Citrus Sinensis ID: 028491
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 208 | ||||||
| 255538678 | 205 | conserved hypothetical protein [Ricinus | 0.985 | 1.0 | 0.711 | 4e-80 | |
| 224085680 | 201 | predicted protein [Populus trichocarpa] | 0.966 | 1.0 | 0.706 | 5e-80 | |
| 224062121 | 209 | predicted protein [Populus trichocarpa] | 0.966 | 0.961 | 0.707 | 9e-76 | |
| 225458255 | 207 | PREDICTED: CBS domain-containing protein | 0.990 | 0.995 | 0.674 | 4e-75 | |
| 356518816 | 205 | PREDICTED: CBS domain-containing protein | 0.985 | 1.0 | 0.644 | 3e-69 | |
| 356509678 | 205 | PREDICTED: CBS domain-containing protein | 0.985 | 1.0 | 0.634 | 9e-69 | |
| 297846924 | 192 | hypothetical protein ARALYDRAFT_314186 [ | 0.826 | 0.895 | 0.664 | 3e-64 | |
| 186489216 | 193 | Cystathionine beta-synthase (CBS) family | 0.831 | 0.896 | 0.649 | 1e-63 | |
| 449469967 | 206 | PREDICTED: CBS domain-containing protein | 0.985 | 0.995 | 0.564 | 2e-55 | |
| 257209020 | 205 | Arabidopsis protein targeted to mitochon | 0.980 | 0.995 | 0.533 | 2e-54 |
| >gi|255538678|ref|XP_002510404.1| conserved hypothetical protein [Ricinus communis] gi|223551105|gb|EEF52591.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 303 bits (775), Expect = 4e-80, Method: Compositional matrix adjust.
Identities = 148/208 (71%), Positives = 175/208 (84%), Gaps = 3/208 (1%)
Query: 1 MQGMIKGVRTCQEILKGAILEHHQGRYVVEGRKTCSRFGCVISSSSSPTEEKGLENISVA 60
MQG+I+GVR+C+EILK H G+ + E + SRFGCV SS S P +KGLEN++VA
Sbjct: 1 MQGLIRGVRSCKEILKIGTQRHSHGKEIFERKNIFSRFGCVTSSPSLP--QKGLENLTVA 58
Query: 61 EVLMTKGDDKVGSWLCCRSDDTVEDAVKNMAQHNIGSLVVLKPGEQQHIAGIFTERDYLR 120
+VLMTKGD+K GSWL C S+DTV DAVKNMA++NIGSL+VLKPGE+ H+AGI TERDYLR
Sbjct: 59 DVLMTKGDEKTGSWLWCHSNDTVYDAVKNMAENNIGSLLVLKPGEK-HLAGIITERDYLR 117
Query: 121 KIVGQGRSPKYTRVAEIMTDENKLITLPSDANILHAMQLMTDKHIRHVPVIDGRIVGMIS 180
K++ +GRS YTRVAEIMTDEN+L+T+ SD IL AMQLMTD HIRHVPVIDGRIVGMIS
Sbjct: 118 KVIAEGRSCHYTRVAEIMTDENRLVTVTSDTTILRAMQLMTDHHIRHVPVIDGRIVGMIS 177
Query: 181 IVDVVRAVVEQQKGELKRLNEFIRGEYY 208
+VDVVRAVVEQQ GELK+LN+FIRGEYY
Sbjct: 178 MVDVVRAVVEQQSGELKQLNDFIRGEYY 205
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224085680|ref|XP_002307661.1| predicted protein [Populus trichocarpa] gi|222857110|gb|EEE94657.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224062121|ref|XP_002300765.1| predicted protein [Populus trichocarpa] gi|222842491|gb|EEE80038.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225458255|ref|XP_002281327.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356518816|ref|XP_003528073.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356509678|ref|XP_003523573.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297846924|ref|XP_002891343.1| hypothetical protein ARALYDRAFT_314186 [Arabidopsis lyrata subsp. lyrata] gi|297337185|gb|EFH67602.1| hypothetical protein ARALYDRAFT_314186 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|186489216|ref|NP_001117443.1| Cystathionine beta-synthase (CBS) family protein [Arabidopsis thaliana] gi|332194027|gb|AEE32148.1| Cystathionine beta-synthase (CBS) family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449469967|ref|XP_004152690.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Cucumis sativus] gi|449520034|ref|XP_004167039.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|257209020|emb|CBB36496.1| Arabidopsis protein targeted to mitochondria proteins At5g10860 [Saccharum hybrid cultivar R570] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 208 | ||||||
| TAIR|locus:4515102654 | 193 | AT1G47271 "AT1G47271" [Arabido | 0.846 | 0.911 | 0.638 | 8.1e-60 | |
| TAIR|locus:2183740 | 206 | CBSX3 "AT5G10860" [Arabidopsis | 0.975 | 0.985 | 0.528 | 9.2e-52 | |
| UNIPROTKB|Q48IU0 | 146 | PSPPH_2494 "CBS domain protein | 0.586 | 0.835 | 0.429 | 1.6e-22 | |
| UNIPROTKB|Q0BYV1 | 144 | HNE_2660 "CBS domain protein" | 0.649 | 0.937 | 0.323 | 1.4e-16 | |
| UNIPROTKB|Q5LRC8 | 144 | SPO2201 "CBS domain protein" [ | 0.673 | 0.972 | 0.324 | 1.2e-12 | |
| TIGR_CMR|SPO_2201 | 144 | SPO_2201 "CBS domain protein" | 0.673 | 0.972 | 0.324 | 1.2e-12 | |
| UNIPROTKB|Q5LSF9 | 607 | SPO1809 "Nucleotidyltransferas | 0.490 | 0.168 | 0.380 | 3e-12 | |
| TIGR_CMR|SPO_1809 | 607 | SPO_1809 "nucleotidyltransfera | 0.490 | 0.168 | 0.380 | 3e-12 | |
| UNIPROTKB|Q60B97 | 150 | MCA0583 "CBS domain protein" [ | 0.562 | 0.78 | 0.333 | 8.2e-12 | |
| UNIPROTKB|O06186 | 143 | hrp1 "Hypoxic response protein | 0.591 | 0.860 | 0.271 | 5.2e-10 |
| TAIR|locus:4515102654 AT1G47271 "AT1G47271" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 613 (220.8 bits), Expect = 8.1e-60, P = 8.1e-60
Identities = 115/180 (63%), Positives = 150/180 (83%)
Query: 29 VEGRKTCSRFGCVISSSSSPTEEKGLENISVAEVLMTKGDDKVGSWLCCRSDDTVEDAVK 88
+ RK + FGC+ +S P EKGLEN++VA+VL TK D + +W+ CR++DTV DAVK
Sbjct: 18 IHQRKVSAGFGCL---TSPPPPEKGLENLTVADVLSTKDTD-IDTWISCRTNDTVSDAVK 73
Query: 89 NMAQHNIGSLVVLKPGEQQHIAGIFTERDYLRKIVGQGRSPKYTRVAEIMTDENKLITLP 148
NMA+HNIGSLVVL+PG+QQ+IAGI TERDY++KI+G GRS K T+V E+MTDE+KL+T+
Sbjct: 74 NMAKHNIGSLVVLEPGDQQYIAGIVTERDYMKKIIGAGRSSKLTKVGEVMTDESKLVTVS 133
Query: 149 SDANILHAMQLMTDKHIRHVPVIDGRIVGMISIVDVVRAVVEQQKGELKRLNEFIRGEYY 208
S NI+ AMQLM++ HIRHVPVIDG+IVG+IS+VDVV+A+V+ Q GELKRLNEFI+G+YY
Sbjct: 134 SGTNIIKAMQLMSENHIRHVPVIDGKIVGLISMVDVVKAIVDHQNGELKRLNEFIKGDYY 193
|
|
| TAIR|locus:2183740 CBSX3 "AT5G10860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q48IU0 PSPPH_2494 "CBS domain protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0BYV1 HNE_2660 "CBS domain protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5LRC8 SPO2201 "CBS domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2201 SPO_2201 "CBS domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5LSF9 SPO1809 "Nucleotidyltransferase/CBS/cyclic nucleotide-binding domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1809 SPO_1809 "nucleotidyltransferase/CBS/cyclic nucleotide-binding domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60B97 MCA0583 "CBS domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O06186 hrp1 "Hypoxic response protein 1" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 208 | |||
| cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after | 1e-41 | |
| cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c | 5e-31 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 2e-25 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 4e-23 | |
| cd04587 | 113 | cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd | 6e-23 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 1e-21 | |
| cd04624 | 112 | cd04624, CBS_pair_11, The CBS domain, named after | 1e-21 | |
| cd04630 | 114 | cd04630, CBS_pair_17, The CBS domain, named after | 2e-21 | |
| cd04625 | 112 | cd04625, CBS_pair_12, The CBS domain, named after | 4e-21 | |
| cd04802 | 112 | cd04802, CBS_pair_3, The CBS domain, named after h | 2e-18 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 2e-17 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 3e-16 | |
| cd04586 | 135 | cd04586, CBS_pair_BON_assoc, This cd contains two | 1e-14 | |
| cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after | 2e-13 | |
| cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two | 2e-13 | |
| cd04595 | 110 | cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con | 6e-13 | |
| cd04604 | 114 | cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain | 9e-13 | |
| cd04620 | 115 | cd04620, CBS_pair_7, The CBS domain, named after h | 2e-12 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 7e-12 | |
| cd04601 | 110 | cd04601, CBS_pair_IMPDH, This cd contains two tand | 1e-11 | |
| cd04589 | 111 | cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd | 1e-11 | |
| COG3448 | 382 | COG3448, COG3448, CBS-domain-containing membrane p | 1e-11 | |
| cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two | 1e-11 | |
| PRK05567 | 486 | PRK05567, PRK05567, inosine 5'-monophosphate dehyd | 2e-11 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 2e-11 | |
| cd04599 | 105 | cd04599, CBS_pair_GGDEF_assoc2, This cd contains t | 4e-11 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 7e-11 | |
| cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after | 8e-11 | |
| cd04629 | 114 | cd04629, CBS_pair_16, The CBS domain, named after | 1e-10 | |
| cd04634 | 143 | cd04634, CBS_pair_21, The CBS domain, named after | 1e-10 | |
| cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after | 4e-10 | |
| cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two | 7e-10 | |
| cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two | 1e-09 | |
| cd04621 | 135 | cd04621, CBS_pair_8, The CBS domain, named after h | 2e-09 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 5e-09 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 9e-09 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 1e-08 | |
| cd04609 | 110 | cd04609, CBS_pair_PALP_assoc2, This cd contains tw | 2e-08 | |
| cd04636 | 132 | cd04636, CBS_pair_23, The CBS domain, named after | 2e-08 | |
| TIGR01302 | 450 | TIGR01302, IMP_dehydrog, inosine-5'-monophosphate | 4e-08 | |
| PRK10892 | 326 | PRK10892, PRK10892, D-arabinose 5-phosphate isomer | 4e-08 | |
| cd04617 | 118 | cd04617, CBS_pair_4, The CBS domain, named after h | 1e-07 | |
| cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two | 2e-07 | |
| cd04642 | 126 | cd04642, CBS_pair_29, The CBS domain, named after | 4e-07 | |
| cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c | 5e-07 | |
| cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after | 1e-06 | |
| PRK07807 | 479 | PRK07807, PRK07807, inosine 5-monophosphate dehydr | 1e-06 | |
| cd04613 | 114 | cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con | 1e-06 | |
| TIGR00393 | 268 | TIGR00393, kpsF, KpsF/GutQ family protein | 2e-06 | |
| PRK11543 | 321 | PRK11543, gutQ, D-arabinose 5-phosphate isomerase; | 2e-06 | |
| cd04606 | 109 | cd04606, CBS_pair_Mg_transporter, This cd contains | 2e-06 | |
| PRK14869 | 546 | PRK14869, PRK14869, putative manganese-dependent i | 3e-06 | |
| cd04626 | 111 | cd04626, CBS_pair_13, The CBS domain, named after | 3e-06 | |
| cd04583 | 109 | cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai | 3e-06 | |
| cd04586 | 135 | cd04586, CBS_pair_BON_assoc, This cd contains two | 5e-06 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 5e-06 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 6e-06 | |
| cd04615 | 113 | cd04615, CBS_pair_2, The CBS domain, named after h | 7e-06 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 9e-06 | |
| cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd c | 9e-06 | |
| cd04642 | 126 | cd04642, CBS_pair_29, The CBS domain, named after | 1e-05 | |
| cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two | 1e-05 | |
| COG2524 | 294 | COG2524, COG2524, Predicted transcriptional regula | 1e-05 | |
| cd04593 | 115 | cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con | 2e-05 | |
| cd04635 | 122 | cd04635, CBS_pair_22, The CBS domain, named after | 3e-05 | |
| COG3620 | 187 | COG3620, COG3620, Predicted transcriptional regula | 4e-05 | |
| cd04609 | 110 | cd04609, CBS_pair_PALP_assoc2, This cd contains tw | 5e-05 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 5e-05 | |
| cd04632 | 128 | cd04632, CBS_pair_19, The CBS domain, named after | 5e-05 | |
| cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after | 6e-05 | |
| cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two | 7e-05 | |
| cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c | 1e-04 | |
| cd04610 | 107 | cd04610, CBS_pair_ParBc_assoc, This cd contains tw | 1e-04 | |
| cd04597 | 113 | cd04597, CBS_pair_DRTGG_assoc2, This cd contains t | 1e-04 | |
| cd04639 | 111 | cd04639, CBS_pair_26, The CBS domain, named after | 1e-04 | |
| cd04619 | 114 | cd04619, CBS_pair_6, The CBS domain, named after h | 1e-04 | |
| pfam00478 | 467 | pfam00478, IMPDH, IMP dehydrogenase / GMP reductas | 1e-04 | |
| cd04627 | 123 | cd04627, CBS_pair_14, The CBS domain, named after | 1e-04 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 2e-04 | |
| cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two | 2e-04 | |
| cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain | 3e-04 | |
| cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after | 5e-04 | |
| cd04801 | 114 | cd04801, CBS_pair_M50_like, This cd contains two t | 6e-04 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 8e-04 | |
| COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins con | 8e-04 | |
| PTZ00314 | 495 | PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd | 9e-04 | |
| COG3448 | 382 | COG3448, COG3448, CBS-domain-containing membrane p | 0.001 | |
| cd04593 | 115 | cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con | 0.001 | |
| PRK07107 | 502 | PRK07107, PRK07107, inosine 5-monophosphate dehydr | 0.001 | |
| cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two | 0.002 | |
| cd04595 | 110 | cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con | 0.002 | |
| cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after | 0.002 | |
| COG2524 | 294 | COG2524, COG2524, Predicted transcriptional regula | 0.002 | |
| COG3620 | 187 | COG3620, COG3620, Predicted transcriptional regula | 0.002 | |
| cd04627 | 123 | cd04627, CBS_pair_14, The CBS domain, named after | 0.002 | |
| COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins con | 0.002 | |
| cd04582 | 106 | cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contain | 0.003 |
| >gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
Score = 136 bits (345), Expect = 1e-41
Identities = 52/112 (46%), Positives = 75/112 (66%), Gaps = 5/112 (4%)
Query: 77 CRSDDTVEDAVKNMAQHNIGSLVVLKPGEQQHIAGIFTERDYLRKIVGQGRSPKYTRVAE 136
R D TV +A K MA+ NIG++VV+ G + GIF+ERD +RK+ +G S T V+E
Sbjct: 6 VRPDATVAEAAKLMAEKNIGAVVVVDDGG--RLVGIFSERDIVRKVALRGASALDTPVSE 63
Query: 137 IMTDENKLITLPSDANILHAMQLMTDKHIRHVPVID-GRIVGMISIVDVVRA 187
IMT +IT+ D + AM LMT++ RH+PV+D G++VG++SI DVV+A
Sbjct: 64 IMTR--NVITVTPDDTVDEAMALMTERRFRHLPVVDGGKLVGIVSIGDVVKA 113
|
CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 113 |
| >gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240001 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239997 cd04625, CBS_pair_12, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >gnl|CDD|239992 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >gnl|CDD|239962 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239993 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239982 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|182814 PRK10892, PRK10892, D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239989 cd04617, CBS_pair_4, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >gnl|CDD|183186 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239979 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239998 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >gnl|CDD|240006 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|226147 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239982 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|239983 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|239970 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|240010 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239991 cd04619, CBS_pair_6, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain | Back alignment and domain information |
|---|
| >gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240114 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >gnl|CDD|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|226147 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239955 cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 208 | |||
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.85 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.84 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.81 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.78 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.78 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.76 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.76 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.74 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.74 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.73 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.73 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.71 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.71 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.7 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.7 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.7 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.7 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.69 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.69 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.69 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.69 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.69 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.69 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.69 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.69 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.68 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.68 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.68 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.68 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.68 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.68 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.67 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.67 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.67 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.67 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.67 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.67 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.67 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.67 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.67 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.67 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.66 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.66 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.66 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.66 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.66 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.65 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.65 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.65 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.65 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.64 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.64 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.64 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.64 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.64 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.64 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.64 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.64 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.63 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.63 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.63 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.62 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.62 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.62 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.62 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.61 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.61 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.6 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.6 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.6 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.59 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.59 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.59 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.59 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.59 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.58 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.58 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.57 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.57 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.57 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.56 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.56 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.55 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.54 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.53 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.51 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.51 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 99.49 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.43 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 99.38 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 99.26 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 99.24 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 99.23 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 99.18 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.02 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.01 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 98.96 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.87 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 98.8 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 98.69 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 98.67 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.64 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 98.61 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 98.59 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.56 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 98.49 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 98.47 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.47 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 98.43 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 98.4 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 98.35 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 98.35 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 98.32 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 98.31 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 98.3 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 98.3 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 98.3 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 98.3 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 98.29 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.29 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 98.28 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 98.28 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 98.27 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 98.27 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.26 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 98.26 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 98.25 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 98.25 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 98.25 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 98.25 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 98.23 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 98.23 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 98.22 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 98.22 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 98.21 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 98.21 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 98.21 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 98.21 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 98.2 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 98.19 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 98.18 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 98.18 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 98.17 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 98.17 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 98.17 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 98.16 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 98.16 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 98.16 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 98.15 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 98.15 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 98.15 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 98.14 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 98.14 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 98.14 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 98.14 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 98.13 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 98.13 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 98.13 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 98.13 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 98.13 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 98.13 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 98.12 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 98.12 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 98.12 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 98.11 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 98.11 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 98.11 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 98.11 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 98.1 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 98.1 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 98.08 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 98.08 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 98.06 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 98.06 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 98.04 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 98.04 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 98.02 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 98.0 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 97.99 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 97.99 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 97.97 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 97.95 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 97.95 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 97.94 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 97.89 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 97.88 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 97.88 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 97.87 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 97.81 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 97.81 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 97.81 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 97.75 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 97.72 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 97.7 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 97.6 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 97.39 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 97.37 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 97.22 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 97.07 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 96.5 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 96.33 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 96.3 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 95.61 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 95.24 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 94.74 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 92.85 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 92.23 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 91.71 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 90.81 |
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.85 E-value=8.1e-22 Score=167.70 Aligned_cols=166 Identities=22% Similarity=0.360 Sum_probs=146.6
Q ss_pred hhhHHHHHHhhhcCcccccccccccccccccCCCC---CccccCcccccHHHhhcccCCCCCCCeEEecCCchHHHHHHH
Q 028491 13 EILKGAILEHHQGRYVVEGRKTCSRFGCVISSSSS---PTEEKGLENISVAEVLMTKGDDKVGSWLCCRSDDTVEDAVKN 89 (208)
Q Consensus 13 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~v~~~m~~~~~~~~~~~~~v~~~~tl~~a~~~ 89 (208)
..+|++.|..|+..++.|+.||...++.+.++... ..-.+.+-...+++++..+ +++|++.+|+.+|++.
T Consensus 102 y~lp~s~F~ql~~~n~~f~~ff~~~~akR~~~~~~~~~eq~~~e~~~trv~~~~~~~-------~~~v~~~~~i~~aa~k 174 (610)
T COG2905 102 YLLPKSVFMQLMEENPEFADFFLRSLAKRLRDIADRLAEQGESEFILTRVGEVKTLP-------AVTVSPQASIQDAARK 174 (610)
T ss_pred EecCHHHHHHHHHhCcHHHHHHHHHHHHHHHHHHHHHHhhccchHHHHHHHHHhcCC-------CcccCccCcHHHHHHH
Confidence 36899999999999999999999888777652211 1111334456889999988 9999999999999999
Q ss_pred HHhcCCcEEEEEecCCCceEEEeechHHHHHHHHhcCCCCCccchhhhhccCCCeEEEcCCCCHHHHHHHHHhcCCCEee
Q 028491 90 MAQHNIGSLVVLKPGEQQHIAGIFTERDYLRKIVGQGRSPKYTRVAEIMTDENKLITLPSDANILHAMQLMTDKHIRHVP 169 (208)
Q Consensus 90 m~~~~~~~~pVv~~d~~~~~iG~vt~~dl~~~~~~~~~~~~~~~v~~im~~~~~~~~v~~~~~l~~a~~~~~~~~~~~lp 169 (208)
|.+.|++.+.++ +.++...||||.+|++.++++++.+ ...+|+++|+. |+++++.++.+.+|+-.|.+.+++++|
T Consensus 175 m~~~gv~s~v~l--~~~~~~~GIvT~~dl~~~v~~~g~~-~~~~V~evmT~--p~~svd~~~~~feAml~m~r~~I~hl~ 249 (610)
T COG2905 175 MKDEGVSSLVVL--DDSGPLLGIVTRKDLRSRVIADGRS-KTQKVSEVMTS--PVISVDRGDFLFEAMLMMLRNRIKHLP 249 (610)
T ss_pred HHhcCCCeEEEE--cCCCCccceeehHHHHHHHHhcCCC-cccchhhhhcc--CceeecCcchHHHHHHHHHHhCCceee
Confidence 999999999999 7889999999999999999998865 58899999999 999999999999999999999999999
Q ss_pred eecCc-eeEEEEHHHHHHHHHH
Q 028491 170 VIDGR-IVGMISIVDVVRAVVE 190 (208)
Q Consensus 170 Vvd~~-~vGiit~~dll~~~~~ 190 (208)
|++++ ++|+||.+||++....
T Consensus 250 V~e~gq~~Gilt~~dIl~l~s~ 271 (610)
T COG2905 250 VTEDGQPLGILTLTDILRLFSQ 271 (610)
T ss_pred eecCCeeeEEeeHHHHHHhhCC
Confidence 99999 9999999999999874
|
|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 208 | ||||
| 4fry_A | 157 | The Structure Of A Putative Signal-Transduction Pro | 3e-22 | ||
| 2rc3_A | 135 | Crystal Structure Of Cbs Domain, Ne2398 Length = 13 | 1e-13 | ||
| 3fhm_A | 165 | Crystal Structure Of The Cbs-Domain Containing Prot | 3e-11 | ||
| 2ef7_A | 133 | Crystal Structure Of St2348, A Hypothetical Protein | 9e-10 | ||
| 1xkf_A | 133 | Crystal Structure Of Hypoxic Response Protein I (Hr | 9e-08 | ||
| 2cu0_A | 486 | Crystal Structure Of Inosine-5'-Monophosphate Dehyd | 2e-07 | ||
| 1vrd_A | 494 | Crystal Structure Of Inosine-5'-Monophosphate Dehyd | 5e-07 | ||
| 3ghd_A | 70 | Crystal Structure Of A Cystathionine Beta-Synthase | 6e-06 | ||
| 1y5h_A | 133 | Crystal Structure Of Truncated Se-Met Hypoxic Respo | 8e-06 |
| >pdb|4FRY|A Chain A, The Structure Of A Putative Signal-Transduction Protein With Cbs Domains From Burkholderia Ambifaria Mc40-6 Length = 157 | Back alignment and structure |
|
| >pdb|2RC3|A Chain A, Crystal Structure Of Cbs Domain, Ne2398 Length = 135 | Back alignment and structure |
| >pdb|3FHM|A Chain A, Crystal Structure Of The Cbs-Domain Containing Protein Atu1752 From Agrobacterium Tumefaciens Length = 165 | Back alignment and structure |
| >pdb|2EF7|A Chain A, Crystal Structure Of St2348, A Hypothetical Protein With Cbs Domains From Sulfolobus Tokodaii Strain7 Length = 133 | Back alignment and structure |
| >pdb|1XKF|A Chain A, Crystal Structure Of Hypoxic Response Protein I (Hrpi) With Two Coordinated Zinc Ions Length = 133 | Back alignment and structure |
| >pdb|2CU0|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 486 | Back alignment and structure |
| >pdb|1VRD|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase (Tm1347) From Thermotoga Maritima At 2.18 A Resolution Length = 494 | Back alignment and structure |
| >pdb|3GHD|A Chain A, Crystal Structure Of A Cystathionine Beta-Synthase Domain Protein Fused To A Zn-Ribbon-Like Domain Length = 70 | Back alignment and structure |
| >pdb|1Y5H|A Chain A, Crystal Structure Of Truncated Se-Met Hypoxic Response Protein I (Hrpi) Length = 133 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 208 | |||
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 6e-48 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 1e-46 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 2e-43 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 1e-39 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 4e-37 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 2e-36 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 2e-34 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 3e-11 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 7e-34 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 1e-33 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 1e-11 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 1e-32 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 2e-11 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 5e-29 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 9e-26 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 8e-25 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 9e-12 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 7e-24 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 3e-11 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 3e-22 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 3e-10 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 8e-04 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 1e-21 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 8e-08 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 8e-06 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 2e-21 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 5e-11 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 4e-21 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 7e-20 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 1e-19 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 3e-09 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-05 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 1e-20 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 4e-19 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 7e-19 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 3e-20 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 7e-07 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 4e-20 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 7e-14 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 4e-11 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 2e-07 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 2e-06 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 4e-20 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 8e-16 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 1e-14 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 9e-10 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 5e-19 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 4e-07 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 2e-18 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 1e-12 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 7e-18 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 3e-12 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 9e-18 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 9e-09 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 1e-17 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 2e-10 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 4e-17 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 4e-14 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 6e-10 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 5e-09 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 4e-17 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 9e-12 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 1e-16 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 2e-16 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 2e-09 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 6e-09 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 2e-07 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 1e-04 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 2e-15 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 8e-14 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 3e-13 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 3e-13 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 8e-13 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 1e-12 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 2e-12 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 2e-12 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 9e-12 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 3e-07 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 2e-04 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 6e-07 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 1e-04 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 2e-04 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 3e-04 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 4e-04 |
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
Score = 153 bits (389), Expect = 6e-48
Identities = 62/155 (40%), Positives = 94/155 (60%), Gaps = 7/155 (4%)
Query: 52 KGLENISVAEVLMTKGDDKVGSWLCCRSDDTVEDAVKNMAQHNIGSLVVLKPGEQQHIAG 111
G + +VA++L K D + +D V DA+K MA+ IG+L+V+ + IAG
Sbjct: 2 PGSMSTTVAQILKAK-PDSGRTIYTVTKNDFVYDAIKLMAEKGIGALLVV---DGDDIAG 57
Query: 112 IFTERDYLRKIVGQGRSPKYTRVAEIMTDENKLITLPSDANILHAMQLMTDKHIRHVPVI 171
I TERDY RK+V Q RS K TRV EIMT K+ + + M LMT+ +RH+PV+
Sbjct: 58 IVTERDYARKVVLQERSSKATRVEEIMTA--KVRYVEPSQSTDECMALMTEHRMRHLPVL 115
Query: 172 D-GRIVGMISIVDVVRAVVEQQKGELKRLNEFIRG 205
D G+++G+ISI D+V++V+ Q+ + +L +I G
Sbjct: 116 DGGKLIGLISIGDLVKSVIADQQFTISQLEHYIHG 150
|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Length = 632 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Length = 473 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Length = 205 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Length = 286 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 208 | |||
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.91 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.9 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.89 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.88 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.88 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.88 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.88 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.88 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.88 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.88 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.88 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.87 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.87 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.87 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.87 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.87 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.87 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.87 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.87 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.87 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.86 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.86 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.86 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.86 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.86 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.85 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.85 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.85 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.85 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.84 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.84 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.84 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.84 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.84 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.84 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.83 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.83 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.83 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.83 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.83 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.81 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.8 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.8 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.8 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.79 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.79 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.78 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.78 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.76 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.76 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.75 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.74 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.72 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.71 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.71 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.7 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.68 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.65 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.64 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.61 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.58 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.58 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.56 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.56 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.55 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.52 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 99.5 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.41 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.37 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 99.26 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.06 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.94 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.93 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.92 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.9 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.82 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.8 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.78 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.76 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.74 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 98.74 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.74 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.74 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.73 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 98.73 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.73 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 98.72 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 98.71 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 98.7 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.7 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.68 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.67 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.67 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.67 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 98.67 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 98.66 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.66 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 98.66 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.65 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.64 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.64 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 98.63 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.62 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.62 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 98.61 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.61 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.6 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 98.6 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.58 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.54 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.53 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 98.53 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 98.51 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.48 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 98.48 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.47 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 98.45 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 98.42 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 98.41 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 98.25 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 98.0 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 97.95 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 97.92 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.91 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 97.88 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.79 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 97.75 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 97.47 |
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
Probab=99.91 E-value=7.2e-24 Score=158.49 Aligned_cols=144 Identities=29% Similarity=0.470 Sum_probs=117.1
Q ss_pred CcccccHHHhhcccCCCCCCCeEEecCCchHHHHHHHHHhcCCcEEEEEecCCCceEEEeechHHHHHHHHhcCCCCCcc
Q 028491 53 GLENISVAEVLMTKGDDKVGSWLCCRSDDTVEDAVKNMAQHNIGSLVVLKPGEQQHIAGIFTERDYLRKIVGQGRSPKYT 132 (208)
Q Consensus 53 ~~~~~~v~~~m~~~~~~~~~~~~~v~~~~tl~~a~~~m~~~~~~~~pVv~~d~~~~~iG~vt~~dl~~~~~~~~~~~~~~ 132 (208)
.+..++|+++|.+... +++++.+++|+.+|++.|.+++++++||+ |++++++|+||.+||++++..........
T Consensus 20 ~l~~~~v~dim~~~~~----~~~~v~~~~~l~~a~~~~~~~~~~~~~Vv--d~~~~~~Givt~~dl~~~~~~~~~~~~~~ 93 (165)
T 3fhm_A 20 QGMATFVKDLLDRKGR----DVVTVGPDVSIGEAAGTLHAHKIGAVVVT--DADGVVLGIFTERDLVKAVAGQGAASLQQ 93 (165)
T ss_dssp SSSSCBHHHHHHHHCS----CCCEECTTSBHHHHHHHHHHHTCSEEEEE--CTTSCEEEEEEHHHHHHHHHHHGGGGGTS
T ss_pred hhhhcCHHHHhccCCC----CCeEECCCCCHHHHHHHHHHcCCCEEEEE--cCCCeEEEEEEHHHHHHHHHhcCCccccC
Confidence 3668999999997200 18899999999999999999999999999 78899999999999998776653234578
Q ss_pred chhhhhccCCCeEEEcCCCCHHHHHHHHHhcCCCEeeeecCc-eeEEEEHHHHHHHHHHhhHHHHHHHHHhhh
Q 028491 133 RVAEIMTDENKLITLPSDANILHAMQLMTDKHIRHVPVIDGR-IVGMISIVDVVRAVVEQQKGELKRLNEFIR 204 (208)
Q Consensus 133 ~v~~im~~~~~~~~v~~~~~l~~a~~~~~~~~~~~lpVvd~~-~vGiit~~dll~~~~~~~~~~~~~~~~~~~ 204 (208)
+++++|.+ +++++++++++.+|++.|.+++++++||+|++ ++|+||..|+++++.+........+++++.
T Consensus 94 ~v~~~m~~--~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~g~~~Giit~~dil~~~~~~~~~~~~~l~~~i~ 164 (165)
T 3fhm_A 94 SVSVAMTK--NVVRCQHNSTTDQLMEIMTGGRFRHVPVEENGRLAGIISIGDVVKARIGEIEAEAEHIKAYIA 164 (165)
T ss_dssp BGGGTSBS--SCCCBCTTCBHHHHHHHHHHHTCSEEEEEETTEEEEEEEHHHHHHHTTCC-------------
T ss_pred CHHHHhcC--CCeEECCCCcHHHHHHHHHHcCCCEEEEEECCEEEEEEEHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 99999998 89999999999999999999999999999999 999999999999999888887788887764
|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 208 | ||||
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 2e-18 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 3e-04 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 2e-14 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 0.002 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 4e-14 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 8e-14 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 2e-13 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 2e-13 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 0.003 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 1e-12 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 6e-05 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 1e-11 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 1e-11 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 2e-11 | |
| d1zfja4 | 126 | d.37.1.1 (A:95-220) Type II inosine monophosphate | 4e-11 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 5e-11 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 7e-11 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 0.004 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 7e-11 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 8e-11 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 8e-11 | |
| d2yvxa2 | 144 | d.37.1.1 (A:132-275) Magnesium transporter MgtE {T | 1e-09 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 2e-09 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 4e-09 | |
| d2ouxa2 | 127 | d.37.1.1 (A:136-262) Magnesium transporter MgtE {E | 4e-09 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 5e-09 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 1e-08 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 0.002 | |
| d2riha1 | 131 | d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 | 1e-08 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 2e-07 | |
| d1yava3 | 132 | d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bac | 3e-07 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 5e-07 |
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Uncharacterized protein NE2398 species: Nitrosomonas europaea [TaxId: 915]
Score = 76.0 bits (186), Expect = 2e-18
Identities = 46/133 (34%), Positives = 75/133 (56%), Gaps = 10/133 (7%)
Query: 58 SVAEVLMTKGDDKVGSWLCCRSDDTVEDAVKNMAQHNIGSLVVLKPGEQQHIAGIFTERD 117
+V +L KG V DD+V +A++ MA NIG+L+V+K + GI TERD
Sbjct: 3 TVKHLLQEKGHTVV----AIGPDDSVFNAMQKMAADNIGALLVMKDEKLV---GILTERD 55
Query: 118 YLRKIVGQGRSPKYTRVAEIMTDENKLITLPSDANILHAMQLMTDKHIRHVPVID-GRIV 176
+ RK + K T+V EIMT + + + M L+T+ +RH+PV+D G+++
Sbjct: 56 FSRKSYLLDKPVKDTQVKEIMTRQVAYV--DLNNTNEDCMALITEMRVRHLPVLDDGKVI 113
Query: 177 GMISIVDVVRAVV 189
G++SI D+V+ +
Sbjct: 114 GLLSIGDLVKDAI 126
|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Length = 132 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 208 | |||
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.93 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.91 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.91 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.91 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.91 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.9 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.9 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.89 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.88 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.88 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.88 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.88 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.88 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.87 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.86 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.86 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.85 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.84 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.84 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.84 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.83 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.82 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.82 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.81 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.81 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.79 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.06 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.99 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.96 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 98.86 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.85 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.85 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.84 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.84 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.82 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.81 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.81 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.8 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.79 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.78 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.77 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.68 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.67 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 98.64 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 98.62 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 98.61 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.58 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.57 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.57 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.55 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.53 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.49 | |
| d1lkvx_ | 213 | FliG {Thermotoga maritima [TaxId: 2336]} | 92.83 | |
| d1lkvx_ | 213 | FliG {Thermotoga maritima [TaxId: 2336]} | 89.63 |
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Hypothetical protein Rv2626c species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.93 E-value=1.2e-25 Score=159.08 Aligned_cols=121 Identities=25% Similarity=0.539 Sum_probs=112.1
Q ss_pred ccHHHhhcccCCCCCCCeEEecCCchHHHHHHHHHhcCCcEEEEEecCCCceEEEeechHHHHHHHHhcCCCCCccchhh
Q 028491 57 ISVAEVLMTKGDDKVGSWLCCRSDDTVEDAVKNMAQHNIGSLVVLKPGEQQHIAGIFTERDYLRKIVGQGRSPKYTRVAE 136 (208)
Q Consensus 57 ~~v~~~m~~~~~~~~~~~~~v~~~~tl~~a~~~m~~~~~~~~pVv~~d~~~~~iG~vt~~dl~~~~~~~~~~~~~~~v~~ 136 (208)
.+++|+|+++ ++++.+++|+.+|++.|.+++++++||+ |++|+++|+||.+||+..++.++.......+++
T Consensus 1 tt~~diM~~~-------~~~v~~~~tl~~a~~~m~~~~~~~~pVv--d~~~~~~Giit~~Di~~~~~~~~~~~~~~~v~~ 71 (123)
T d1y5ha3 1 TTARDIMNAG-------VTCVGEHETLTAAAQYMREHDIGALPIC--GDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGE 71 (123)
T ss_dssp CCHHHHSEET-------CCCEETTSBHHHHHHHHHHHTCSEEEEE--CGGGBEEEEEEHHHHHHTTGGGTCCTTTSBHHH
T ss_pred CCHHHhcCCC-------CcEECCcCcHHHHHHHHHHcCCCceEEE--eccchhhhhhhhhhHhhhhhhcCCCcccceEEE
Confidence 3789999998 9999999999999999999999999999 788999999999999887777766666778999
Q ss_pred hhccCCCeEEEcCCCCHHHHHHHHHhcCCCEeeeecCc-eeEEEEHHHHHHHH
Q 028491 137 IMTDENKLITLPSDANILHAMQLMTDKHIRHVPVIDGR-IVGMISIVDVVRAV 188 (208)
Q Consensus 137 im~~~~~~~~v~~~~~l~~a~~~~~~~~~~~lpVvd~~-~vGiit~~dll~~~ 188 (208)
+|.+ +++++++++++.+|++.|.+++++++||+|++ ++|+||..|+++++
T Consensus 72 im~~--~~~~v~~~~~~~~~~~~m~~~~~~~lpVvd~~~lvGiit~~Dil~~l 122 (123)
T d1y5ha3 72 LARD--SIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHL 122 (123)
T ss_dssp HHTT--CCCCEETTCCHHHHHHHHHHHTCSEEEEEETTEEEEEEEHHHHHHTC
T ss_pred Eeec--cceeeeecchHHHHHHHHHHcCceEEEEEECCEEEEEEEHHHHHhhC
Confidence 9998 89999999999999999999999999999988 99999999999864
|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|