccc
Q 028267 157 KEPTPIQRQAIPVLLSDRECFACAPTGSGKTLAFLCPMLMKLRVLF 202 (211)
Q Consensus 157 ~~pt~iQ~~aip~il~G~dvi~~A~TGsGKTlaf~lPil~~l~~~~ 202 (211)
..|+|||.+|||.++.++|+++||||||||||||++|+|++|....
T Consensus 157 ~~Pt~iq~~aipvfl~~r~~lAcapTGsgKtlaf~~Pil~~L~~~~ 202 (593)
T KOG0344|consen 157 DEPTPIQKQAIPVFLEKRDVLACAPTGSGKTLAFNLPILQHLKDLS 202 (593)
T ss_pred CCCCcccchhhhhhhcccceEEeccCCCcchhhhhhHHHHHHHHhh
Confidence 9999999999999999999999999999999999999999998776
|
|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK13850 type IV secretion system protein VirD4; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13897 type IV secretion system component VirD4; Provisional | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK13880 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK13876 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD | Back alignment and domain information |
|---|
| >PRK13700 conjugal transfer protein TraD; Provisional | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK13822 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 211 | ||||
| 3dkp_A | 245 | Human Dead-Box Rna-Helicase Ddx52, Conserved Domain | 1e-22 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 5e-15 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 6e-10 | ||
| 1wrb_A | 253 | Crystal Structure Of The N-Terminal Reca-Like Domai | 1e-09 | ||
| 1vec_A | 206 | Crystal Structure Of The N-Terminal Domain Of RckP5 | 3e-08 | ||
| 4a4d_A | 253 | Crystal Structure Of The N-Terminal Domain Of The H | 1e-07 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 1e-07 | ||
| 3fe2_A | 242 | Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D | 1e-07 | ||
| 3iuy_A | 228 | Crystal Structure Of Ddx53 Dead-Box Domain Length = | 6e-07 | ||
| 3ly5_A | 262 | Ddx18 Dead-Domain Length = 262 | 7e-07 | ||
| 2pl3_A | 236 | Human Dead-Box Rna Helicase Ddx10, Dead Domain In C | 7e-07 | ||
| 3ber_A | 249 | Human Dead-Box Rna-Helicase Ddx47, Conserved Domain | 1e-06 | ||
| 2gxq_A | 207 | Hera N-Terminal Domain In Complex With Amp, Crystal | 4e-05 | ||
| 2z0m_A | 337 | Crystal Structure Of Hypothetical Atp-Dependent Rna | 8e-05 | ||
| 3mwj_A | 207 | Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap | 1e-04 | ||
| 3bor_A | 237 | Crystal Structure Of The Deadc Domain Of Human Tran | 2e-04 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 2e-04 | ||
| 1oyw_A | 523 | Structure Of The Recq Catalytic Core Length = 523 | 3e-04 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 3e-04 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 3e-04 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 4e-04 | ||
| 1oyy_A | 523 | Structure Of The Recq Catalytic Core Bound To Atp-G | 4e-04 | ||
| 3fmo_B | 300 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 4e-04 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 6e-04 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 6e-04 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 6e-04 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 6e-04 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 7e-04 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 7e-04 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 7e-04 |
| >pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 | Back alignment and structure |
|
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 | Back alignment and structure |
| >pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 | Back alignment and structure |
| >pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 | Back alignment and structure |
| >pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 | Back alignment and structure |
| >pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 | Back alignment and structure |
| >pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 | Back alignment and structure |
| >pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 | Back alignment and structure |
| >pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 | Back alignment and structure |
| >pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 | Back alignment and structure |
| >pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 | Back alignment and structure |
| >pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 | Back alignment and structure |
| >pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 7e-45 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 4e-31 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 2e-28 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 3e-27 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 7e-27 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 1e-25 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 8e-21 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 4e-20 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 5e-20 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 6e-20 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 8e-19 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 8e-19 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 1e-17 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 2e-17 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 2e-16 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 9e-16 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 2e-15 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 2e-15 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 3e-15 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 2e-14 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 4e-14 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 6e-14 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 6e-14 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 9e-14 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 1e-13 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 2e-13 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 2e-12 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 3e-12 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 5e-12 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 6e-11 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 6e-08 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 7e-07 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 3e-06 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 1e-04 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 2e-04 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 6e-04 |
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
Score = 148 bits (376), Expect = 7e-45
Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
Query: 105 NKQIERDAVFRKKYNIHVSGANVPSPLRTFVKLSSRFGCESYLLRNLAELGYKEPTPIQR 164
+ +I R K+ IHV G ++P P+ TF +L + S LL+N+ + G++ PTPIQ
Sbjct: 1 SMKINF---LRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQM 57
Query: 165 QAIPVLLSDRECFACAPTGSGKTLAFLCPMLMKLR 199
QAIPV+L RE A APTGSGKTLAF P+LM+L+
Sbjct: 58 QAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLK 92
|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.8 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.8 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.77 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.74 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.69 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.66 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.66 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.66 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.65 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.64 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.64 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.62 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.61 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.61 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.6 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.59 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.58 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.56 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.55 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.53 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.5 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.5 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.49 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.48 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.47 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.47 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.46 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.41 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.28 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.2 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.17 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.16 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.15 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.14 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.12 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.11 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.01 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 98.98 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.88 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 98.88 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 98.83 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.8 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 98.79 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 98.74 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 98.71 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 98.7 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 98.68 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.62 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 98.61 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 98.61 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 98.6 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 98.57 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 98.56 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 98.56 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 98.54 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 98.42 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 98.38 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 98.36 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 98.31 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 98.3 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.28 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 98.25 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 98.24 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 98.17 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 98.17 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 97.91 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 97.78 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 97.74 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 97.67 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 97.45 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 97.37 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 96.99 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 96.9 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 96.25 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 96.17 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 95.2 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 95.01 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 94.73 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 94.22 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 94.01 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 93.94 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 93.6 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 93.51 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 93.26 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 92.78 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 91.27 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 90.19 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 88.9 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 88.4 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 88.24 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 88.01 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 87.54 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 86.53 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 85.74 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 85.26 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 84.31 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 84.2 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 83.78 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 83.46 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 83.07 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 82.64 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 82.5 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 82.13 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 81.41 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 81.41 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 81.17 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 81.15 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 81.07 |
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.80 E-value=5e-20 Score=160.63 Aligned_cols=110 Identities=24% Similarity=0.417 Sum_probs=81.7
Q ss_pred hHHHhhhhHHHHHHHHhhcCceeccCCCCCCchhhhhhcccCCCCHHHHHHHHHcCCCCCcHHHHHHHhhHhcC--CcEE
Q 028267 100 AKKELNKQIERDAVFRKKYNIHVSGANVPSPLRTFVKLSSRFGCESYLLRNLAELGYKEPTPIQRQAIPVLLSD--RECF 177 (211)
Q Consensus 100 ~~k~~~~~~~~~~~~~~~~~i~v~g~~~p~p~~~f~~l~~~~~l~~~ll~~l~~~g~~~pt~iQ~~aip~il~G--~dvi 177 (211)
...+......+....+..+.+.+.+.+.+.|+.++..+ +.++|++.++++|..+||..||+||.++||.++.| +|+|
T Consensus 57 ~~~~~~~~~~~~~~~~~~~~v~v~~~~~~~p~~~~~~f-~~l~l~~~l~~~l~~~g~~~pt~iQ~~ai~~il~~~~~~~l 135 (300)
T 3fmo_B 57 AAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSF-EELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLI 135 (300)
T ss_dssp ------------CCCCCCSCEEEECSSTTCCCCCCCCS-GGGTCCHHHHHHHHHTTCCSCCHHHHHHHHHHTSSSCCCEE
T ss_pred hHHHHHHhhhhcccccccccceeccCCCCCCcCCcCCH-hhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHHcCCCCeEE
Confidence 33444444555555666788899999888876543322 34499999999999999999999999999999998 9999
Q ss_pred EEcCCCchhHHHhHHHHHHHHhcccCCCceEEe
Q 028267 178 ACAPTGSGKTLAFLCPMLMKLRVLFIPFDYFCE 210 (211)
Q Consensus 178 ~~A~TGsGKTlaf~lPil~~l~~~~~~~~~~~~ 210 (211)
++|+||||||++|++|+++++........++++
T Consensus 136 ~~a~TGsGKT~a~~lp~l~~l~~~~~~~~~lil 168 (300)
T 3fmo_B 136 AQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCL 168 (300)
T ss_dssp EECCTTSSHHHHHHHHHHHHCCTTSCSCCEEEE
T ss_pred EECCCCCCccHHHHHHHHHhhhccCCCceEEEE
Confidence 999999999999999999999776544444443
|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 211 | ||||
| d1wrba1 | 238 | c.37.1.19 (A:164-401) putative ATP-dependent RNA h | 1e-17 | |
| d2g9na1 | 218 | c.37.1.19 (A:21-238) Initiation factor 4a {Human ( | 1e-16 | |
| d2j0sa1 | 222 | c.37.1.19 (A:22-243) Probable ATP-dependent RNA he | 2e-15 | |
| d2p6ra3 | 202 | c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus | 2e-15 | |
| d1veca_ | 206 | c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma | 2e-14 | |
| d1qdea_ | 212 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 2e-14 | |
| d1q0ua_ | 209 | c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR | 7e-14 | |
| d1s2ma1 | 206 | c.37.1.19 (A:46-251) Putative ATP-dependent RNA he | 7e-14 | |
| d1t6na_ | 207 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 8e-14 | |
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 4e-13 | |
| d1oywa2 | 206 | c.37.1.19 (A:1-206) RecQ helicase domain {Escheric | 1e-12 | |
| d1hv8a1 | 208 | c.37.1.19 (A:3-210) Putative DEAD box RNA helicase | 6e-10 | |
| d1wp9a1 | 200 | c.37.1.19 (A:1-200) putative ATP-dependent RNA hel | 1e-07 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 3e-04 |
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: putative ATP-dependent RNA helicase VlgB species: Flatworm (Dugesia japonica) [TaxId: 6161]
Score = 76.5 bits (187), Expect = 1e-17
Identities = 31/87 (35%), Positives = 46/87 (52%), Gaps = 9/87 (10%)
Query: 117 KYN---IHVSG--ANVPSPLRTFVKLSSRFGCESYLLRNLAELGYKEPTPIQRQAIPVLL 171
KY+ + V+G + + + F + + N+ Y+ PTPIQ+ AIP +L
Sbjct: 1 KYDSIPVSVTGPDYSATNVIENF----DELKLDPTIRNNILLASYQRPTPIQKNAIPAIL 56
Query: 172 SDRECFACAPTGSGKTLAFLCPMLMKL 198
R+ ACA TGSGKT AFL P++ L
Sbjct: 57 EHRDIMACAQTGSGKTAAFLIPIINHL 83
|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.84 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.83 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.83 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.82 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.81 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.81 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.79 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.78 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.7 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.41 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.36 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.27 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 98.38 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 97.45 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.96 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 96.84 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 96.1 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 94.63 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 94.25 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 93.41 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 92.09 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 91.79 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.22 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 90.99 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 90.65 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 90.28 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 90.21 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 88.7 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 88.07 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 86.19 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 85.12 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 85.0 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 84.78 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 84.73 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 82.76 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 82.15 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 81.58 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 80.7 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 80.52 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 80.45 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 80.38 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 80.33 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 80.18 |
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Initiation factor 4a species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.84 E-value=1.7e-21 Score=160.88 Aligned_cols=82 Identities=24% Similarity=0.373 Sum_probs=75.1
Q ss_pred cCCCCCCchhhhhhcccCCCCHHHHHHHHHcCCCCCcHHHHHHHhhHhcCCcEEEEcCCCchhHHHhHHHHHHHHhcccC
Q 028267 124 GANVPSPLRTFVKLSSRFGCESYLLRNLAELGYKEPTPIQRQAIPVLLSDRECFACAPTGSGKTLAFLCPMLMKLRVLFI 203 (211)
Q Consensus 124 g~~~p~p~~~f~~l~~~~~l~~~ll~~l~~~g~~~pt~iQ~~aip~il~G~dvi~~A~TGsGKTlaf~lPil~~l~~~~~ 203 (211)
|.+.|.++.+|+++ +|++.++++|.++||.+|||||++|||.++.|+|++++|+||||||+||++|+++++.....
T Consensus 2 ~~~~~~~~~sF~~l----~l~~~l~~~L~~~g~~~pt~iQ~~aip~il~g~dvl~~a~TGsGKT~a~~lp~i~~l~~~~~ 77 (212)
T d1qdea_ 2 QTNYDKVVYKFDDM----ELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVK 77 (212)
T ss_dssp CBSCCCCCCCGGGG----TCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHCCTTCC
T ss_pred CCCCcccccChhhC----CCCHHHHHHHHHCCCCCCCHHHHHHHHHHHcCCCEEeecccccchhhhhHhhhHhhhhccCC
Confidence 67889999999999 99999999999999999999999999999999999999999999999999999999976655
Q ss_pred CCceEE
Q 028267 204 PFDYFC 209 (211)
Q Consensus 204 ~~~~~~ 209 (211)
...++.
T Consensus 78 ~~~~li 83 (212)
T d1qdea_ 78 APQALM 83 (212)
T ss_dssp SCCEEE
T ss_pred CcceEE
Confidence 444433
|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|