Citrus Sinensis ID: 029271
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 196 | ||||||
| 14590237 | 177 | phosphoribosylaminoimidazole carboxylase | 0.760 | 0.841 | 0.46 | 2e-29 | |
| 449442114 | 586 | PREDICTED: phosphoribosylaminoimidazole | 0.755 | 0.252 | 0.477 | 6e-29 | |
| 449490248 | 586 | PREDICTED: phosphoribosylaminoimidazole | 0.755 | 0.252 | 0.477 | 7e-29 | |
| 357441429 | 641 | Phosphoribosylaminoimidazole carboxylase | 0.755 | 0.230 | 0.483 | 1e-28 | |
| 410667200 | 164 | phosphoribosylaminoimidazole carboxylase | 0.739 | 0.884 | 0.493 | 3e-28 | |
| 356535191 | 633 | PREDICTED: phosphoribosylaminoimidazole | 0.739 | 0.229 | 0.486 | 4e-28 | |
| 13173434 | 623 | phosphoribosylaminoimidazole carboxylase | 0.75 | 0.235 | 0.493 | 5e-28 | |
| 37983592 | 621 | phosphoribosylaminoimidazole carboxylase | 0.75 | 0.236 | 0.493 | 6e-28 | |
| 297823643 | 645 | hypothetical protein ARALYDRAFT_321477 [ | 0.744 | 0.226 | 0.462 | 2e-27 | |
| 356576720 | 633 | PREDICTED: phosphoribosylaminoimidazole | 0.744 | 0.230 | 0.482 | 2e-27 |
| >gi|14590237|ref|NP_142303.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] gi|3914493|sp|O58058.1|PURE_PYRHO RecName: Full=N5-carboxyaminoimidazole ribonucleotide mutase; Short=N5-CAIR mutase; AltName: Full=5-(carboxyamino)imidazole ribonucleotide mutase gi|3256711|dbj|BAA29394.1| 177aa long hypothetical phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] | Back alignment and taxonomy information |
|---|
Score = 134 bits (337), Expect = 2e-29, Method: Compositional matrix adjust.
Identities = 69/150 (46%), Positives = 107/150 (71%), Gaps = 1/150 (0%)
Query: 48 LAADAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERG 107
+ ++ P+VGIIM SD DLPVM +AAR L +FGVPYEI I+ H+ + A YA A+ERG
Sbjct: 5 MKSEKPLVGIIMGSDSDLPVMKEAARILEEFGVPYEITIISAHRTPERAYEYAKKAEERG 64
Query: 108 IKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSE-DDVINSIRMPSHVQVASVPRN 166
I++II G G AHL G+ A+ + + VI VP+ S+ + D +++ ++MPS + VA+V +
Sbjct: 65 IEVIIAGAGGAAHLPGIIASLTVLPVIGVPIKSKALNGLDSLLSIVQMPSGIPVATVAID 124
Query: 167 NAKNAALYAVKVLGIADEDLLERIRKYVEE 196
NAKNAAL A+++LGI ++ E++R+Y+++
Sbjct: 125 NAKNAALLALRILGIKYPEIKEKLRRYMKD 154
|
Source: Pyrococcus horikoshii OT3 Species: Pyrococcus horikoshii Genus: Pyrococcus Family: Thermococcaceae Order: Thermococcales Class: Thermococci Phylum: Euryarchaeota Superkingdom: Archaea |
| >gi|449442114|ref|XP_004138827.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449490248|ref|XP_004158550.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357441429|ref|XP_003590992.1| Phosphoribosylaminoimidazole carboxylase [Medicago truncatula] gi|355480040|gb|AES61243.1| Phosphoribosylaminoimidazole carboxylase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|410667200|ref|YP_006919571.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] gi|409104947|gb|AFV11072.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] | Back alignment and taxonomy information |
|---|
| >gi|356535191|ref|XP_003536132.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|13173434|gb|AAK14408.1| phosphoribosylaminoimidazole carboxylase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|37983592|gb|AAR06291.1| phosphoribosylaminoimidazole carboxylase, partial [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|297823643|ref|XP_002879704.1| hypothetical protein ARALYDRAFT_321477 [Arabidopsis lyrata subsp. lyrata] gi|297325543|gb|EFH55963.1| hypothetical protein ARALYDRAFT_321477 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356576720|ref|XP_003556478.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 196 | ||||||
| CGD|CAL0003241 | 568 | ADE2 [Candida albicans (taxid: | 0.780 | 0.269 | 0.422 | 1.9e-27 | |
| UNIPROTKB|Q92210 | 568 | ADE2 "Phosphoribosylaminoimida | 0.780 | 0.269 | 0.422 | 1.9e-27 | |
| TAIR|locus:2040771 | 642 | AT2G37690 [Arabidopsis thalian | 0.744 | 0.227 | 0.462 | 4.2e-27 | |
| SGD|S000005654 | 571 | ADE2 "Phosphoribosylaminoimida | 0.724 | 0.248 | 0.454 | 3.8e-26 | |
| TAIR|locus:2051314 | 162 | AT2G05140 "AT2G05140" [Arabido | 0.704 | 0.851 | 0.453 | 3.6e-25 | |
| UNIPROTKB|P96880 | 174 | purE "N5-carboxyaminoimidazole | 0.724 | 0.816 | 0.426 | 1.8e-23 | |
| POMBASE|SPCC1322.13 | 552 | ade6 "phosphoribosylaminoimida | 0.846 | 0.300 | 0.366 | 4.5e-22 | |
| TIGR_CMR|GSU_0611 | 169 | GSU_0611 "phosphoribosylaminoi | 0.719 | 0.834 | 0.409 | 5.5e-22 | |
| TIGR_CMR|CHY_1069 | 162 | CHY_1069 "phosphoribosylaminoi | 0.724 | 0.876 | 0.373 | 1.1e-21 | |
| TIGR_CMR|CPS_0026 | 160 | CPS_0026 "phosphoribosylaminoi | 0.709 | 0.868 | 0.373 | 1.2e-19 |
| CGD|CAL0003241 ADE2 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Score = 293 (108.2 bits), Expect = 1.9e-27, Sum P(2) = 1.9e-27
Identities = 65/154 (42%), Positives = 93/154 (60%)
Query: 42 LPRFLLLAADAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYAL 101
+P+ L ++P+VGIIM SD DLPVM AR L FGVP+E+ I+ H+ YA+
Sbjct: 386 IPKSLATDKESPLVGIIMGSDSDLPVMAVGARILKQFGVPFELTIVSAHRTPHRMSEYAI 445
Query: 102 SAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSI-RMPSHVQV 160
A +RG+K II G G AHL G+ AA + + VI VP+ D ++SI +MP + V
Sbjct: 446 EAPKRGLKCIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGIPV 505
Query: 161 ASVPRNNAKNAALYAVKVLGIADEDLLERIRKYV 194
A+V NN+ NAAL A+++LG D L + +Y+
Sbjct: 506 ATVAINNSTNAALLAIRILGAYDSKWLTEMNQYM 539
|
|
| UNIPROTKB|Q92210 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040771 AT2G37690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| SGD|S000005654 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2051314 AT2G05140 "AT2G05140" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P96880 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC1322.13 ade6 "phosphoribosylaminoimidazole carboxylase Ade6" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0611 GSU_0611 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1069 CHY_1069 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0026 CPS_0026 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| purE | phosphoribosylaminoimidazole carboxylase catalytic subunit; This subunit can alone transform AIR to CAIR, but in association with purK, which possesses an ATPase activity, an enzyme complex is produced which is capable of converting AIR to CAIR efficiently under physiological condition (By similarity) (177 aa) | ||||||||||
(Pyrococcus horikoshii) | |||||||||||
| purC | • | • | • | • | • | 0.999 | |||||
| purD | • | • | • | • | • | • | • | 0.999 | |||
| purT | • | • | • | • | • | 0.999 | |||||
| purF | • | • | • | • | • | • | 0.998 | ||||
| purM | • | • | • | • | • | • | 0.997 | ||||
| purB | • | • | • | • | • | 0.996 | |||||
| purQ | • | • | • | • | 0.982 | ||||||
| glnA | • | • | 0.976 | ||||||||
| purL | • | • | • | 0.964 | |||||||
| purA | • | • | • | 0.961 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 196 | |||
| TIGR01162 | 156 | TIGR01162, purE, phosphoribosylaminoimidazole carb | 6e-43 | |
| pfam00731 | 150 | pfam00731, AIRC, AIR carboxylase | 1e-41 | |
| COG0041 | 162 | COG0041, PurE, Phosphoribosylcarboxyaminoimidazole | 2e-41 | |
| PLN02948 | 577 | PLN02948, PLN02948, phosphoribosylaminoimidazole c | 2e-40 | |
| smart01001 | 152 | smart01001, AIRC, AIR carboxylase | 2e-37 |
| >gnl|CDD|130230 TIGR01162, purE, phosphoribosylaminoimidazole carboxylase, PurE protein | Back alignment and domain information |
|---|
Score = 140 bits (356), Expect = 6e-43
Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 1/143 (0%)
Query: 55 VGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVG 114
VGIIM SD DLP M AA L +FG+PYE++++ H+ + L YA A+ERGIK+II G
Sbjct: 1 VGIIMGSDSDLPTMKKAADILEEFGIPYELRVVSAHRTPELMLEYAKEAEERGIKVIIAG 60
Query: 115 DGVEAHLSGVAAANSQILVIRVPL-LSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAAL 173
G AHL G+ AA + + VI VP+ D +++ ++MPS V VA+V NA NAAL
Sbjct: 61 AGGAAHLPGMVAALTPLPVIGVPVPSKALSGLDSLLSIVQMPSGVPVATVAIGNAGNAAL 120
Query: 174 YAVKVLGIADEDLLERIRKYVEE 196
A ++LGI D +L E++++Y E
Sbjct: 121 LAAQILGIKDPELAEKLKEYREN 143
|
Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE. This model represents PurK, an N5-CAIR mutase [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]. Length = 156 |
| >gnl|CDD|144362 pfam00731, AIRC, AIR carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|223119 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|214965 smart01001, AIRC, AIR carboxylase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| TIGR01162 | 156 | purE phosphoribosylaminoimidazole carboxylase, Pur | 100.0 | |
| COG0041 | 162 | PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m | 100.0 | |
| PF00731 | 150 | AIRC: AIR carboxylase; InterPro: IPR000031 Phospho | 100.0 | |
| PLN02948 | 577 | phosphoribosylaminoimidazole carboxylase | 100.0 | |
| COG1691 | 254 | NCAIR mutase (PurE)-related proteins [General func | 99.97 | |
| KOG2835 | 373 | consensus Phosphoribosylamidoimidazole-succinocarb | 99.88 | |
| KOG2835 | 373 | consensus Phosphoribosylamidoimidazole-succinocarb | 99.11 | |
| cd08170 | 351 | GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox | 97.46 | |
| PRK00843 | 350 | egsA NAD(P)-dependent glycerol-1-phosphate dehydro | 97.45 | |
| cd08550 | 349 | GlyDH-like Glycerol_dehydrogenase-like. Families o | 97.39 | |
| cd08175 | 348 | G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c | 97.23 | |
| cd08171 | 345 | GlyDH-like2 Glycerol dehydrogenase-like. Glycerol | 97.23 | |
| PRK09423 | 366 | gldA glycerol dehydrogenase; Provisional | 97.22 | |
| TIGR01357 | 344 | aroB 3-dehydroquinate synthase. This model represe | 97.21 | |
| cd08195 | 345 | DHQS Dehydroquinate synthase (DHQS) catalyzes the | 97.21 | |
| cd08551 | 370 | Fe-ADH iron-containing alcohol dehydrogenases (Fe- | 97.18 | |
| cd08173 | 339 | Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro | 97.08 | |
| cd08549 | 332 | G1PDH_related Glycerol-1-phosphate_dehydrogenase a | 97.06 | |
| cd07766 | 332 | DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) | 97.02 | |
| PRK00002 | 358 | aroB 3-dehydroquinate synthase; Reviewed | 96.94 | |
| cd08185 | 380 | Fe-ADH1 Iron-containing alcohol dehydrogenases-lik | 96.92 | |
| cd08199 | 354 | EEVS 2-epi-5-epi-valiolone synthase (EEVS). 2-epi- | 96.85 | |
| cd08197 | 355 | DOIS 2-deoxy-scyllo-inosose synthase (DOIS) cataly | 96.83 | |
| cd08183 | 374 | Fe-ADH2 Iron-containing alcohol dehydrogenases-lik | 96.8 | |
| cd08182 | 367 | HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c | 96.77 | |
| cd08176 | 377 | LPO Lactadehyde:propanediol oxidoreductase (LPO) c | 96.73 | |
| cd08174 | 331 | G1PDH-like Glycerol-1-phosphate dehydrogenase-like | 96.72 | |
| cd08193 | 376 | HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze | 96.66 | |
| cd08194 | 375 | Fe-ADH6 Iron-containing alcohol dehydrogenases-lik | 96.61 | |
| cd08187 | 382 | BDH Butanol dehydrogenase catalyzes the conversion | 96.54 | |
| cd08186 | 383 | Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ | 96.54 | |
| TIGR02638 | 379 | lactal_redase lactaldehyde reductase. This clade o | 96.49 | |
| cd08189 | 374 | Fe-ADH5 Iron-containing alcohol dehydrogenases-lik | 96.46 | |
| PLN02834 | 433 | 3-dehydroquinate synthase | 96.41 | |
| cd08192 | 370 | Fe-ADH7 Iron-containing alcohol dehydrogenases-lik | 96.41 | |
| cd08172 | 347 | GlyDH-like1 Glycerol dehydrogenases-like. Glycerol | 96.35 | |
| cd08181 | 357 | PPD-like 1,3-propanediol dehydrogenase-like (PPD). | 96.3 | |
| cd08178 | 398 | AAD_C C-terminal alcohol dehydrogenase domain of t | 96.28 | |
| PF13685 | 250 | Fe-ADH_2: Iron-containing alcohol dehydrogenase; P | 96.24 | |
| PF00465 | 366 | Fe-ADH: Iron-containing alcohol dehydrogenase ; In | 96.2 | |
| cd08177 | 337 | MAR Maleylacetate reductase is involved in many ar | 96.19 | |
| cd08191 | 386 | HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz | 96.13 | |
| cd08169 | 344 | DHQ-like Dehydroquinate synthase-like which includ | 96.13 | |
| cd08179 | 375 | NADPH_BDH NADPH-dependent butanol dehydrogenase in | 96.08 | |
| PRK15454 | 395 | ethanol dehydrogenase EutG; Provisional | 96.06 | |
| cd08188 | 377 | Fe-ADH4 Iron-containing alcohol dehydrogenases-lik | 95.96 | |
| PRK10624 | 382 | L-1,2-propanediol oxidoreductase; Provisional | 95.93 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 95.9 | |
| PRK09860 | 383 | putative alcohol dehydrogenase; Provisional | 95.88 | |
| cd08190 | 414 | HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv | 95.86 | |
| PRK06203 | 389 | aroB 3-dehydroquinate synthase; Reviewed | 95.77 | |
| cd08180 | 332 | PDD 1,3-propanediol dehydrogenase (PPD) catalyzes | 95.77 | |
| PRK10586 | 362 | putative oxidoreductase; Provisional | 95.74 | |
| cd08198 | 369 | DHQS-like2 Dehydroquinate synthase (DHQS)-like. DH | 95.28 | |
| PRK15138 | 387 | aldehyde reductase; Provisional | 95.26 | |
| COG0371 | 360 | GldA Glycerol dehydrogenase and related enzymes [E | 95.07 | |
| cd08196 | 346 | DHQS-like1 Dehydroquinate synthase (DHQS)-like. DH | 95.02 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 94.72 | |
| PF06506 | 176 | PrpR_N: Propionate catabolism activator; InterPro: | 94.69 | |
| COG1454 | 377 | EutG Alcohol dehydrogenase, class IV [Energy produ | 93.94 | |
| PRK13805 | 862 | bifunctional acetaldehyde-CoA/alcohol dehydrogenas | 93.9 | |
| TIGR02417 | 327 | fruct_sucro_rep D-fructose-responsive transcriptio | 93.62 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 93.54 | |
| cd08184 | 347 | Fe-ADH3 Iron-containing alcohol dehydrogenases-lik | 93.31 | |
| PF04392 | 294 | ABC_sub_bind: ABC transporter substrate binding pr | 93.19 | |
| cd03786 | 363 | GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th | 93.11 | |
| cd06283 | 267 | PBP1_RegR_EndR_KdgR_like Ligand-binding domain of | 93.06 | |
| cd06280 | 263 | PBP1_LacI_like_4 Ligand-binding domain of uncharac | 92.91 | |
| cd06275 | 269 | PBP1_PurR Ligand-binding domain of purine represso | 92.9 | |
| COG3199 | 355 | Predicted inorganic polyphosphate/ATP-NAD kinase [ | 92.67 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 92.32 | |
| TIGR03405 | 355 | Phn_Fe-ADH phosphonate metabolism-associated iron- | 92.17 | |
| PF13407 | 257 | Peripla_BP_4: Periplasmic binding protein domain; | 91.79 | |
| COG2515 | 323 | Acd 1-aminocyclopropane-1-carboxylate deaminase [A | 91.63 | |
| PRK01372 | 304 | ddl D-alanine--D-alanine ligase; Reviewed | 91.59 | |
| cd06311 | 274 | PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi | 91.57 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 91.48 | |
| PRK13055 | 334 | putative lipid kinase; Reviewed | 91.19 | |
| cd06298 | 268 | PBP1_CcpA_like Ligand-binding domain of the catabo | 90.78 | |
| PRK11914 | 306 | diacylglycerol kinase; Reviewed | 90.71 | |
| cd06305 | 273 | PBP1_methylthioribose_binding_like Methylthioribos | 90.6 | |
| cd01391 | 269 | Periplasmic_Binding_Protein_Type_1 Type 1 periplas | 90.51 | |
| COG0337 | 360 | AroB 3-dehydroquinate synthetase [Amino acid trans | 90.47 | |
| cd01537 | 264 | PBP1_Repressors_Sugar_Binding_like Ligand-binding | 90.33 | |
| cd01539 | 303 | PBP1_GGBP Periplasmic glucose/galactose-binding pr | 90.3 | |
| PRK10653 | 295 | D-ribose transporter subunit RbsB; Provisional | 90.18 | |
| COG2984 | 322 | ABC-type uncharacterized transport system, peripla | 90.0 | |
| PRK13337 | 304 | putative lipid kinase; Reviewed | 89.96 | |
| PRK13054 | 300 | lipid kinase; Reviewed | 89.77 | |
| cd06273 | 268 | PBP1_GntR_like_1 This group includes the ligand-bi | 89.23 | |
| TIGR03702 | 293 | lip_kinase_YegS lipid kinase YegS. Members of this | 89.22 | |
| PRK10727 | 343 | DNA-binding transcriptional regulator GalR; Provis | 89.18 | |
| cd06323 | 268 | PBP1_ribose_binding Periplasmic sugar-binding doma | 89.07 | |
| cd01541 | 273 | PBP1_AraR Ligand-binding domain of DNA transcripti | 89.01 | |
| TIGR00147 | 293 | lipid kinase, YegS/Rv2252/BmrU family. The E. coli | 88.83 | |
| cd06318 | 282 | PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi | 88.31 | |
| PF00763 | 117 | THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh | 87.79 | |
| cd06321 | 271 | PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b | 87.63 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 87.61 | |
| PRK10481 | 224 | hypothetical protein; Provisional | 87.57 | |
| PF00532 | 279 | Peripla_BP_1: Periplasmic binding proteins and sug | 87.43 | |
| cd06300 | 272 | PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi | 87.41 | |
| cd01575 | 268 | PBP1_GntR Ligand-binding domain of DNA transcripti | 87.28 | |
| cd06310 | 273 | PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi | 87.21 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 86.98 | |
| cd06296 | 270 | PBP1_CatR_like Ligand-binding domain of a LacI-lik | 86.85 | |
| cd06320 | 275 | PBP1_allose_binding Periplasmic allose-binding dom | 86.23 | |
| TIGR02955 | 295 | TMAO_TorT TMAO reductase system periplasmic protei | 86.22 | |
| cd01542 | 259 | PBP1_TreR_like Ligand-binding domain of DNA transc | 86.19 | |
| PRK00861 | 300 | putative lipid kinase; Reviewed | 85.58 | |
| PRK10014 | 342 | DNA-binding transcriptional repressor MalI; Provis | 85.54 | |
| cd01538 | 288 | PBP1_ABC_xylose_binding Periplasmic xylose-binding | 85.43 | |
| cd01988 | 132 | Na_H_Antiporter_C The C-terminal domain of a subfa | 85.29 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 85.2 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 85.19 | |
| cd06292 | 273 | PBP1_LacI_like_10 Ligand-binding domain of unchara | 84.79 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 84.78 | |
| COG1597 | 301 | LCB5 Sphingosine kinase and enzymes related to euk | 84.15 | |
| PRK10703 | 341 | DNA-binding transcriptional repressor PurR; Provis | 83.87 | |
| TIGR01481 | 329 | ccpA catabolite control protein A. Catabolite cont | 83.26 | |
| cd06290 | 265 | PBP1_LacI_like_9 Ligand-binding domain of uncharac | 82.18 | |
| cd00578 | 452 | L-fuc_L-ara-isomerases L-fucose isomerase (FucIase | 82.05 | |
| cd06308 | 270 | PBP1_sensor_kinase_like Periplasmic binding domain | 81.95 | |
| cd00764 | 762 | Eukaryotic_PFK Phosphofructokinase, a key regulato | 81.83 | |
| cd00860 | 91 | ThrRS_anticodon ThrRS Threonyl-anticodon binding d | 81.49 | |
| PF10096 | 243 | DUF2334: Uncharacterized protein conserved in bact | 81.44 | |
| cd06293 | 269 | PBP1_LacI_like_11 Ligand-binding domain of unchara | 81.22 | |
| cd06284 | 267 | PBP1_LacI_like_6 Ligand-binding domain of an uncha | 81.01 | |
| PRK10310 | 94 | PTS system galactitol-specific transporter subunit | 80.89 | |
| cd06289 | 268 | PBP1_MalI_like Ligand-binding domain of MalI, a tr | 80.75 | |
| PRK09526 | 342 | lacI lac repressor; Reviewed | 80.7 | |
| PRK13951 | 488 | bifunctional shikimate kinase/3-dehydroquinate syn | 80.49 | |
| cd01540 | 289 | PBP1_arabinose_binding Periplasmic L-arabinose-bin | 80.17 | |
| cd06281 | 269 | PBP1_LacI_like_5 Ligand-binding domain of uncharac | 80.08 |
| >TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.5e-60 Score=385.89 Aligned_cols=142 Identities=48% Similarity=0.748 Sum_probs=139.8
Q ss_pred EEEEEcCCCCHHHHHHHHHHHHHhCCCeEEEEEcccCCchHHHHHHHHHhhCCCeEEEEecCCCCchhHhhhhccCCcEE
Q 029271 55 VGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVI 134 (196)
Q Consensus 55 V~IimGS~SD~~~~~~~~~~l~~~gi~~ev~V~SaHR~p~~~~~~~~~~e~~~~~V~IavAG~sa~L~gvvA~~t~~PVI 134 (196)
|+|||||+||+++|+|+.++|++|||+||++|+||||+|+++.+|+++|+++|++|||++||++||||||+||+|++|||
T Consensus 1 V~IimGS~SD~~~~~~a~~~L~~~gi~~dv~V~SaHRtp~~~~~~~~~a~~~g~~viIa~AG~aa~Lpgvva~~t~~PVI 80 (156)
T TIGR01162 1 VGIIMGSDSDLPTMKKAADILEEFGIPYELRVVSAHRTPELMLEYAKEAEERGIKVIIAGAGGAAHLPGMVAALTPLPVI 80 (156)
T ss_pred CEEEECcHhhHHHHHHHHHHHHHcCCCeEEEEECcccCHHHHHHHHHHHHHCCCeEEEEeCCccchhHHHHHhccCCCEE
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EecCCCCCCChhh-hhhhhcCCCCCeeeEEecCChhhHHHHHHHHHccCCHHHHHHHHHHHhC
Q 029271 135 RVPLLSEDWSEDD-VINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE 196 (196)
Q Consensus 135 gvP~~~~~~~G~D-LlS~lqmPsGvpvatV~I~~~~nAA~~AaqILa~~d~~l~~kl~~~r~~ 196 (196)
|||++++.++|+| ||||+|||+|+||+||+|+|++|||++|+|||+++|++||+||++||++
T Consensus 81 gvP~~~~~l~G~daLlS~vqmP~gvpvatv~I~~~~nAa~~AaqIl~~~d~~l~~kl~~~r~~ 143 (156)
T TIGR01162 81 GVPVPSKALSGLDSLLSIVQMPSGVPVATVAIGNAGNAALLAAQILGIKDPELAEKLKEYREN 143 (156)
T ss_pred EecCCccCCCCHHHHHHHhcCCCCCeeEEEEcCChhHHHHHHHHHHcCCCHHHHHHHHHHHHH
Confidence 9999988899999 9999999999999999999999999999999999999999999999974
|
Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE. This model represents PurK, an N5-CAIR mutase. |
| >COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE | Back alignment and domain information |
|---|
| >PLN02948 phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation | Back alignment and domain information |
|---|
| >PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd08550 GlyDH-like Glycerol_dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner | Back alignment and domain information |
|---|
| >cd08171 GlyDH-like2 Glycerol dehydrogenase-like | Back alignment and domain information |
|---|
| >PRK09423 gldA glycerol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01357 aroB 3-dehydroquinate synthase | Back alignment and domain information |
|---|
| >cd08195 DHQS Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis | Back alignment and domain information |
|---|
| >cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like | Back alignment and domain information |
|---|
| >cd08173 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro1PDH) catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate using either NADH or NADPH as a coenzyme | Back alignment and domain information |
|---|
| >cd08549 G1PDH_related Glycerol-1-phosphate_dehydrogenase and related proteins | Back alignment and domain information |
|---|
| >cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) | Back alignment and domain information |
|---|
| >PRK00002 aroB 3-dehydroquinate synthase; Reviewed | Back alignment and domain information |
|---|
| >cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08199 EEVS 2-epi-5-epi-valiolone synthase (EEVS) | Back alignment and domain information |
|---|
| >cd08197 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) catalyzes carbocycle formation from D-glucose-6-phosphate to 2-deoxy-scyllo-inosose through a multistep reaction in the biosynthesis of aminoglycoside antibiotics | Back alignment and domain information |
|---|
| >cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) | Back alignment and domain information |
|---|
| >cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria | Back alignment and domain information |
|---|
| >cd08174 G1PDH-like Glycerol-1-phosphate dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor | Back alignment and domain information |
|---|
| >cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process | Back alignment and domain information |
|---|
| >cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02638 lactal_redase lactaldehyde reductase | Back alignment and domain information |
|---|
| >cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >PLN02834 3-dehydroquinate synthase | Back alignment and domain information |
|---|
| >cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway | Back alignment and domain information |
|---|
| >cd08172 GlyDH-like1 Glycerol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) | Back alignment and domain information |
|---|
| >cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) | Back alignment and domain information |
|---|
| >PF13685 Fe-ADH_2: Iron-containing alcohol dehydrogenase; PDB: 3CE9_C | Back alignment and domain information |
|---|
| >PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes | Back alignment and domain information |
|---|
| >cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate | Back alignment and domain information |
|---|
| >cd08169 DHQ-like Dehydroquinate synthase-like which includes dehydroquinate synthase, 2-deoxy-scyllo-inosose synthase, and 2-epi-5-epi-valiolone synthase | Back alignment and domain information |
|---|
| >cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria | Back alignment and domain information |
|---|
| >PRK15454 ethanol dehydrogenase EutG; Provisional | Back alignment and domain information |
|---|
| >cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >PRK10624 L-1,2-propanediol oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09860 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism | Back alignment and domain information |
|---|
| >PRK06203 aroB 3-dehydroquinate synthase; Reviewed | Back alignment and domain information |
|---|
| >cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism | Back alignment and domain information |
|---|
| >PRK10586 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd08198 DHQS-like2 Dehydroquinate synthase (DHQS)-like | Back alignment and domain information |
|---|
| >PRK15138 aldehyde reductase; Provisional | Back alignment and domain information |
|---|
| >COG0371 GldA Glycerol dehydrogenase and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd08196 DHQS-like1 Dehydroquinate synthase (DHQS)-like | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >cd08184 Fe-ADH3 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems | Back alignment and domain information |
|---|
| >cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) | Back alignment and domain information |
|---|
| >cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR | Back alignment and domain information |
|---|
| >cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli | Back alignment and domain information |
|---|
| >COG3199 Predicted inorganic polyphosphate/ATP-NAD kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR03405 Phn_Fe-ADH phosphonate metabolism-associated iron-containing alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A | Back alignment and domain information |
|---|
| >COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01372 ddl D-alanine--D-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >PRK13055 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation | Back alignment and domain information |
|---|
| >PRK11914 diacylglycerol kinase; Reviewed | Back alignment and domain information |
|---|
| >cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily | Back alignment and domain information |
|---|
| >COG0337 AroB 3-dehydroquinate synthetase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems | Back alignment and domain information |
|---|
| >cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species | Back alignment and domain information |
|---|
| >PRK10653 D-ribose transporter subunit RbsB; Provisional | Back alignment and domain information |
|---|
| >COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13337 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK13054 lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >TIGR03702 lip_kinase_YegS lipid kinase YegS | Back alignment and domain information |
|---|
| >PRK10727 DNA-binding transcriptional regulator GalR; Provisional | Back alignment and domain information |
|---|
| >cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs | Back alignment and domain information |
|---|
| >cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >TIGR00147 lipid kinase, YegS/Rv2252/BmrU family | Back alignment and domain information |
|---|
| >cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PRK10481 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators | Back alignment and domain information |
|---|
| >cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily | Back alignment and domain information |
|---|
| >cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation | Back alignment and domain information |
|---|
| >cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis | Back alignment and domain information |
|---|
| >TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT | Back alignment and domain information |
|---|
| >cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PRK00861 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK10014 DNA-binding transcriptional repressor MalI; Provisional | Back alignment and domain information |
|---|
| >cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK10703 DNA-binding transcriptional repressor PurR; Provisional | Back alignment and domain information |
|---|
| >TIGR01481 ccpA catabolite control protein A | Back alignment and domain information |
|---|
| >cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd00578 L-fuc_L-ara-isomerases L-fucose isomerase (FucIase) and L-arabinose isomerase (AI) family; composed of FucIase, AI and similar proteins | Back alignment and domain information |
|---|
| >cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems | Back alignment and domain information |
|---|
| >cd00764 Eukaryotic_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate | Back alignment and domain information |
|---|
| >cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain | Back alignment and domain information |
|---|
| >PF10096 DUF2334: Uncharacterized protein conserved in bacteria (DUF2334); InterPro: IPR018763 This group of proteins has no known function | Back alignment and domain information |
|---|
| >cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria | Back alignment and domain information |
|---|
| >PRK10310 PTS system galactitol-specific transporter subunit IIB; Provisional | Back alignment and domain information |
|---|
| >cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria | Back alignment and domain information |
|---|
| >PRK09526 lacI lac repressor; Reviewed | Back alignment and domain information |
|---|
| >PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily | Back alignment and domain information |
|---|
| >cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 196 | ||||
| 1o4v_A | 183 | Crystal Structure Of The Catalytic Subunit Of A Pho | 1e-26 | ||
| 3lp6_A | 174 | Crystal Structure Of Rv3275c-E60a From Mycobacteriu | 2e-21 | ||
| 4b4k_A | 181 | Crystal Structure Of Bacillus Anthracis Pure Length | 3e-18 | ||
| 1xmp_A | 170 | Crystal Structure Of Pure (Ba0288) From Bacillus An | 4e-18 | ||
| 3opq_A | 163 | Phosphoribosylaminoimidazole Carboxylase With Fruct | 5e-16 | ||
| 3oow_A | 166 | Octameric Structure Of The Phosphoribosylaminoimida | 5e-16 | ||
| 4grd_A | 173 | Crystal Structure Of Phosphoribosylaminoimidazole C | 2e-14 | ||
| 1u11_A | 182 | Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutas | 3e-14 | ||
| 2fw1_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 3e-14 | ||
| 2fwa_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 3e-13 | ||
| 2fw6_A | 183 | Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc | 3e-13 | ||
| 2fwb_A | 183 | Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc | 4e-13 | ||
| 2fw9_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 4e-13 | ||
| 2fwi_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 5e-13 | ||
| 2ywx_A | 157 | Crystal Structure Of Phosphoribosylaminoimidazole C | 4e-12 | ||
| 2fw8_A | 183 | Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc | 1e-10 | ||
| 3ors_A | 163 | Crystal Structure Of N5-Carboxyaminoimidazole Ribon | 2e-10 | ||
| 2nsl_A | 169 | E. Coli Pure H45n Mutant Complexed With Cair Length | 1e-09 | ||
| 2nsh_A | 169 | E. Coli Pure H45q Mutant Complexed With Nitro-Air L | 1e-09 | ||
| 2h31_A | 425 | Crystal Structure Of Human Paics, A Bifunctional Ca | 5e-09 | ||
| 3rg8_A | 159 | Crystal Structure Of Treponema Denticola Pure Lengt | 1e-08 | ||
| 3rgg_A | 159 | Crystal Structure Of Treponema Denticola Pure Bound | 2e-08 | ||
| 1qcz_A | 169 | Crystal Structure Of E. Coli Pure, An Unusual Mutas | 5e-08 | ||
| 2ate_A | 169 | Structure Of The Complex Of Pure With Nitroair Leng | 5e-08 | ||
| 1d7a_A | 161 | Crystal Structure Of E. Coli Pure-Mononucleotide Co | 6e-08 | ||
| 3kuu_A | 174 | Structure Of The Pure Phosphoribosylaminoimidazole | 6e-08 | ||
| 3trh_A | 169 | Structure Of A Phosphoribosylaminoimidazole Carboxy | 3e-06 |
| >pdb|1O4V|A Chain A, Crystal Structure Of The Catalytic Subunit Of A Phosphoribosylaminoimidazole Mutase (Tm0446) From Thermotoga Maritima At 1.77 A Resolution Length = 183 | Back alignment and structure |
|
| >pdb|3LP6|A Chain A, Crystal Structure Of Rv3275c-E60a From Mycobacterium Tubercu 1.7a Resolution Length = 174 | Back alignment and structure |
| >pdb|4B4K|A Chain A, Crystal Structure Of Bacillus Anthracis Pure Length = 181 | Back alignment and structure |
| >pdb|1XMP|A Chain A, Crystal Structure Of Pure (Ba0288) From Bacillus Anthracis At 1.8 Resolution Length = 170 | Back alignment and structure |
| >pdb|3OPQ|A Chain A, Phosphoribosylaminoimidazole Carboxylase With Fructose-6-Phosphate Bound To The Central Channel Of The Octameric Protein Structure. Length = 163 | Back alignment and structure |
| >pdb|3OOW|A Chain A, Octameric Structure Of The Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Francisella Tularensis Subsp. Tularensis Schu S4. Length = 166 | Back alignment and structure |
| >pdb|4GRD|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Burkholderia Cenocepacia J2315 Length = 173 | Back alignment and structure |
| >pdb|1U11|A Chain A, Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophile Acetobacter Aceti Length = 182 | Back alignment and structure |
| >pdb|2FW1|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8.5 Length = 183 | Back alignment and structure |
| >pdb|2FWA|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H89n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 7 Length = 183 | Back alignment and structure |
| >pdb|2FW6|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) Mutant H59n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 5.4 Length = 183 | Back alignment and structure |
| >pdb|2FWB|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 | Back alignment and structure |
| >pdb|2FW9|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 | Back alignment and structure |
| >pdb|2FWI|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59d, From The Acidophilic Bacterium Acetobacter Aceti, Complexed With 5-aminoimidazole Ribonucleotide (air) Length = 183 | Back alignment and structure |
| >pdb|2YWX|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Methanocaldococcus Jannaschii Length = 157 | Back alignment and structure |
| >pdb|2FW8|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89g From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 | Back alignment and structure |
| >pdb|3ORS|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Mutase From Staphylococcus Aureus Length = 163 | Back alignment and structure |
| >pdb|2NSL|A Chain A, E. Coli Pure H45n Mutant Complexed With Cair Length = 169 | Back alignment and structure |
| >pdb|2NSH|A Chain A, E. Coli Pure H45q Mutant Complexed With Nitro-Air Length = 169 | Back alignment and structure |
| >pdb|2H31|A Chain A, Crystal Structure Of Human Paics, A Bifunctional Carboxylase And Synthetase In Purine Biosynthesis Length = 425 | Back alignment and structure |
| >pdb|3RG8|A Chain A, Crystal Structure Of Treponema Denticola Pure Length = 159 | Back alignment and structure |
| >pdb|3RGG|A Chain A, Crystal Structure Of Treponema Denticola Pure Bound To Air Length = 159 | Back alignment and structure |
| >pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusual Mutase That Catalyzes The Conversion Of N5-carboxyaminoimidazole Ribonucleotide (n5-cair) To 4-carboxyaminoimidazole Ribonucleotide (cair) In The Purine Biosynthetic Pathway Length = 169 | Back alignment and structure |
| >pdb|2ATE|A Chain A, Structure Of The Complex Of Pure With Nitroair Length = 169 | Back alignment and structure |
| >pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucleotide Complex. Length = 161 | Back alignment and structure |
| >pdb|3KUU|A Chain A, Structure Of The Pure Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Yersinia Pestis Length = 174 | Back alignment and structure |
| >pdb|3TRH|A Chain A, Structure Of A Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit (Pure) From Coxiella Burnetii Length = 169 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 196 | |||
| 1o4v_A | 183 | Phosphoribosylaminoimidazole mutase PURE; structur | 1e-44 | |
| 3lp6_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti; | 3e-44 | |
| 3rg8_A | 159 | Phosphoribosylaminoimidazole carboxylase, PURE PR; | 7e-42 | |
| 3trh_A | 169 | Phosphoribosylaminoimidazole carboxylase carboxylt | 8e-39 | |
| 3ors_A | 163 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 1e-38 | |
| 1xmp_A | 170 | PURE, phosphoribosylaminoimidazole carboxylase; pu | 6e-38 | |
| 4b4k_A | 181 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 8e-38 | |
| 2ywx_A | 157 | Phosphoribosylaminoimidazole carboxylase catalyti; | 1e-37 | |
| 1u11_A | 182 | PURE (N5-carboxyaminoimidazole ribonucleotide MUT; | 3e-37 | |
| 3oow_A | 166 | Phosphoribosylaminoimidazole carboxylase,catalyic; | 4e-37 | |
| 3kuu_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti | 2e-36 | |
| 2h31_A | 425 | Multifunctional protein ADE2; alpha-beta-alpha, li | 2e-33 |
| >1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Length = 183 | Back alignment and structure |
|---|
Score = 145 bits (367), Expect = 1e-44
Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 1/149 (0%)
Query: 49 AADAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGI 108
P VGIIM SD DLPVM AA L +FG+ YEI I+ H+ YA +A+ERGI
Sbjct: 10 HHHVPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGI 69
Query: 109 KIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSI-RMPSHVQVASVPRNN 167
++II G G AHL G+ A+ + + VI VP+ + + D + SI +MP V VA+V NN
Sbjct: 70 EVIIAGAGGAAHLPGMVASITHLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAINN 129
Query: 168 AKNAALYAVKVLGIADEDLLERIRKYVEE 196
AKNA + A +LGI ++ ++++Y E
Sbjct: 130 AKNAGILAASILGIKYPEIARKVKEYKER 158
|
| >3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Length = 174 | Back alignment and structure |
|---|
| >3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} PDB: 3rgg_A* Length = 159 | Back alignment and structure |
|---|
| >3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Length = 169 | Back alignment and structure |
|---|
| >3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Length = 163 | Back alignment and structure |
|---|
| >1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Length = 170 | Back alignment and structure |
|---|
| >4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Length = 181 | Back alignment and structure |
|---|
| >2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Length = 157 | Back alignment and structure |
|---|
| >1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Length = 182 | Back alignment and structure |
|---|
| >3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} PDB: 3opq_A* Length = 166 | Back alignment and structure |
|---|
| >3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Length = 174 | Back alignment and structure |
|---|
| >2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| 3ors_A | 163 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 100.0 | |
| 3trh_A | 169 | Phosphoribosylaminoimidazole carboxylase carboxylt | 100.0 | |
| 3lp6_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti; | 100.0 | |
| 3kuu_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti | 100.0 | |
| 1xmp_A | 170 | PURE, phosphoribosylaminoimidazole carboxylase; pu | 100.0 | |
| 3oow_A | 166 | Phosphoribosylaminoimidazole carboxylase,catalyic; | 100.0 | |
| 1o4v_A | 183 | Phosphoribosylaminoimidazole mutase PURE; structur | 100.0 | |
| 1u11_A | 182 | PURE (N5-carboxyaminoimidazole ribonucleotide MUT; | 100.0 | |
| 4grd_A | 173 | N5-CAIR mutase, phosphoribosylaminoimidazole carbo | 100.0 | |
| 4b4k_A | 181 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 100.0 | |
| 3rg8_A | 159 | Phosphoribosylaminoimidazole carboxylase, PURE PR; | 100.0 | |
| 2ywx_A | 157 | Phosphoribosylaminoimidazole carboxylase catalyti; | 100.0 | |
| 2h31_A | 425 | Multifunctional protein ADE2; alpha-beta-alpha, li | 100.0 | |
| 3uhj_A | 387 | Probable glycerol dehydrogenase; structural genomi | 97.38 | |
| 1jq5_A | 370 | Glycerol dehydrogenase; oxidoreductase, NAD, glyce | 97.25 | |
| 3ce9_A | 354 | Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin | 97.01 | |
| 3bfj_A | 387 | 1,3-propanediol oxidoreductase; opportunistic path | 96.97 | |
| 1o2d_A | 371 | Alcohol dehydrogenase, iron-containing; TM0920, st | 96.93 | |
| 3ox4_A | 383 | Alcohol dehydrogenase 2; iron, NAD, oxidoreductase | 96.9 | |
| 3okf_A | 390 | 3-dehydroquinate synthase; structural genomics, ce | 96.88 | |
| 3hl0_A | 353 | Maleylacetate reductase; structur genomics, PSI-2, | 96.82 | |
| 1sg6_A | 393 | Pentafunctional AROM polypeptide; shikimate pathwa | 96.81 | |
| 1vlj_A | 407 | NADH-dependent butanol dehydrogenase; TM0820, stru | 96.7 | |
| 1ta9_A | 450 | Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosa | 96.7 | |
| 3jzd_A | 358 | Iron-containing alcohol dehydrogenase; YP_298327.1 | 96.6 | |
| 1rrm_A | 386 | Lactaldehyde reductase; structural genomics, dehyd | 96.55 | |
| 2q5c_A | 196 | NTRC family transcriptional regulator; structural | 96.44 | |
| 1oj7_A | 408 | Hypothetical oxidoreductase YQHD; structural genom | 96.21 | |
| 2pju_A | 225 | Propionate catabolism operon regulatory protein; s | 96.15 | |
| 2gru_A | 368 | 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2 | 96.14 | |
| 3l49_A | 291 | ABC sugar (ribose) transporter, periplasmic substr | 95.99 | |
| 3qbe_A | 368 | 3-dehydroquinate synthase; shikimate pathway, myco | 95.9 | |
| 3egc_A | 291 | Putative ribose operon repressor; structural genom | 95.81 | |
| 3m9w_A | 313 | D-xylose-binding periplasmic protein; xylose bindi | 95.79 | |
| 1xah_A | 354 | Sadhqs, 3-dehydroquinate synthase; shikimate pathw | 95.71 | |
| 3iv7_A | 364 | Alcohol dehydrogenase IV; NP_602249.1, iron-contai | 95.71 | |
| 1ujn_A | 348 | Dehydroquinate synthase; riken structu genomics/pr | 95.52 | |
| 3kke_A | 303 | LACI family transcriptional regulator; structural | 95.42 | |
| 3dbi_A | 338 | Sugar-binding transcriptional regulator, LACI FAM; | 94.92 | |
| 3o74_A | 272 | Fructose transport system repressor FRUR; dual tra | 94.81 | |
| 3h5o_A | 339 | Transcriptional regulator GNTR; transcription regu | 94.67 | |
| 3gv0_A | 288 | Transcriptional regulator, LACI family; transcript | 94.52 | |
| 3k4h_A | 292 | Putative transcriptional regulator; structural gen | 94.42 | |
| 2o20_A | 332 | Catabolite control protein A; CCPA, transcriptiona | 94.38 | |
| 2rjo_A | 332 | Twin-arginine translocation pathway signal protei; | 94.33 | |
| 1kq3_A | 376 | Glycerol dehydrogenase; structural genomics, joint | 94.27 | |
| 2rgy_A | 290 | Transcriptional regulator, LACI family; 11011J, NY | 94.24 | |
| 3clh_A | 343 | 3-dehydroquinate synthase; shikimate pathway, arom | 94.13 | |
| 3ctp_A | 330 | Periplasmic binding protein/LACI transcriptional; | 94.09 | |
| 3miz_A | 301 | Putative transcriptional regulator protein, LACI f | 93.95 | |
| 3l6u_A | 293 | ABC-type sugar transport system periplasmic compo; | 93.93 | |
| 1dbq_A | 289 | Purine repressor; transcription regulation, DNA-bi | 93.88 | |
| 3k9c_A | 289 | Transcriptional regulator, LACI family protein; PS | 93.86 | |
| 3jy6_A | 276 | Transcriptional regulator, LACI family; NYSGXRC, P | 93.85 | |
| 3bbl_A | 287 | Regulatory protein of LACI family; protein structu | 93.77 | |
| 3huu_A | 305 | Transcription regulator like protein; PSI-II, NYSG | 93.74 | |
| 3c3k_A | 285 | Alanine racemase; structural genomics, protein str | 93.73 | |
| 3bil_A | 348 | Probable LACI-family transcriptional regulator; st | 93.61 | |
| 3o1i_D | 304 | Periplasmic protein TORT; ligand free, two compone | 93.56 | |
| 3qk7_A | 294 | Transcriptional regulators; structural genomics, N | 93.55 | |
| 3brs_A | 289 | Periplasmic binding protein/LACI transcriptional; | 93.55 | |
| 3g1w_A | 305 | Sugar ABC transporter; sugar-binding protein, baci | 93.53 | |
| 3rf7_A | 375 | Iron-containing alcohol dehydrogenase; structural | 93.44 | |
| 2h3h_A | 313 | Sugar ABC transporter, periplasmic sugar-binding p | 93.42 | |
| 2fn9_A | 290 | Ribose ABC transporter, periplasmic ribose-bindin; | 93.38 | |
| 2iks_A | 293 | DNA-binding transcriptional dual regulator; escher | 93.14 | |
| 3jvd_A | 333 | Transcriptional regulators; structural genomics, P | 93.08 | |
| 3d8u_A | 275 | PURR transcriptional regulator; APC91343.1, vibrio | 93.07 | |
| 1qpz_A | 340 | PURA, protein (purine nucleotide synthesis repress | 92.91 | |
| 3hcw_A | 295 | Maltose operon transcriptional repressor; RNA-bind | 92.83 | |
| 3h75_A | 350 | Periplasmic sugar-binding domain protein; protein | 92.79 | |
| 3s99_A | 356 | Basic membrane lipoprotein; ssgcid, structural gen | 92.59 | |
| 3rot_A | 297 | ABC sugar transporter, periplasmic sugar binding; | 92.58 | |
| 3lft_A | 295 | Uncharacterized protein; ABC, ATPase, cassette, L- | 92.56 | |
| 3gbv_A | 304 | Putative LACI-family transcriptional regulator; NY | 92.44 | |
| 3gyb_A | 280 | Transcriptional regulators (LACI-family transcript | 92.2 | |
| 1mjh_A | 162 | Protein (ATP-binding domain of protein MJ0577); hy | 92.2 | |
| 3e3m_A | 355 | Transcriptional regulator, LACI family; structural | 91.93 | |
| 3hs3_A | 277 | Ribose operon repressor; PSI-II, NYSGXRC, periplas | 91.89 | |
| 3clk_A | 290 | Transcription regulator; 11017J, PSI-II, NYSGXRC, | 91.85 | |
| 3ksm_A | 276 | ABC-type sugar transport system, periplasmic COMP; | 91.84 | |
| 2vk2_A | 306 | YTFQ, ABC transporter periplasmic-binding protein | 91.76 | |
| 3kjx_A | 344 | Transcriptional regulator, LACI family; LACL famil | 91.49 | |
| 2qh8_A | 302 | Uncharacterized protein; conserved domain protein, | 91.46 | |
| 1jye_A | 349 | Lactose operon repressor; gene regulation, protein | 91.23 | |
| 1jx6_A | 342 | LUXP protein; protein-ligand complex, signaling pr | 91.08 | |
| 1tjy_A | 316 | Sugar transport protein; protein-ligand complex, s | 91.08 | |
| 3d02_A | 303 | Putative LACI-type transcriptional regulator; peri | 91.04 | |
| 2fqx_A | 318 | Membrane lipoprotein TMPC; ABC transport system, l | 91.03 | |
| 2x7x_A | 325 | Sensor protein; transferase, sensor histidine kina | 90.9 | |
| 1tq8_A | 163 | Hypothetical protein RV1636; MTCY01B2.28, structur | 90.77 | |
| 2dri_A | 271 | D-ribose-binding protein; sugar transport; HET: RI | 90.46 | |
| 2fep_A | 289 | Catabolite control protein A; CCPA, transcriptiona | 90.44 | |
| 3brq_A | 296 | HTH-type transcriptional regulator ASCG; transcrip | 90.39 | |
| 2qu7_A | 288 | Putative transcriptional regulator; structural gen | 90.37 | |
| 3tb6_A | 298 | Arabinose metabolism transcriptional repressor; tr | 89.6 | |
| 1f0k_A | 364 | MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe | 89.5 | |
| 8abp_A | 306 | L-arabinose-binding protein; binding proteins; HET | 89.26 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 89.22 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 88.95 | |
| 3idf_A | 138 | USP-like protein; universal, stress, PSI, MCSG, st | 88.95 | |
| 2qv7_A | 337 | Diacylglycerol kinase DGKB; alpha-beta domain 1, b | 88.83 | |
| 2fvy_A | 309 | D-galactose-binding periplasmic protein; periplasm | 88.73 | |
| 2dum_A | 170 | Hypothetical protein PH0823; conserved hypothetica | 88.55 | |
| 2hsg_A | 332 | Glucose-resistance amylase regulator; CCPA, transc | 88.4 | |
| 3uug_A | 330 | Multiple sugar-binding periplasmic receptor CHVE; | 88.33 | |
| 3lkv_A | 302 | Uncharacterized conserved domain protein; ATPase b | 87.99 | |
| 3dlo_A | 155 | Universal stress protein; unknown function, struct | 87.48 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 87.05 | |
| 3s3t_A | 146 | Nucleotide-binding protein, universal stress PROT | 86.93 | |
| 2gm3_A | 175 | Unknown protein; AT3G01520, putative ethylene-resp | 86.83 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 86.11 | |
| 2dgd_A | 223 | 223AA long hypothetical arylmalonate decarboxylas; | 85.78 | |
| 2ioy_A | 283 | Periplasmic sugar-binding protein; ribose binding | 85.7 | |
| 1byk_A | 255 | Protein (trehalose operon repressor); LACI family, | 85.24 | |
| 3fg9_A | 156 | Protein of universal stress protein USPA family; A | 85.01 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 83.5 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 83.29 | |
| 2h0a_A | 276 | TTHA0807, transcriptional regulator; repressor, st | 82.9 | |
| 1gud_A | 288 | ALBP, D-allose-binding periplasmic protein; peripl | 82.65 | |
| 2l2q_A | 109 | PTS system, cellobiose-specific IIB component (CE; | 82.29 | |
| 3s81_A | 268 | Putative aspartate racemase; structural genomics, | 81.99 | |
| 2xed_A | 273 | Putative maleate isomerase; nicotinic acid catabol | 81.26 | |
| 1efv_B | 255 | Electron transfer flavoprotein; electron transport | 80.51 | |
| 2o6l_A | 170 | UDP-glucuronosyltransferase 2B7; drug metabolism, | 80.22 | |
| 3g85_A | 289 | Transcriptional regulator (LACI family); transcrip | 80.07 | |
| 1efp_B | 252 | ETF, protein (electron transfer flavoprotein); ele | 80.06 |
| >3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.3e-61 Score=394.27 Aligned_cols=146 Identities=34% Similarity=0.577 Sum_probs=142.5
Q ss_pred CCCeEEEEEcCCCCHHHHHHHHHHHHHhCCCeEEEEEcccCCchHHHHHHHHHhhCCCeEEEEecCCCCchhHhhhhccC
Q 029271 51 DAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQ 130 (196)
Q Consensus 51 ~~~~V~IimGS~SD~~~~~~~~~~l~~~gi~~ev~V~SaHR~p~~~~~~~~~~e~~~~~V~IavAG~sa~L~gvvA~~t~ 130 (196)
+.++|+|||||+||+++|+|++++|++||++||++|+|+||+|+++.+|+++++++|++|||++||++||||||+||+|+
T Consensus 2 ~~~~V~Iimgs~SD~~v~~~a~~~l~~~gi~~ev~V~SaHR~p~~~~~~~~~a~~~g~~ViIa~AG~aa~LpgvvA~~t~ 81 (163)
T 3ors_A 2 NAMKVAVIMGSSSDWKIMQESCNMLDYFEIPYEKQVVSAHRTPKMMVQFASEARERGINIIIAGAGGAAHLPGMVASLTT 81 (163)
T ss_dssp -CCCEEEEESCGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEEESSCCHHHHHHHHCS
T ss_pred CCCeEEEEECcHHHHHHHHHHHHHHHHcCCCEEEEEECCcCCHHHHHHHHHHHHhCCCcEEEEECCchhhhHHHHHhccC
Confidence 35789999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CcEEEecCCCCCCChhh-hhhhhcCCCCCeeeEEecC--ChhhHHHHHHHHHccCCHHHHHHHHHHHhC
Q 029271 131 ILVIRVPLLSEDWSEDD-VINSIRMPSHVQVASVPRN--NAKNAALYAVKVLGIADEDLLERIRKYVEE 196 (196)
Q Consensus 131 ~PVIgvP~~~~~~~G~D-LlS~lqmPsGvpvatV~I~--~~~nAA~~AaqILa~~d~~l~~kl~~~r~~ 196 (196)
+||||||+++++++|+| ||||+|||+|+||+||+|| |++|||++|+|||+++|++||+||++||++
T Consensus 82 ~PVIgVP~~~~~l~G~dsLlS~vqmp~GvPVatV~I~~a~~~nAa~lAa~Il~~~d~~l~~kl~~~r~~ 150 (163)
T 3ors_A 82 LPVIGVPIETKSLKGIDSLLSIVQMPGGIPVATTAIGAAGAKNAGILAARMLSIQNPSLVEKLNQYESS 150 (163)
T ss_dssp SCEEEEEECCTTTTTHHHHHHHHTCCTTSCCEECCSTHHHHHHHHHHHHHHHHTTCTHHHHHHHHHHHH
T ss_pred CCEEEeeCCCCCCCCHHHHHHHhhCCCCCceEEEEcCCcccHHHHHHHHHHHhCCCHHHHHHHHHHHHH
Confidence 99999999999999999 9999999999999999999 999999999999999999999999999973
|
| >3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 | Back alignment and structure |
|---|
| >3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* | Back alignment and structure |
|---|
| >1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 | Back alignment and structure |
|---|
| >3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* | Back alignment and structure |
|---|
| >1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 | Back alignment and structure |
|---|
| >1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A | Back alignment and structure |
|---|
| >4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* | Back alignment and structure |
|---|
| >2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* | Back alignment and structure |
|---|
| >3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* | Back alignment and structure |
|---|
| >3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* | Back alignment and structure |
|---|
| >3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor} | Back alignment and structure |
|---|
| >3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1sg6_A Pentafunctional AROM polypeptide; shikimate pathway, aromatic amino acid biosynthesis, DHQS, O form J, domain movement, cyclase, lyase; HET: NAD; 1.70A {Emericella nidulans} SCOP: e.22.1.1 PDB: 1nr5_A* 1nrx_A* 1nua_A 1nva_A* 1nvb_A* 1nvd_A* 1nve_A* 1nvf_A* 1dqs_A* | Back alignment and structure |
|---|
| >1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 | Back alignment and structure |
|---|
| >1ta9_A Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural GENO joint center for structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* | Back alignment and structure |
|---|
| >2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 | Back alignment and structure |
|---|
| >2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 | Back alignment and structure |
|---|
| >2gru_A 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* | Back alignment and structure |
|---|
| >3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3qbe_A 3-dehydroquinate synthase; shikimate pathway, mycobacte tuberculosis, nicotinamide adenine dinucleotide (NAD)-depen enzyme; 2.07A {Mycobacterium tuberculosis} PDB: 3qbd_A | Back alignment and structure |
|---|
| >3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* | Back alignment and structure |
|---|
| >1xah_A Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A* | Back alignment and structure |
|---|
| >3iv7_A Alcohol dehydrogenase IV; NP_602249.1, iron-containing alcohol dehydrogenase, structur genomics, joint center for structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1ujn_A Dehydroquinate synthase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.80A {Thermus thermophilus} SCOP: e.22.1.1 | Back alignment and structure |
|---|
| >3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* | Back alignment and structure |
|---|
| >3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} | Back alignment and structure |
|---|
| >2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} | Back alignment and structure |
|---|
| >2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >1kq3_A Glycerol dehydrogenase; structural genomics, joint center FO structural genomics, JCSG, protein structure initiative, PS oxidoreductase; 1.50A {Thermotoga maritima} SCOP: e.22.1.2 | Back alignment and structure |
|---|
| >2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >3clh_A 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, DHQS, amino-acid biosynthesis, cytoplasm, lyase, NAD; HET: NAD; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} | Back alignment and structure |
|---|
| >3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} | Back alignment and structure |
|---|
| >3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A | Back alignment and structure |
|---|
| >3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} | Back alignment and structure |
|---|
| >3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} | Back alignment and structure |
|---|
| >3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C | Back alignment and structure |
|---|
| >3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} | Back alignment and structure |
|---|
| >3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3rf7_A Iron-containing alcohol dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: NAD EPE; 2.12A {Shewanella denitrificans} | Back alignment and structure |
|---|
| >2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* | Back alignment and structure |
|---|
| >2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* | Back alignment and structure |
|---|
| >2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... | Back alignment and structure |
|---|
| >3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} | Back alignment and structure |
|---|
| >3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} | Back alignment and structure |
|---|
| >2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... | Back alignment and structure |
|---|
| >1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* | Back alignment and structure |
|---|
| >1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* | Back alignment and structure |
|---|
| >3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* | Back alignment and structure |
|---|
| >2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* | Back alignment and structure |
|---|
| >2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* | Back alignment and structure |
|---|
| >3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* | Back alignment and structure |
|---|
| >8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A | Back alignment and structure |
|---|
| >2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* | Back alignment and structure |
|---|
| >2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* | Back alignment and structure |
|---|
| >3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* | Back alignment and structure |
|---|
| >3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 | Back alignment and structure |
|---|
| >3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* | Back alignment and structure |
|---|
| >2l2q_A PTS system, cellobiose-specific IIB component (CE; cellobiose-specific phosphotransferase IIB component, struct genomics; NMR {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A | Back alignment and structure |
|---|
| >2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A | Back alignment and structure |
|---|
| >1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* | Back alignment and structure |
|---|
| >2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 196 | ||||
| d1o4va_ | 169 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 2e-33 | |
| d1qcza_ | 163 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 3e-33 | |
| d1xmpa_ | 155 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 5e-31 | |
| d1u11a_ | 159 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 5e-30 |
| >d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Length = 169 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) species: Thermotoga maritima [TaxId: 2336]
Score = 114 bits (288), Expect = 2e-33
Identities = 62/145 (42%), Positives = 90/145 (62%), Gaps = 1/145 (0%)
Query: 53 PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIII 112
P VGIIM SD DLPVM AA L +FG+ YEI I+ H+ YA +A+ERGI++II
Sbjct: 1 PRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVII 60
Query: 113 VGDGVEAHLSGVAAANSQILVIRVPLLSEDWS-EDDVINSIRMPSHVQVASVPRNNAKNA 171
G G AHL G+ A+ + + VI VP+ + + D + + ++MP V VA+V NNAKNA
Sbjct: 61 AGAGGAAHLPGMVASITHLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAINNAKNA 120
Query: 172 ALYAVKVLGIADEDLLERIRKYVEE 196
+ A +LGI ++ ++++Y E
Sbjct: 121 GILAASILGIKYPEIARKVKEYKER 145
|
| >d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Length = 163 | Back information, alignment and structure |
|---|
| >d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Length = 155 | Back information, alignment and structure |
|---|
| >d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Length = 159 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| d1o4va_ | 169 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 100.0 | |
| d1u11a_ | 159 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 100.0 | |
| d1xmpa_ | 155 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 100.0 | |
| d1qcza_ | 163 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 100.0 | |
| d1jq5a_ | 366 | Glycerol dehydrogenase {Bacillus stearothermophilu | 97.46 | |
| d1o2da_ | 359 | Alcohol dehydrogenase TM0920 {Thermotoga maritima | 96.86 | |
| d1vlja_ | 398 | NADH-dependent butanol dehydrogenase A (TM0820) {T | 96.48 | |
| d1rrma_ | 385 | Lactaldehyde reductase FucO {Escherichia coli [Tax | 95.93 | |
| d2dria_ | 271 | D-ribose-binding protein {Escherichia coli, strain | 95.89 | |
| d2bona1 | 295 | Lipid kinase YegS {Escherichia coli [TaxId: 562]} | 95.5 | |
| d2pjua1 | 186 | Propionate catabolism operon regulatory protein Pr | 95.33 | |
| d2nzug1 | 275 | Glucose-resistance amylase regulator CcpA, C-termi | 95.1 | |
| d1kq3a_ | 364 | Glycerol dehydrogenase {Thermotoga maritima [TaxId | 94.58 | |
| d1oj7a_ | 390 | Hypothetical oxidoreductase yqhD {Escherichia coli | 93.44 | |
| d1tjya_ | 316 | AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 | 93.06 | |
| d1dbqa_ | 282 | Purine repressor (PurR), C-terminal domain {Escher | 92.12 | |
| d1sg6a_ | 389 | Dehydroquinate synthase, DHQS {Aspergillus nidulan | 91.84 | |
| d1jx6a_ | 338 | Quorum-sensing signal (autoinducer-2) binding prot | 91.27 | |
| d1byka_ | 255 | Trehalose repressor, C-terminal domain {Escherichi | 91.26 | |
| d1guda_ | 288 | D-allose-binding protein {Escherichia coli [TaxId: | 91.1 | |
| d2qv7a1 | 312 | Diacylglycerol kinase DgkB {Staphylococcus aureus | 90.63 | |
| d1mjha_ | 160 | "Hypothetical" protein MJ0577 {Archaeon Methanococ | 89.82 | |
| d2gm3a1 | 171 | Putative ethylene-responsive protein AT3g01520/F4P | 88.19 | |
| d1ujna_ | 347 | Dehydroquinate synthase, DHQS {Thermus thermophilu | 88.08 | |
| d1utaa_ | 77 | Cell division protein FtsN {Escherichia coli [TaxI | 88.03 | |
| d8abpa_ | 305 | L-arabinose-binding protein {Escherichia coli [Tax | 86.85 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 85.39 | |
| d2fvya1 | 305 | Galactose/glucose-binding protein {Escherichia col | 85.31 | |
| d1gpua3 | 146 | Transketolase (TK), C-domain {Baker's yeast (Sacch | 83.63 | |
| d1pfka_ | 320 | ATP-dependent phosphofructokinase {Escherichia col | 82.75 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 82.75 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 82.5 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 82.05 | |
| d1v4va_ | 373 | UDP-N-acetylglucosamine 2-epimerase {Thermus therm | 80.92 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 80.58 |
| >d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) species: Thermotoga maritima [TaxId: 2336]
Probab=100.00 E-value=5.7e-58 Score=375.87 Aligned_cols=144 Identities=43% Similarity=0.705 Sum_probs=141.9
Q ss_pred CeEEEEEcCCCCHHHHHHHHHHHHHhCCCeEEEEEcccCCchHHHHHHHHHhhCCCeEEEEecCCCCchhHhhhhccCCc
Q 029271 53 PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQIL 132 (196)
Q Consensus 53 ~~V~IimGS~SD~~~~~~~~~~l~~~gi~~ev~V~SaHR~p~~~~~~~~~~e~~~~~V~IavAG~sa~L~gvvA~~t~~P 132 (196)
|+|+|||||+||+++++|+.++|++|||+|+++|.|+||+|+++++|++++++++++|||++||+++|||||+||+|++|
T Consensus 1 PkV~Ii~Gs~SD~~~~~~a~~~L~~~gi~~~~~v~saHr~p~rl~~~~~~~~~~~~~viIa~AG~aa~LpgvvA~~t~~P 80 (169)
T d1o4va_ 1 PRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVIIAGAGGAAHLPGMVASITHLP 80 (169)
T ss_dssp CEEEEEESCGGGHHHHHHHHHHHHHTTCEEEEEECCTTTCHHHHHHHHHHTTTTTCCEEEEEEESSCCHHHHHHHHCSSC
T ss_pred CeEEEEECcHhhHHHHHHHHHHHHHcCCcEEEEEeeeecCHHHHHHHHHHHHhcCCeEEEEeecCCcCchHHHHHhccee
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEecCCCCCCChhh-hhhhhcCCCCCeeeEEecCChhhHHHHHHHHHccCCHHHHHHHHHHHhC
Q 029271 133 VIRVPLLSEDWSEDD-VINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE 196 (196)
Q Consensus 133 VIgvP~~~~~~~G~D-LlS~lqmPsGvpvatV~I~~~~nAA~~AaqILa~~d~~l~~kl~~~r~~ 196 (196)
|||||++++.++|+| ||||+|||+|+||+||||||++|||++|+|||+++|++||+||++||++
T Consensus 81 VIgvP~~~~~~~G~daLlS~lqmp~gvpVatV~Id~~~nAA~~A~~Il~l~d~~i~~kl~~~r~~ 145 (169)
T d1o4va_ 81 VIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAINNAKNAGILAASILGIKYPEIARKVKEYKER 145 (169)
T ss_dssp EEEEEECCTTTTTHHHHHHHHTCCTTCCCEECCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred EEecccccccCccHHHHHHhccCCccCCceeeecCchHHHHHHHHHHHhCCCHHHHHHHHHHHHH
Confidence 999999999999999 9999999999999999999999999999999999999999999999974
|
| >d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} | Back information, alignment and structure |
|---|
| >d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sg6a_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ujna_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpua3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|