Citrus Sinensis ID: 030783

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-

MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVLVILIYLYV

ccccccccccccccccccccEEEEEHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccEEEEEEEccEEEEEEEEccccccccHHEEHHHHcccccccccccccEEEEEEEEEEccEEEEEccccHHHHHHHHHHHcc

ccccccccccccccccccccEEEEEHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEHHHHccccccccccccccccccccEEEEEccEEEEEEEccccccccccHHHHEEEcccccccccccccEEEEEEEEEccccEEEEccHHHHHHEEEEEEEEc

mlnmfslrglpwvsssdgqeKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIrtrwkplpgepppiddtdvddwlpRFIVLHGSCIFFYLlstdlspqdstvlSDVVEvaslpsitrengemQYCFYILTRhglriecssiSKIQVLVILIYLYV

mlnmfslrglpwvsssdgqEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTrwkplpgepppiDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVAslpsitrengeMQYCFYILTRHGLRiecssiskiqvLVILIYLYV

MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVLVILIYLYV

***********************************************AQLEHVDEILRSARLSGYLYIRTRWKPLPGE*PPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVLVILIYLY*

**NMFSLRGL*************LTATELESLRS**********HLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVLVILIYLYV

MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVLVILIYLYV

*LNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVLVILIYLYV

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHi

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLNMFSLRGLPWVSSSDGQEKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVLVILIYLYV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		171
297742337		1479	unnamed protein product [Vitis vinifera]	0.988	0.114	0.798	3e-76
359473918		521	PREDICTED: uncharacterized protein LOC10	0.947	0.310	0.820	6e-75
255537803		245	conserved hypothetical protein [Ricinus	0.982	0.685	0.816	7e-74
297803746		247	hypothetical protein ARALYDRAFT_492476 [	0.935	0.647	0.796	3e-70
334186865		467	Pleckstrin homology (PH) domain-containi	0.935	0.342	0.777	7e-70
42573011		247	Pleckstrin homology (PH) domain-containi	0.935	0.647	0.777	2e-69
227204407		188	AT4G23895 [Arabidopsis thaliana]	0.935	0.851	0.777	5e-69
388509664		188	unknown [Lotus japonicus]	0.947	0.861	0.759	8e-68
449452212		252	PREDICTED: uncharacterized protein LOC10	0.923	0.626	0.778	2e-66
224058266		244	predicted protein [Populus trichocarpa]	0.947	0.663	0.765	4e-66

>gi\|297742337\|emb\|CBI34486.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  289 bits (739), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 135/169 (79%), Positives = 150/169 (88%)

Query: 1    MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA 60
            MLN+FSLRGLPW SSSD QEKVELT  ELESLR+ELA LE+REAH KAQLEHVDEILRSA
Sbjct: 1291 MLNLFSLRGLPWGSSSDDQEKVELTVAELESLRTELASLEEREAHFKAQLEHVDEILRSA 1350

Query: 61   RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS 120
            RLSGYLYIRTRW  LPGEPPPIDDT+VDDWLPRF+VLHGSC+FFY+LSTDLSPQDST+LS
Sbjct: 1351 RLSGYLYIRTRWAALPGEPPPIDDTEVDDWLPRFVVLHGSCLFFYMLSTDLSPQDSTLLS 1410

Query: 121  DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVLVILIYL 169
            DV EV  LP++TRE+ E++YCFYILT HGLR ECSS+SK+QV   L  L
Sbjct: 1411 DVTEVGPLPNLTREDKEIRYCFYILTSHGLRYECSSVSKVQVDSWLTAL 1459

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359473918\|ref\|XP_002269576.2\| PREDICTED: uncharacterized protein LOC100263310 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255537803\|ref\|XP_002509968.1\| conserved hypothetical protein [Ricinus communis] gi\|223549867\|gb\|EEF51355.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|297803746\|ref\|XP_002869757.1\| hypothetical protein ARALYDRAFT_492476 [Arabidopsis lyrata subsp. lyrata] gi\|297315593\|gb\|EFH46016.1\| hypothetical protein ARALYDRAFT_492476 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|334186865\|ref\|NP_001190817.1\| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi\|332659423\|gb\|AEE84823.1\| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|42573011|ref|NP_974602.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|145333884|ref|NP_001078437.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659421|gb|AEE84821.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659422|gb|AEE84822.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|227204407\|dbj\|BAH57055.1\| AT4G23895 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|388509664\|gb\|AFK42898.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|449452212\|ref\|XP_004143854.1\| PREDICTED: uncharacterized protein LOC101205585 [Cucumis sativus] gi\|449501777\|ref\|XP_004161455.1\| PREDICTED: uncharacterized LOC101205585 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224058266\|ref\|XP_002299473.1\| predicted protein [Populus trichocarpa] gi\|222846731\|gb\|EEE84278.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		171
TAIR\|locus:1006230394		247	AT4G23895 [Arabidopsis thalian	0.935	0.647	0.777	7.4e-66

TAIR\|locus:1006230394 AT4G23895 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 670 (240.9 bits), Expect = 7.4e-66, P = 7.4e-66
 Identities = 126/162 (77%), Positives = 144/162 (88%)

Query:     1 MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA 60
             MLN+F+LR LPWVS  DGQEKVEL+A ELESLRSEL+D+E+REA+LKAQLEHVDE+LRSA
Sbjct:    60 MLNLFTLRRLPWVS--DGQEKVELSAAELESLRSELSDMEEREAYLKAQLEHVDEVLRSA 117

Query:    61 RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS 120
             RLSGYL+IR+RW  LPGEPPPIDDT+VDDWLPRF+VL G C+FFYLLSTDLSPQDST+L+
Sbjct:   118 RLSGYLFIRSRWAALPGEPPPIDDTEVDDWLPRFVVLQGPCLFFYLLSTDLSPQDSTLLA 177

Query:   121 DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQV 162
             D+VE+ S+PS TRE  E  YCFYILTR GLR ECSS SK QV
Sbjct:   178 DIVEIGSVPSYTREFDETHYCFYILTRQGLRFECSSTSKTQV 219


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.321   0.138   0.412    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      171       171   0.00090  108 3  11 22  0.38    32
                                                     31  0.47    34


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  597 (63 KB)
  Total size of DFA:  153 KB (2092 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  19.46u 0.21s 19.67t   Elapsed:  00:00:01
  Total cpu time:  19.46u 0.21s 19.67t   Elapsed:  00:00:01
  Start:  Thu May  9 21:09:06 2013   End:  Thu May  9 21:09:07 2013

GO:0004550 "nucleoside diphosphate kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005543 "phospholipid binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0006165 "nucleoside diphosphate phosphorylation" evidence=IEA

GO:0006183 "GTP biosynthetic process" evidence=IEA

GO:0006228 "UTP biosynthetic process" evidence=IEA

GO:0006241 "CTP biosynthetic process" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		171
PF00169		104	PH: PH domain; InterPro: IPR001849 The pleckstrin	98.56
smart00233		102	PH Pleckstrin homology domain. Domain commonly fou	98.09
cd01246		91	PH_oxysterol_bp Oxysterol binding protein (OSBP) P	98.02
cd01250		94	PH_centaurin Centaurin Pleckstrin homology (PH) do	97.92
cd01253		104	PH_beta_spectrin Beta-spectrin pleckstrin homology	97.88
cd01252		125	PH_cytohesin Cytohesin Pleckstrin homology (PH) do	97.87
cd00821		96	PH Pleckstrin homology (PH) domain. Pleckstrin hom	97.85
cd01238		106	PH_Tec Tec pleckstrin homology (PH) domain. Tec pl	97.85
cd01233		100	Unc104 Unc-104 pleckstrin homology (PH) domain. Un	97.84
cd01235		101	PH_SETbf Set binding factor Pleckstrin Homology (P	97.78
cd01260		96	PH_CNK Connector enhancer of KSR (Kinase suppresso	97.5
cd01265		95	PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain	97.33
cd01251		103	PH_centaurin_alpha Centaurin alpha Pleckstrin homo	97.27
cd00900		99	PH-like Pleckstrin homology-like domain. Pleckstri	97.18
cd01247		91	PH_GPBP Goodpasture antigen binding protein (GPBP)	97.06
cd01266		108	PH_Gab Gab (Grb2-associated binder) pleckstrin hom	96.6
cd01263		122	PH_anillin Anillin Pleckstrin homology (PH) domain	96.43
cd01245		98	PH_RasGAP_CG5898 RAS GTPase-activating protein (GA	95.56
cd01257		101	PH_IRS Insulin receptor substrate (IRS) pleckstrin	94.81
cd01236		104	PH_outspread Outspread Pleckstrin homology (PH) do	94.63
cd01244		98	PH_RasGAP_CG9209 RAS_GTPase activating protein (GA	94.43
cd01264		101	PH_melted Melted pleckstrin homology (PH) domain.	93.78
cd01241		102	PH_Akt Akt pleckstrin homology (PH) domain. Akt pl	93.14
cd01230		117	PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6	91.03
PRK09039		343	hypothetical protein; Validated	90.24
cd01254		121	PH_PLD Phospholipase D (PLD) pleckstrin homology (	89.02
cd01249		104	PH_oligophrenin Oligophrenin Pleckstrin homology (	88.01
cd01219		101	PH_FGD FGD (faciogenital dysplasia protein) plecks	84.07
cd01258		108	PH_syntrophin Syntrophin pleckstrin homology (PH)	81.93

>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ]	Back alignment and domain information

Probab=98.56  E-value=3e-08  Score=63.73  Aligned_cols=93  Identities=27%  Similarity=0.395  Sum_probs=76.7

Q ss_pred             cceeEEEeeecccCCCCCCCCCCCCccccceeeEeeecceeEeEeeeC---CCCCCCcceeehhhhccCCCCcc-ccCCc
Q 030783           62 LSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLST---DLSPQDSTVLSDVVEVASLPSIT-RENGE  137 (171)
Q Consensus        62 lsgYLyiRtRW~aLpgEpppiDDtdVDDWlpRFVVl~G~cif~yL~sT---DLsPqdStllsdIVEvg~lP~~~-rEdge  137 (171)
                      ..|||+.++              .-...|=+||+||.|.+++||-..+   +..|..++-|.++ +|...++.. ....+
T Consensus         3 ~~G~L~~~~--------------~~~~~wk~r~~vL~~~~L~~~~~~~~~~~~~~~~~i~l~~~-~v~~~~~~~~~~~~~   67 (104)
T PF00169_consen    3 KEGWLLKKS--------------SSRKKWKKRYFVLRDSYLLYYKSSKDKSDSKPKGSIPLDDC-TVRPDPSSDFLSNKK   67 (104)
T ss_dssp             EEEEEEEEE--------------SSSSSEEEEEEEEETTEEEEESSTTTTTESSESEEEEGTTE-EEEEETSSTSTSTSS
T ss_pred             EEEEEEEEC--------------CCCCCeEEEEEEEECCEEEEEecCccccceeeeEEEEecCc-eEEEcCccccccccC
Confidence            479999999              2345799999999999999999999   7999999999999 887777764 24455


Q ss_pred             eEEEEEEEeecceeeeecccceeeeeeeeeee
Q 030783          138 MQYCFYILTRHGLRIECSSISKIQVLVILIYL  169 (171)
Q Consensus       138 ~~yaFyIlTrhGLR~ECSS~skiQVdswLs~l  169 (171)
                      ..++|.|.+..|=.|..+..++-+...|+.+|
T Consensus        68 ~~~~f~i~~~~~~~~~~~~~s~~~~~~W~~~i   99 (104)
T PF00169_consen   68 RKNCFEITTPNGKSYLFSAESEEERKRWIQAI   99 (104)
T ss_dssp             SSSEEEEEETTSEEEEEEESSHHHHHHHHHHH
T ss_pred             CCcEEEEEeCCCcEEEEEcCCHHHHHHHHHHH
Confidence            68899999999977777777778888887664

The pleckstrin homology domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. The 3D structure of several PH domains has been determined []. All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families: Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w. ; GO: 0005515 protein binding; PDB: 1DYN_B 2DYN_B 3SNH_A 3ZYS_C 1X05_A 2I5F_A 1ZM0_B 1XX0_A 2I5C_C 3A8P_D ....

>smart00233 PH Pleckstrin homology domain	Back alignment and domain information

>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain	Back alignment and domain information

>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd00821 PH Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01238 PH_Tec Tec pleckstrin homology (PH) domain	Back alignment and domain information

>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain	Back alignment and domain information

>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain	Back alignment and domain information

>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain	Back alignment and domain information

>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain	Back alignment and domain information

>cd00900 PH-like Pleckstrin homology-like domain	Back alignment and domain information

>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain	Back alignment and domain information

>cd01264 PH_melted Melted pleckstrin homology (PH) domain	Back alignment and domain information

>cd01241 PH_Akt Akt pleckstrin homology (PH) domain	Back alignment and domain information

>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		171
1wgq_A		109	FYVE, rhogef and PH domain containing 6; ethanol d	98.68
1pls_A		113	Pleckstrin homology domain; phosphorylation; NMR {	98.63
1u5d_A		108	SKAP55, SRC kinase-associated phosphoprotein of 55	98.59
2i5f_A		109	Pleckstrin; PH domain, protein-inositol phosphate	98.57
1x05_A		129	Pleckstrin; PH domain, structural genomics, NPPSFA	98.45
1v89_A		118	Hypothetical protein KIAA0053; pleckstrin homology	98.43
1u5f_A		148	SRC-associated adaptor protein; PH domain of SKAP-	98.41
2d9y_A		117	Pleckstrin homology domain-containing protein fami	98.39
2yry_A		122	Pleckstrin homology domain-containing family A mem	98.36
1eaz_A		125	Tandem PH domain containing protein-1; lipid-bindi	98.34
2dn6_A		115	KIAA0640 protein; PH domain, structural genomics,	98.29
2cod_A		115	Centaurin-delta 1; ARF GAP and RHO GAP with ankyri	98.28
1upq_A		123	PEPP1; PH domain, phosphoinositide binding, signal	98.28
3rcp_A		103	Pleckstrin homology domain-containing family A ME;	98.25
1fao_A		126	Dual adaptor of phosphotyrosine and 3- phosphoinos	98.24
3aj4_A		112	Pleckstrin homology domain-containing family B ME;	98.23
1fgy_A		127	GRP1; PH domain, signaling protein; HET: 4IP; 1.50	98.2
1x1g_A		129	Pleckstrin 2; PH domain, structural genomics, rike	98.17
1v5u_A		117	SBF1, SET binding factor 1; MTMR5, the pleckstrin	98.16
2dkp_A		128	Pleckstrin homology domain-containing family A mem	98.12
2y7b_A		134	Actin-binding protein anillin; cell cycle; 1.90A {	98.07
1btn_A		106	Beta-spectrin; signal transduction protein; HET: I	98.04
2w2x_D		124	1-phosphatidylinositol-4,5-bisphosphate phosphodie	98.02
2d9v_A		130	Pleckstrin homology domain-containing protein fami	97.99
1v5p_A		126	Pleckstrin homology domain-containing, family A; T	97.99
4h8s_A		407	DCC-interacting protein 13-beta; BAR domain, pleck	97.98
2d9x_A		120	Oxysterol binding protein-related protein 11; PH d	97.95
3tca_A		291	Amyloid beta A4 precursor protein-binding family 1	97.94
1u5e_A		211	SRC-associated adaptor protein; novel dimerization	97.94
2dhk_A		119	TBC1 domain family member 2; PH domain, paris-1, s	97.93
1v88_A		130	Oxysterol binding protein-related protein 8; vesic	97.9
2cof_A		107	Protein KIAA1914; PH domain, structural genomics,	97.89
3cxb_B		112	Pleckstrin homology domain-containing family M mem	97.89
1unq_A		125	RAC-alpha serine/threonine kinase; transferase, pl	97.86
2rsg_A		94	Collagen type IV alpha-3-binding protein; pleckstr	97.72
1wi1_A		126	Calcium-dependent activator protein for secretion,	97.7
2lul_A		164	Tyrosine-protein kinase TEC; structural genomics,	97.7
2coc_A		112	FYVE, rhogef and PH domain containing protein 3; s	97.7
1x1f_A		149	Signal-transducing adaptor protein 1; docking prot	97.7
2j59_M		168	RHO-GTPase activating protein 10; ARF, ARF1, ARFBD	97.69
1wg7_A		150	Dedicator of cytokinesis protein 9; pleckstrin hom	97.67
2dtc_A		126	RAL guanine nucleotide exchange factor ralgps1A; P	97.66
2da0_A		114	130-kDa phosphatidylinositol 4,5-biphosphate- depe	97.64
1btk_A		169	Bruton'S tyrosine kinase; transferase, PH domain,	97.62
2p0d_A		129	RHO GTPase-activating protein 9; protein-phosphoin	97.51
1dro_A		122	Beta-spectrin; cytoskeleton; NMR {Drosophila melan	97.5
2rlo_A		128	Centaurin-gamma 1; split PH domain, alternative sp	97.47
2r09_A		347	Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph	97.44
2q13_A		385	DCC-interacting protein 13 alpha; APPL1, BAR domai	97.38
3a8p_A		263	T-lymphoma invasion and metastasis-inducing protei	97.37
1wjm_A		123	Beta-spectrin III; PH domain, signal transduction,	97.36
3pp2_A		124	RHO GTPase-activating protein 27; PH domain, GTPas	97.23
1qqg_A		264	IRS-1, insulin receptor substrate 1; beta-sandwhic	97.17
3lju_X		386	ARF-GAP with dual PH domain-containing protein 1;	97.13
3tfm_A		228	Myosin X; split PH domain, motor protein; 2.53A {R	97.13
4a6h_A		120	Phosphatidylinositol 4,5-bisphosphate-binding Pro	96.96
2rov_A		117	RHO-associated protein kinase 2; ATP-binding, coil	96.96
3lju_X		386	ARF-GAP with dual PH domain-containing protein 1;	96.69
4gmv_A		281	RAS-associated and pleckstrin homology domains-CO	95.79
3hk0_A		256	Growth factor receptor-bound protein 10; GRB10, RA	95.13
3a8n_A		279	TIAM-1, T-lymphoma invasion and metastasis-inducin	94.72
1dyn_A		125	Dynamin; signal transduction protein; 2.20A {Homo	94.64
4ejn_A		446	RAC-alpha serine/threonine-protein kinase; AKT1, a	87.81
2ys3_A		137	UNC-112-related protein 2; PH domain, kindlin-3, s	84.7
2yy0_A		53	C-MYC-binding protein; conserved hypothetical prot	80.5

>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

Probab=98.68  E-value=9.5e-09  Score=68.86  Aligned_cols=91  Identities=15%  Similarity=0.208  Sum_probs=71.2

Q ss_pred             hhcceeEEEeeecccCCCCCCCCCCCCccccceeeEeeecceeEeEeeeCCCCCCCcceeehhhhccCCCCccccCCceE
Q 030783           60 ARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQ  139 (171)
Q Consensus        60 arlsgYLyiRtRW~aLpgEpppiDDtdVDDWlpRFVVl~G~cif~yL~sTDLsPqdStllsdIVEvg~lP~~~rEdge~~  139 (171)
                      ..++|||+-+..              -..-|=.||+||.|.+++||-...|-.|.+++-|.++.-+-..+.     ....
T Consensus         8 ~~~~G~L~K~~~--------------~~~~Wk~RwfvL~~~~L~yyk~~~~~~~~~~i~L~~~~~~~~~~~-----~~~~   68 (109)
T 1wgq_A            8 STMSGYLYRSKG--------------SKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTLVKDE-----NSES   68 (109)
T ss_dssp             CSCEEEEEEESS--------------TTSCCEEEEEEEETTEEEEESCTTCSSCSEEEECSSEEEEECCCS-----SCSS
T ss_pred             CeEEEEEEeCCC--------------CCCCceeEEEEEeCCEEEEECCCCcCccCceEECCCCEEEECCCC-----CCCC
Confidence            357999997631              146799999999999999999999999999999988776544332     2235


Q ss_pred             EEEEEEeecceeeeecccceeeeeeeeeee
Q 030783          140 YCFYILTRHGLRIECSSISKIQVLVILIYL  169 (171)
Q Consensus       140 yaFyIlTrhGLR~ECSS~skiQVdswLs~l  169 (171)
                      ++|-|.|.++-.|..+..++-+.+.|+.+|
T Consensus        69 ~~F~i~~~~~~~~~~~a~s~~e~~~Wi~al   98 (109)
T 1wgq_A           69 KVFQLLHKGMVFYVFKADDAHSTQRWIDAF   98 (109)
T ss_dssp             SEEEEEETTEEEEEEECSSHHHHHHHHHHH
T ss_pred             cEEEEEeCCCeEEEEECCCHHHHHHHHHHH
Confidence            899999887766777777788888898765

PyMOL of 1wgq

>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A	Back alignment and structure

>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A	Back alignment and structure

>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A	Back alignment and structure

>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A*	Back alignment and structure

>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A	Back alignment and structure

>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A	Back alignment and structure

>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A	Back alignment and structure

>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A*	Back alignment and structure

>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens}	Back alignment and structure

>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens}	Back alignment and structure

>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A	Back alignment and structure

>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A	Back alignment and structure

>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens}	Back alignment and structure

>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus}	Back alignment and structure

>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A	Back alignment and structure

>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B	Back alignment and structure

>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A	Back alignment and structure

>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens}	Back alignment and structure

>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens}	Back alignment and structure

>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A	Back alignment and structure

>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus}	Back alignment and structure

>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A*	Back alignment and structure

>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A*	Back alignment and structure

>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1	Back alignment and structure

>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens}	Back alignment and structure

>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A*	Back alignment and structure

>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A	Back alignment and structure

>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A	Back alignment and structure

>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens}	Back alignment and structure

>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A*	Back alignment and structure

>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C*	Back alignment and structure

>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus}	Back alignment and structure

>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A	Back alignment and structure

>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus}	Back alignment and structure

>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C*	Back alignment and structure

>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A	Back alignment and structure

>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens}	Back alignment and structure

>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus}	Back alignment and structure

>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A	Back alignment and structure

>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A*	Back alignment and structure

>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		171
d2i5fa1		104	Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	98.64
d1u5fa1		111	Src-associated adaptor protein Skap2 {Mouse (Mus m	98.5
d1u5da1		106	Src kinase-associated phosphoprotein SKAP55 (SCAP1	98.41
d1upqa_		107	Phosphoinositol 3-phosphate binding protein-1, PEP	98.4
d1plsa_		113	Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	98.28
d1wgqa_		109	FYVE, RhoGEF and PH domain containing protein 6, F	98.25
d1faoa_		100	Dual adaptor of phosphotyrosine and 3-phosphoinosi	98.22
d2fjla1		101	Phosphoinositide phospholipase C, PLC-gamma-1 {Rat	98.18
d1v88a_		130	Oxysterol binding protein-related protein 8 (ORP-8	98.16
d1wjma_		123	beta-spectrin {Human (Homo sapiens), brain 2 isofo	98.08
d2elba2		101	DCC-interacting protein 13-alpha, APPL1 {Human (Ho	98.07
d2coaa1		112	Protein kinase c, d2 type {Human (Homo sapiens) [T	98.04
d2cofa1		95	KIAA1914 {Human (Homo sapiens) [TaxId: 9606]}	98.03
d1x1fa1		136	Signal-transducing adaptor protein 1, STAP-1 {Huma	98.01
d1v5ua_		117	SET binding factor 1, Sbf1 {Mouse (Mus musculus) [	98.0
d2coca1		99	FYVE, RhoGEF and PH domain containing protein 3, F	98.0
d1v89a_		118	Rho-GTPase-activating protein 25 (KIAA0053) {Human	97.99
d1u5ea1		209	Src-associated adaptor protein Skap2 {Mouse (Mus m	97.83
d2j59m1		133	Rho GTPase-activating protein 21 {Human (Homo sapi	97.82
d1btna_		106	beta-spectrin {Mouse (Mus musculus), brain [TaxId:	97.81
d1omwa2		119	G-protein coupled receptor kinase 2 (beta-adrenerg	97.81
d1eaza_		103	Tapp1 {Human (Homo sapiens) [TaxId: 9606]}	97.75
d1x1ga1		116	Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]}	97.67
d1v5pa_		126	Tapp2 {Mouse (Mus musculus) [TaxId: 10090]}	97.65
d1v5ma_		136	SH2 and PH domain-containing adapter protein APS {	97.53
d1wi1a_		126	Calcium-dependent activator protein for secretion,	97.51
d1droa_		122	beta-spectrin {Fruit fly (Drosophila melanogaster)	97.46
d2dyna_		111	Dynamin {Human (Homo sapiens) [TaxId: 9606]}	97.38
d1unqa_		118	Rac-alpha serine/threonine kinase {Human (Homo sap	97.36
d1qqga1		103	Insulin receptor substrate 1, IRS-1 {Human (Homo s	97.22
d1fgya_		127	Grp1 {Mouse (Mus musculus) [TaxId: 10090]}	97.16
d1btka_		169	Bruton's tyrosine kinase {Human (Homo sapiens) [Ta	96.91
d2coda1		102	Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96	96.91
d1wg7a_		150	Dedicator of cytokinesis protein 9, DOCK9 {Human (	96.87
d1w1ha_		147	3-phosphoinositide dependent protein kinase-1 {Hum	96.18

>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Pleckstrin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.64  E-value=4.2e-09  Score=66.76  Aligned_cols=93  Identities=14%  Similarity=0.188  Sum_probs=67.1

Q ss_pred             ceeEEEeeecccCCCCCCCCCCCCccccceeeEeeecc--eeEeEeeeCCCCCCCcceeehhhhccCCCCccccCCceEE
Q 030783           63 SGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGS--CIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQY  140 (171)
Q Consensus        63 sgYLyiRtRW~aLpgEpppiDDtdVDDWlpRFVVl~G~--cif~yL~sTDLsPqdStllsdIVEvg~lP~~~rEdge~~y  140 (171)
                      +|||+.+++..              .-|-+||+||.|.  ++|||=...|-.|.+++.+.++.-+..-++...+.....+
T Consensus         5 ~G~L~k~~~~~--------------k~WkkR~fvL~~~~~~l~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~   70 (104)
T d2i5fa1           5 QGCLLKQGHRR--------------KNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEEN   70 (104)
T ss_dssp             EEEEEEECTTT--------------CCEEEEEEEEETTTTEEEEECTTSCSSCSEEEECTTCEEEEECC--------CCS
T ss_pred             EEEEEEECCCC--------------CCcEEEEEEEECCeeEEEEEcCccccCccceEeecceEEEEeccCcccccccCcc
Confidence            79999987542              3699999999865  6677777889999999999886555555555556666788


Q ss_pred             EEEEEeecceeeeecccceeeeeeeeeee
Q 030783          141 CFYILTRHGLRIECSSISKIQVLVILIYL  169 (171)
Q Consensus       141 aFyIlTrhGLR~ECSS~skiQVdswLs~l  169 (171)
                      +|.+.|..|-.|.-...+.-..+.|+.+|
T Consensus        71 ~~~~~~~~~~~~~~~a~s~~e~~~W~~ai   99 (104)
T d2i5fa1          71 LFEIITADEVHYFLQAATPKERTEWIKAI   99 (104)
T ss_dssp             EEEEECTTCCEEEEECSSHHHHHHHHHHH
T ss_pred             EEEEECCCCeEEEEEcCCHHHHHHHHHHH
Confidence            99999999877666666777788888776

PyMOL of d2i5fa1

>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]}	Back information, alignment and structure

>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]}	Back information, alignment and structure

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure