Citrus Sinensis ID: 030283


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MKGAKGKGAARVSQEALKPNDRKVGKRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKSEYGKKMNAYNKKQDGDEASDKSKSEVNDEDEASGEEEHQLEPEPEPEQDEDEEVEEDEDDEEDDDD
ccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHcccccccccccccccHHHcccccccccccc
ccccHHHHHHccHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEcHHHcHHHHHcccccccHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHccccccccccHHHcccccccccccccccccccccccccccc
mkgakgkgaarvsqealkpndrkvgkRKAATAkldsgskrqgkrekkakkdpnkpkrppsaFFVFLEEFRKTFkkenpnvtaVSAVgkaaggkwksmspaekapyesKAEKLKSEYGKKMnaynkkqdgdeasdksksevndedeasgeeehqlepepepeqdedeeveededdeedddd
mkgakgkgaarvsqealkpndrkvgkrkaatakldsgskrqgkrekkakkdpnkpkrppsAFFVFLEEFRKTfkkenpnvtavsavgkaaggkwksmspaekapyeskAEKLKSEYGKKMnaynkkqdgdeasdkskseVNDEdeasgeeehqlepepepeqdedeeveededdeedddd
MKGAKGKGAARVSQEALKPNDRKVGKRKAATAKLDSGSkrqgkrekkakkdpnkpkrppSAFFVFLEEFRKTFKKENPNvtavsavgkaaggkwkSMSPAEKAPYESKAEKLKSEYGKKMNAYNKKQDGDEASDKSKSEVNDEDEASGeeehqlepepepeqdedeeveededdeedddd
************************************************************AFFVFLEEFRKTFK**********************************************************************************************************
*********************************************************PPSAFFVFLEEFRKTFK**NPN*TAVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKSEYGKK*************************************************************
********************************************************RPPSAFFVFLEEFRKTFKKENPNVTAVSAVG*************************KSEYGKKMNAYNK*******************************************************
*************************K**AATAKLDSGSKR*********KDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKSEYGKKMNAYNKK******************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGAKGKGAARVSQEALKPNDRKVGKRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKSEYGKKMNAYNKKQDGDEASDKSKSEVNDEDEASGEEEHQLEPEPEPEQDEDEEVEEDEDDEEDDDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
O49595178 High mobility group B pro yes no 0.805 0.814 0.693 5e-46
P40619144 HMG1/2-like protein OS=Ip N/A no 0.572 0.715 0.644 5e-30
O49596144 High mobility group B pro no no 0.544 0.680 0.676 2e-27
P26585152 HMG1/2-like protein OS=Gl no no 0.45 0.532 0.765 3e-27
Q42344138 High mobility group B pro no no 0.711 0.927 0.480 9e-27
P93047141 High mobility group B pro no no 0.588 0.751 0.618 7e-26
P40620149 HMG1/2-like protein OS=Vi N/A no 0.511 0.617 0.621 1e-24
P27347157 DNA-binding protein MNB1B N/A no 0.594 0.681 0.550 2e-24
P40621161 HMG1/2-like protein OS=Tr N/A no 0.594 0.664 0.523 7e-22
O49597125 High mobility group B pro no no 0.5 0.72 0.488 1e-18
>sp|O49595|HMGB1_ARATH High mobility group B protein 1 OS=Arabidopsis thaliana GN=HMGB1 PE=1 SV=1 Back     alignment and function desciption
 Score =  183 bits (465), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 122/150 (81%), Gaps = 5/150 (3%)

Query: 1   MKGAKGKGAARVSQEALKP-NDRKVGKRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPP 59
           MK AKGK   + ++EALKP +DRKVGKRKA   K    +KR+ ++EKKAKKDPNKPKR P
Sbjct: 1   MKTAKGKDKVKTTKEALKPVDDRKVGKRKAPAEK---PTKRETRKEKKAKKDPNKPKRAP 57

Query: 60  SAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKSEYGKK 119
           SAFFVFLE+FR TFKKENPNV AVSAVGKA G KWKSMS AEKAPYE KA K K+EY K+
Sbjct: 58  SAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSMSQAEKAPYEEKAAKRKAEYEKQ 117

Query: 120 MNAYNKK-QDGDEASDKSKSEVNDEDEASG 148
           M+AYNK  ++G + S+KS+SE+NDEDEASG
Sbjct: 118 MDAYNKNLEEGSDESEKSRSEINDEDEASG 147




Binds preferentially double-stranded DNA. Modulates general plant growth and stress tolerance. Confers sensitivity to salt and genotoxic (methyl methanesulfonate, MMS) stresses.
Arabidopsis thaliana (taxid: 3702)
>sp|P40619|HMGL_IPONI HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1 Back     alignment and function description
>sp|O49596|HMGB2_ARATH High mobility group B protein 2 OS=Arabidopsis thaliana GN=HMGB2 PE=1 SV=1 Back     alignment and function description
>sp|P26585|HMGL_SOYBN HMG1/2-like protein OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|Q42344|HMGB4_ARATH High mobility group B protein 4 OS=Arabidopsis thaliana GN=HMGB4 PE=1 SV=1 Back     alignment and function description
>sp|P93047|HMGB3_ARATH High mobility group B protein 3 OS=Arabidopsis thaliana GN=HMGB3 PE=1 SV=1 Back     alignment and function description
>sp|P40620|HMGL_VICFA HMG1/2-like protein OS=Vicia faba PE=2 SV=1 Back     alignment and function description
>sp|P27347|MNB1B_MAIZE DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1 Back     alignment and function description
>sp|P40621|HMGL_WHEAT HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|O49597|HMGB5_ARATH High mobility group B protein 5 OS=Arabidopsis thaliana GN=HMGB5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
255574381171 DNA-binding protein MNB1B, putative [Ric 0.8 0.842 0.754 1e-46
449461783169 PREDICTED: high mobility group B protein 0.811 0.863 0.710 2e-46
297819892185 hypothetical protein ARALYDRAFT_323737 [ 0.811 0.789 0.701 1e-45
42572635185 high mobility group protein B1 [Arabidop 0.811 0.789 0.695 3e-45
15231065178 high mobility group protein B1 [Arabidop 0.805 0.814 0.693 2e-44
312281849185 unnamed protein product [Thellungiella h 0.766 0.745 0.678 5e-41
334185909161 high mobility group protein B1 [Arabidop 0.766 0.857 0.678 2e-40
351725417169 uncharacterized protein LOC100305961 [Gl 0.805 0.857 0.710 9e-40
224112525176 high mobility group family [Populus tric 0.794 0.812 0.632 3e-39
407971018166 uncharacterized protein LOC100499704 [Gl 0.766 0.831 0.724 6e-39
>gi|255574381|ref|XP_002528104.1| DNA-binding protein MNB1B, putative [Ricinus communis] gi|223532493|gb|EEF34283.1| DNA-binding protein MNB1B, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (84%), Gaps = 7/151 (4%)

Query: 1   MKGAKGKGAARVSQEALKP-NDRKVGKRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPP 59
           MK +KG GAA+ S++ALKP +DRKVGKRKAA A +D  SK + KREKKAKKDPNKPKRPP
Sbjct: 1   MKNSKGTGAAKASKDALKPADDRKVGKRKAAAA-VDRSSKLKAKREKKAKKDPNKPKRPP 59

Query: 60  SAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKSEYGKK 119
           SAFFVFLEEFRKTFKKENP+VT+V+AVGKA G KWKSMS AEKAPYE+KA K K EYGK 
Sbjct: 60  SAFFVFLEEFRKTFKKENPSVTSVAAVGKAGGAKWKSMSSAEKAPYEAKAAKKKDEYGKL 119

Query: 120 MNAYNKKQ-----DGDEASDKSKSEVNDEDE 145
           MNAYNKKQ     DG+E SD+SKSEVNDED+
Sbjct: 120 MNAYNKKQESTADDGEEESDRSKSEVNDEDD 150




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449461783|ref|XP_004148621.1| PREDICTED: high mobility group B protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297819892|ref|XP_002877829.1| hypothetical protein ARALYDRAFT_323737 [Arabidopsis lyrata subsp. lyrata] gi|297323667|gb|EFH54088.1| hypothetical protein ARALYDRAFT_323737 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42572635|ref|NP_974413.1| high mobility group protein B1 [Arabidopsis thaliana] gi|222423104|dbj|BAH19531.1| AT3G51880 [Arabidopsis thaliana] gi|332645335|gb|AEE78856.1| high mobility group protein B1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15231065|ref|NP_190756.1| high mobility group protein B1 [Arabidopsis thaliana] gi|145332807|ref|NP_001078269.1| high mobility group protein B1 [Arabidopsis thaliana] gi|75274976|sp|O49595.1|HMGB1_ARATH RecName: Full=High mobility group B protein 1; AltName: Full=High mobility group protein A; Short=AtHMGalpha; Short=HMG alpha; AltName: Full=Nucleosome/chromatin assembly factor group D 01; Short=Nucleosome/chromatin assembly factor group D 1 gi|2832357|emb|CAA74400.1| HMG protein [Arabidopsis thaliana] gi|3068715|gb|AAC14415.1| unknown [Arabidopsis thaliana] gi|15912191|gb|AAL08229.1| At3g51880/ORF13 [Arabidopsis thaliana] gi|21360557|gb|AAM47475.1| At3g51880/ORF13 [Arabidopsis thaliana] gi|332645334|gb|AEE78855.1| high mobility group protein B1 [Arabidopsis thaliana] gi|332645336|gb|AEE78857.1| high mobility group protein B1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312281849|dbj|BAJ33790.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|334185909|ref|NP_001190062.1| high mobility group protein B1 [Arabidopsis thaliana] gi|332645337|gb|AEE78858.1| high mobility group protein B1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|351725417|ref|NP_001235556.1| uncharacterized protein LOC100305961 [Glycine max] gi|255627113|gb|ACU13901.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224112525|ref|XP_002316220.1| high mobility group family [Populus trichocarpa] gi|222865260|gb|EEF02391.1| high mobility group family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|407971018|ref|NP_001238631.1| uncharacterized protein LOC100499704 [Glycine max] gi|255625939|gb|ACU13314.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
TAIR|locus:505006135144 HMGB2 "high mobility group B2" 0.483 0.604 0.560 5.4e-23
TAIR|locus:2053893138 HMGB4 "high mobility group B4" 0.483 0.630 0.442 4.8e-17
TAIR|locus:2128003125 HMGB5 "high mobility group B5" 0.472 0.68 0.321 2.1e-10
ZFIN|ZDB-GENE-030131-341205 hmgb1a "high-mobility group bo 0.472 0.414 0.404 4.7e-09
TAIR|locus:2154433241 HMGB6 "high-mobility group box 0.466 0.348 0.337 1.1e-08
ZFIN|ZDB-GENE-050417-290198 hmgb3b "high-mobility group bo 0.472 0.429 0.348 2.6e-08
RGD|1559962209 RGD1559962 "similar to High mo 0.472 0.406 0.361 1.1e-07
UNIPROTKB|P40618202 HMGB3 "High mobility group pro 0.472 0.420 0.355 1.2e-07
UNIPROTKB|F1N927214 HMGB1 "High mobility group pro 0.472 0.397 0.368 2.2e-07
UNIPROTKB|Q9YH06215 HMG1 "High mobility group 1 pr 0.472 0.395 0.368 2.2e-07
TAIR|locus:505006135 HMGB2 "high mobility group B2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 235 (87.8 bits), Expect = 5.4e-23, Sum P(2) = 5.4e-23
 Identities = 51/91 (56%), Positives = 61/91 (67%)

Query:    60 SAFFVFLEEFRKTFKKENPNXXXXXXXXXXXXXXXXSMSPAEKAPYESKAEKLKSEYGKK 119
             SAFFVF+E+FR+TFKKENP                 S+S +EKAPY +KAEK K EY K 
Sbjct:    43 SAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKN 102

Query:   120 MNAYNKK-QDG---DEASDKSKSEVNDEDEA 146
             + AYNKK ++G   DE SDKS SEVNDED+A
Sbjct:   103 IKAYNKKLEEGPKEDEESDKSVSEVNDEDDA 133


GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0000785 "chromatin" evidence=TAS
GO:0003682 "chromatin binding" evidence=TAS
GO:0006333 "chromatin assembly or disassembly" evidence=RCA;TAS
GO:0030527 "structural constituent of chromatin" evidence=TAS
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0003677 "DNA binding" evidence=ISS;IDA
TAIR|locus:2053893 HMGB4 "high mobility group B4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128003 HMGB5 "high mobility group B5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-341 hmgb1a "high-mobility group box 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2154433 HMGB6 "high-mobility group box 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-290 hmgb3b "high-mobility group box 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1559962 RGD1559962 "similar to High mobility group protein 2 (HMG-2)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P40618 HMGB3 "High mobility group protein B3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N927 HMGB1 "High mobility group protein B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YH06 HMG1 "High mobility group 1 protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O49595HMGB1_ARATHNo assigned EC number0.69330.80550.8146yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 3e-16
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 3e-14
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 5e-13
smart0039870 smart00398, HMG, high mobility group 3e-11
COG5648211 COG5648, NHP6B, Chromatin-associated proteins cont 1e-10
PTZ0019994 PTZ00199, PTZ00199, high mobility group protein; P 3e-09
pfam0901169 pfam09011, DUF1898, Domain of unknown function (DU 8e-09
cd0138872 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I 2e-07
cd0138977 cd01389, MATA_HMG-box, MATA_HMG-box, class I membe 1e-06
pfam04147 809 pfam04147, Nop14, Nop14-like family 5e-04
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 8e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.001
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.002
pfam09184285 pfam09184, PPP4R2, PPP4R2 0.002
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
 Score = 69.2 bits (170), Expect = 3e-16
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 55  PKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKS 114
           PKRP SAFF+F +E R   K ENP +   + + K  G KWK++S  EK PYE KAEK K+
Sbjct: 1   PKRPLSAFFLFSQEQRAKLKAENPGLK-NAEISKILGEKWKNLSEEEKKPYEEKAEKEKA 59

Query: 115 EYGKKMNAYN 124
            Y K   AY 
Sbjct: 60  RYEKAYPAYK 69


Length = 69

>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional Back     alignment and domain information
>gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) Back     alignment and domain information
>gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|238685 cd01389, MATA_HMG-box, MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
PTZ0019994 high mobility group protein; Provisional 99.91
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.82
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.81
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.8
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.78
smart0039870 HMG high mobility group. 99.78
COG5648211 NHP6B Chromatin-associated proteins containing the 99.77
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.77
KOG038196 consensus HMG box-containing protein [General func 99.72
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.71
KOG0527 331 consensus HMG-box transcription factor [Transcript 99.67
KOG0526615 consensus Nucleosome-binding factor SPN, POB3 subu 99.6
KOG3248 421 consensus Transcription factor TCF-4 [Transcriptio 99.31
KOG4715 410 consensus SWI/SNF-related matrix-associated actin- 99.26
KOG0528511 consensus HMG-box transcription factor SOX5 [Trans 99.1
KOG2746 683 consensus HMG-box transcription factor Capicua and 98.56
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 98.16
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 96.8
COG5648211 NHP6B Chromatin-associated proteins containing the 96.71
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 96.33
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 95.41
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 94.52
PF04769201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 92.93
KOG3223221 consensus Uncharacterized conserved protein [Funct 92.56
TIGR03481198 HpnM hopanoid biosynthesis associated membrane pro 86.63
PRK15117211 ABC transporter periplasmic binding protein MlaC; 82.58
PF05494170 Tol_Tol_Ttg2: Toluene tolerance, Ttg2 ; InterPro: 80.09
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
Probab=99.91  E-value=7.3e-24  Score=153.09  Aligned_cols=85  Identities=44%  Similarity=0.694  Sum_probs=78.6

Q ss_pred             cccccccccCCCCCCCCCCCChHHHHHHHHHHHHHHhCCCCc-cHHHHHHHHHhhhcCCCchhhhhHHHHHHHHHHHHHH
Q 030283           40 RQGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVT-AVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKSEYGK  118 (180)
Q Consensus        40 kk~kk~kk~~kdp~~PKrP~sAy~lF~~e~r~~ik~e~P~~~-~~~eisk~l~e~Wk~Ls~eeK~~Y~~~A~~~k~~y~~  118 (180)
                      +.+++++++.+||++|+||+|||||||+++|..|..+||++. ++.+|+++||++|+.||+++|.+|+.+|..++.+|..
T Consensus         8 ~~~k~~~k~~kdp~~PKrP~sAY~~F~~~~R~~i~~~~P~~~~~~~evsk~ige~Wk~ls~eeK~~y~~~A~~dk~rY~~   87 (94)
T PTZ00199          8 VLVRKNKRKKKDPNAPKRALSAYMFFAKEKRAEIIAENPELAKDVAAVGKMVGEAWNKLSEEEKAPYEKKAQEDKVRYEK   87 (94)
T ss_pred             ccccccCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCcCCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHHH
Confidence            444555667899999999999999999999999999999985 4889999999999999999999999999999999999


Q ss_pred             HHHHHh
Q 030283          119 KMNAYN  124 (180)
Q Consensus       119 e~~~y~  124 (180)
                      +|.+|.
T Consensus        88 e~~~Y~   93 (94)
T PTZ00199         88 EKAEYA   93 (94)
T ss_pred             HHHHHh
Confidence            999996



>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>KOG0381 consensus HMG box-containing protein [General function prediction only] Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>KOG0527 consensus HMG-box transcription factor [Transcription] Back     alignment and domain information
>KOG0526 consensus Nucleosome-binding factor SPN, POB3 subunit [Transcription; Replication, recombination and repair; Chromatin structure and dynamics] Back     alignment and domain information
>KOG3248 consensus Transcription factor TCF-4 [Transcription] Back     alignment and domain information
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0528 consensus HMG-box transcription factor SOX5 [Transcription] Back     alignment and domain information
>KOG2746 consensus HMG-box transcription factor Capicua and related proteins [Transcription] Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>KOG3223 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM Back     alignment and domain information
>PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional Back     alignment and domain information
>PF05494 Tol_Tol_Ttg2: Toluene tolerance, Ttg2 ; InterPro: IPR008869 Toluene tolerance is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
1hme_A77 High mobility group protein fragment-B; DNA-bindin 7e-23
2lhj_A97 High mobility group protein homolog NHP1; structur 1e-22
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 1e-21
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 3e-21
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 1e-20
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 3e-20
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 3e-20
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 2e-19
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 2e-18
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 4e-18
1wgf_A90 Upstream binding factor 1; transcription factor, D 5e-18
2yrq_A173 High mobility group protein B1; HMG box domain, DN 9e-17
2yrq_A173 High mobility group protein B1; HMG box domain, DN 2e-12
1ckt_A71 High mobility group 1 protein; high-mobility group 4e-16
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 2e-15
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 2e-14
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 5e-14
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 5e-14
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 6e-13
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 6e-13
3tq6_A214 Transcription factor A, mitochondrial; transcripti 9e-13
3tq6_A214 Transcription factor A, mitochondrial; transcripti 1e-09
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 1e-12
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 1e-11
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 4e-11
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 4e-11
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 5e-11
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 1e-08
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 7e-11
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 1e-10
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 2e-10
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 5e-10
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 1e-09
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 6e-07
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 8e-07
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 3e-05
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
 Score = 85.8 bits (213), Expect = 7e-23
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 1/77 (1%)

Query: 50  KDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAEKAPYESKA 109
           KDPN PKRPPSAFF+F  E+R   K E+P ++ +  V K  G  W + +  +K PYE KA
Sbjct: 2   KDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLS-IGDVAKKLGEMWNNTAADDKQPYEKKA 60

Query: 110 EKLKSEYGKKMNAYNKK 126
            KLK +Y K + AY  K
Sbjct: 61  AKLKEKYEKDIAAYRAK 77


>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.91
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.91
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.9
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.9
2lhj_A97 High mobility group protein homolog NHP1; structur 99.89
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.89
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.89
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.89
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.88
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.88
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.88
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.88
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.88
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.87
1ckt_A71 High mobility group 1 protein; high-mobility group 99.87
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.86
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.86
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.85
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.85
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.85
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.85
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.85
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.85
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.84
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.84
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.84
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.84
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.83
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.83
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.81
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.81
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.81
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.77
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.76
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.76
2cto_A93 Novel protein; high mobility group box domain, hel 99.75
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.75
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.74
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.68
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
Probab=99.91  E-value=2.3e-24  Score=156.49  Aligned_cols=85  Identities=35%  Similarity=0.620  Sum_probs=80.2

Q ss_pred             ccccCCCCCCCCCCCChHHHHHHHHHHHHHHhCCCCccHHHHHHHHHhhhcCCCchhhhhHHHHHHHHHHHHHHHHHHHh
Q 030283           45 EKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKSEYGKKMNAYN  124 (180)
Q Consensus        45 ~kk~~kdp~~PKrP~sAy~lF~~e~r~~ik~e~P~~~~~~eisk~l~e~Wk~Ls~eeK~~Y~~~A~~~k~~y~~e~~~y~  124 (180)
                      ++++.+||++|+||+|||||||+++|..|+.+||+++ +.+|+++||++|++|++++|.+|.++|..++++|..+|..|+
T Consensus         8 ~kk~~kdp~~pKrP~say~lF~~~~r~~i~~~~P~~~-~~eisk~lg~~Wk~ls~eeK~~Y~~~A~~~k~~y~~e~~~Y~   86 (102)
T 2co9_A            8 KKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNAT-FGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYR   86 (102)
T ss_dssp             SCSSCCCCCSCCCCCCHHHHTHHHHHHHHHHHCTTSC-HHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCC-HHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3456789999999999999999999999999999997 899999999999999999999999999999999999999999


Q ss_pred             hhCCCC
Q 030283          125 KKQDGD  130 (180)
Q Consensus       125 ~~~~~~  130 (180)
                      .++...
T Consensus        87 ~~~~~~   92 (102)
T 2co9_A           87 ASLVSK   92 (102)
T ss_dssp             HHHTSS
T ss_pred             hhcccc
Confidence            988644



>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 1e-16
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 4e-14
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 2e-13
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 3e-13
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-12
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 2e-12
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 4e-12
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 6e-12
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 6e-12
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 2e-10
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 2e-09
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-07
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 69.2 bits (169), Expect = 1e-16
 Identities = 38/88 (43%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 39  KRQGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMS 98
           +   KR  + KKDPN PKR  SA+  F  E R   + ENP++T    VGK  G KWK+++
Sbjct: 5   REPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDIT-FGQVGKKLGEKWKALT 63

Query: 99  PAEKAPYESKAEKLKSEYGKKMNAYNKK 126
           P EK PYE+KA+  K  Y  +   YN  
Sbjct: 64  PEEKQPYEAKAQADKKRYESEKELYNAT 91


>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.9
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.88
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.87
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.86
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.85
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.84
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.83
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.81
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.78
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.78
d1l8ya_84 Nucleolar transcription factor 1 (Upstream binding 96.4
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.90  E-value=8.7e-24  Score=149.43  Aligned_cols=83  Identities=45%  Similarity=0.773  Sum_probs=78.3

Q ss_pred             cccccCCCCCCCCCCCChHHHHHHHHHHHHHHhCCCCccHHHHHHHHHhhhcCCCchhhhhHHHHHHHHHHHHHHHHHHH
Q 030283           44 REKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAEKAPYESKAEKLKSEYGKKMNAY  123 (180)
Q Consensus        44 k~kk~~kdp~~PKrP~sAy~lF~~e~r~~ik~e~P~~~~~~eisk~l~e~Wk~Ls~eeK~~Y~~~A~~~k~~y~~e~~~y  123 (180)
                      +.++..++|++|+||+|||||||+++|..|+.+||+++ +.+|++.||.+|++||+++|.+|.++|..++.+|..+|..|
T Consensus        10 ~~~k~~k~p~~PKrP~saf~lF~~e~r~~ik~~~p~~~-~~ei~k~l~~~W~~ls~~eK~~y~~~a~~~k~~y~~e~~~y   88 (93)
T d1lwma_          10 RTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDIT-FGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELY   88 (93)
T ss_dssp             CCCSCCCCSSCCCCCCCHHHHHHHHHHHHHHHHCTTSC-HHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccCCCCcCCCCCCCCHHHHHHHHHHHHHHHhCCCCc-HHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44456779999999999999999999999999999997 89999999999999999999999999999999999999999


Q ss_pred             hhhC
Q 030283          124 NKKQ  127 (180)
Q Consensus       124 ~~~~  127 (180)
                      +.++
T Consensus        89 ~~~l   92 (93)
T d1lwma_          89 NATL   92 (93)
T ss_dssp             HHHH
T ss_pred             Hhcc
Confidence            9875



>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure