Citrus Sinensis ID: 031293


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIARFAKV
cHHHHHccccEEEcccccccccccEEEEEcccEEEEEccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHcc
cHHHHHcHHHHccccccccccEEEEEEEEccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHcEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHccccc
MLNALTRqwgvvrtsdkpgltqtINFFKLGTKlclvdlpgygfaYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIdtkwgvkprdHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKAnnslvqpvmmvssksgagiRSLRTVLSKIARFAKV
mlnaltrqwgvvrtsdkpgltqTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYvstrvslkrvcllidtkwgvkprdhELISlmersqtkyQVVLTKTDTVFPIDVARRAMQIEESlkannslvqpvmmvssksgagirslRTVLSKIARFAKV
MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIARFAKV
******RQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIE*****************************VL*********
MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIARFAKV
MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIARFAKV
MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIARFAK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIARFAKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q1GJX8216 Probable GTP-binding prot yes no 0.962 0.722 0.416 2e-30
Q3IYY4217 Probable GTP-binding prot yes no 0.969 0.723 0.401 3e-29
Q5LW13217 Probable GTP-binding prot yes no 0.962 0.718 0.397 7e-29
Q5FPX9227 Probable GTP-binding prot yes no 0.962 0.687 0.391 8e-28
Q16AA3216 Probable GTP-binding prot yes no 0.962 0.722 0.397 1e-27
C3MF47217 Probable GTP-binding prot yes no 0.975 0.728 0.386 3e-27
Q92SF6217 Probable GTP-binding prot yes no 0.944 0.705 0.382 8e-27
Q89BP9217 Probable GTP-binding prot yes no 0.962 0.718 0.392 1e-26
A6U5K8217 Probable GTP-binding prot yes no 0.944 0.705 0.376 2e-26
Q98D85212 Probable GTP-binding prot yes no 0.944 0.721 0.388 3e-26
>sp|Q1GJX8|ENGB_RUEST Probable GTP-binding protein EngB OS=Ruegeria sp. (strain TM1040) GN=engB PE=3 SV=1 Back     alignment and function desciption
 Score =  131 bits (330), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 102/156 (65%)

Query: 1   MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKE 60
           ++NALT   G+ R S+ PG TQ INFF  G +L LVDLPGYG+A A   V + W+ L+K+
Sbjct: 60  LINALTGTKGLARASNTPGRTQEINFFTQGPELYLVDLPGYGYANAPLAVVEKWQRLLKQ 119

Query: 61  YVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQ 120
           Y+S R +L+R  +LIDT+ GVK  D E++ L++ S   +QVV+TK D V   D A+   Q
Sbjct: 120 YLSGRQTLRRAFVLIDTRHGVKKVDEEIMKLLDTSAVTFQVVMTKADKVKEKDRAKILDQ 179

Query: 121 IEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKI 156
           + ++L  + +    +++ SS+ G GI +LR++++ +
Sbjct: 180 VRDALSKHPAAYPEIVLTSSEKGDGIATLRSIIAHL 215




Necessary for normal cell division and for the maintenance of normal septation.
Silicibacter sp. (strain TM1040) (taxid: 292414)
>sp|Q3IYY4|ENGB_RHOS4 Probable GTP-binding protein EngB OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=engB PE=3 SV=1 Back     alignment and function description
>sp|Q5LW13|ENGB_RUEPO Probable GTP-binding protein EngB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=engB PE=3 SV=1 Back     alignment and function description
>sp|Q5FPX9|ENGB_GLUOX Probable GTP-binding protein EngB OS=Gluconobacter oxydans (strain 621H) GN=engB PE=3 SV=1 Back     alignment and function description
>sp|Q16AA3|ENGB_ROSDO Probable GTP-binding protein EngB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=engB PE=3 SV=1 Back     alignment and function description
>sp|C3MF47|ENGB_RHISN Probable GTP-binding protein EngB OS=Rhizobium sp. (strain NGR234) GN=engB PE=3 SV=1 Back     alignment and function description
>sp|Q92SF6|ENGB_RHIME Probable GTP-binding protein EngB OS=Rhizobium meliloti (strain 1021) GN=engB PE=3 SV=1 Back     alignment and function description
>sp|Q89BP9|ENGB_BRAJA Probable GTP-binding protein EngB OS=Bradyrhizobium japonicum (strain USDA 110) GN=engB PE=3 SV=1 Back     alignment and function description
>sp|A6U5K8|ENGB_SINMW Probable GTP-binding protein EngB OS=Sinorhizobium medicae (strain WSM419) GN=engB PE=3 SV=1 Back     alignment and function description
>sp|Q98D85|ENGB_RHILO Probable GTP-binding protein EngB OS=Rhizobium loti (strain MAFF303099) GN=engB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
255553339 489 GTP binding protein, putative [Ricinus c 1.0 0.331 0.840 3e-80
449439155 535 PREDICTED: uncharacterized protein LOC10 1.0 0.302 0.876 3e-80
224145468 305 predicted protein [Populus trichocarpa] 0.993 0.527 0.882 9e-79
449516736 373 PREDICTED: probable GTP-binding protein 1.0 0.434 0.858 7e-78
356537641 535 PREDICTED: uncharacterized protein LOC10 0.993 0.300 0.857 2e-77
356569473 540 PREDICTED: uncharacterized protein LOC10 0.993 0.298 0.850 5e-77
42573726 465 putative GTP-binding protein CGPA [Arabi 0.993 0.346 0.844 1e-76
297793371 467 predicted protein [Arabidopsis lyrata su 0.993 0.344 0.838 3e-76
343172533 343 putative GTP-binding protein, partial [S 0.993 0.469 0.850 2e-75
343172535 343 putative GTP-binding protein, partial [S 0.993 0.469 0.844 5e-75
>gi|255553339|ref|XP_002517711.1| GTP binding protein, putative [Ricinus communis] gi|223543109|gb|EEF44643.1| GTP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  302 bits (773), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 155/176 (88%), Gaps = 14/176 (7%)

Query: 1   MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKE 60
           +LNALTRQWGV RTSDKPGLTQTINFF LG KLCLVDLPGYGFAYAKEEVKDAWE+LVKE
Sbjct: 314 LLNALTRQWGVARTSDKPGLTQTINFFSLGPKLCLVDLPGYGFAYAKEEVKDAWEDLVKE 373

Query: 61  YVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQ 120
           YVSTRV LKRVCLLIDTKWG+KPRDHELI+LMERSQTKYQ+VLTKTD VFPIDVARRAMQ
Sbjct: 374 YVSTRVGLKRVCLLIDTKWGMKPRDHELINLMERSQTKYQIVLTKTDVVFPIDVARRAMQ 433

Query: 121 IEESLKANNSLVQPV--------------MMVSSKSGAGIRSLRTVLSKIARFAKV 162
           IEESLKAN S+VQPV              MMVSSKSGAGIRSLRTVLSKIA FAK+
Sbjct: 434 IEESLKANKSIVQPVFFDVSQSNYVVFTQMMVSSKSGAGIRSLRTVLSKIAWFAKL 489




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449439155|ref|XP_004137353.1| PREDICTED: uncharacterized protein LOC101223165 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224145468|ref|XP_002325653.1| predicted protein [Populus trichocarpa] gi|222862528|gb|EEF00035.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449516736|ref|XP_004165402.1| PREDICTED: probable GTP-binding protein EngB-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356537641|ref|XP_003537334.1| PREDICTED: uncharacterized protein LOC100801850 [Glycine max] Back     alignment and taxonomy information
>gi|356569473|ref|XP_003552925.1| PREDICTED: uncharacterized protein LOC100799694 [Glycine max] Back     alignment and taxonomy information
>gi|42573726|ref|NP_974959.1| putative GTP-binding protein CGPA [Arabidopsis thaliana] gi|222423373|dbj|BAH19659.1| AT5G58370 [Arabidopsis thaliana] gi|332009661|gb|AED97044.1| putative GTP-binding protein CGPA [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297793371|ref|XP_002864570.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297310405|gb|EFH40829.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|343172533|gb|AEL98970.1| putative GTP-binding protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|343172535|gb|AEL98971.1| putative GTP-binding protein, partial [Silene latifolia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2161243465 AT5G58370 [Arabidopsis thalian 0.993 0.346 0.844 1.4e-69
UNIPROTKB|Q5LW13217 engB "Probable GTP-binding pro 0.962 0.718 0.397 3.5e-27
TIGR_CMR|SPO_0530217 SPO_0530 "GTP-binding protein" 0.962 0.718 0.397 3.5e-27
DICTYBASE|DDB_G0348940 743 DDB_G0348940 [Dictyostelium di 0.938 0.204 0.389 5.7e-26
UNIPROTKB|Q2GKS7193 engB "Probable GTP-binding pro 0.956 0.803 0.354 1e-22
TIGR_CMR|APH_0421193 APH_0421 "putative GTP-binding 0.956 0.803 0.354 1e-22
GENEDB_PFALCIPARUM|PF14_0400 1000 PF14_0400 "hypothetical protei 0.956 0.155 0.356 1.9e-21
UNIPROTKB|Q8IL49 1000 PF14_0400 "GTP binding protein 0.956 0.155 0.356 1.9e-21
DICTYBASE|DDB_G0268824432 DDB_G0268824 [Dictyostelium di 0.956 0.358 0.314 1.1e-18
UNIPROTKB|Q9KVN0220 engB "Probable GTP-binding pro 0.932 0.686 0.384 1.7e-18
TAIR|locus:2161243 AT5G58370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 705 (253.2 bits), Expect = 1.4e-69, P = 1.4e-69
 Identities = 136/161 (84%), Positives = 150/161 (93%)

Query:     1 MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKE 60
             +LNALTRQWGVVRTSDKPGLTQTINFF LG K+ LVDLPGYGFA+AK+EVK+AWE+LVKE
Sbjct:   304 LLNALTRQWGVVRTSDKPGLTQTINFFGLGPKVRLVDLPGYGFAFAKDEVKEAWEDLVKE 363

Query:    61 YVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQ 120
             YVSTR SLKRVCLL+DTKWG+KPRD ELI+LMERS TKYQ+VLTKTD VFPIDVARRAMQ
Sbjct:   364 YVSTRTSLKRVCLLVDTKWGMKPRDQELINLMERSNTKYQIVLTKTDVVFPIDVARRAMQ 423

Query:   121 IEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIARFAK 161
             IEE LKAN S+VQP+MMVSS+SGAGI SLRT L+KIARFAK
Sbjct:   424 IEEKLKANRSIVQPLMMVSSRSGAGIGSLRTALAKIARFAK 464




GO:0000917 "barrier septum assembly" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
UNIPROTKB|Q5LW13 engB "Probable GTP-binding protein EngB" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0530 SPO_0530 "GTP-binding protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0348940 DDB_G0348940 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q2GKS7 engB "Probable GTP-binding protein EngB" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0421 APH_0421 "putative GTP-binding protein EngB" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0400 PF14_0400 "hypothetical protein, conserved" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IL49 PF14_0400 "GTP binding protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268824 DDB_G0268824 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVN0 engB "Probable GTP-binding protein EngB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2GKS7ENGB_ANAPZNo assigned EC number0.35480.95670.8031yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 4e-51
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 4e-45
TIGR03598178 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi 1e-40
COG0218200 COG0218, COG0218, Predicted GTPase [General functi 8e-40
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 3e-11
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 6e-08
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 6e-08
cd00880161 cd00880, Era_like, E 4e-07
cd00881183 cd00881, GTP_translation_factor, GTP translation f 1e-05
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provision 3e-05
cd04163168 cd04163, Era, E 2e-04
TIGR03918 391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 7e-04
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 0.001
COG3276 447 COG3276, SelB, Selenocysteine-specific translation 0.001
PRK00089 292 PRK00089, era, GTPase Era; Reviewed 0.001
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
 Score =  160 bits (408), Expect = 4e-51
 Identities = 66/156 (42%), Positives = 97/156 (62%), Gaps = 1/156 (0%)

Query: 2   LNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEY 61
           +NALT +  + RTS  PG TQ INFF +G K  LVDLPGYG+A   +EV++ W +L++EY
Sbjct: 16  INALTNRKKLARTSKTPGRTQLINFFNVGDKFRLVDLPGYGYAKVSKEVREKWGKLIEEY 75

Query: 62  VSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQI 121
           +  R +LK V LLID + G  P D E++  +E     + +VLTK D +   ++A+   +I
Sbjct: 76  LENRENLKGVVLLIDARHGPTPIDLEMLEFLEELGIPFLIVLTKADKLKKSELAKVLKKI 135

Query: 122 EESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIA 157
           +E L   N L  PV++ SSK G GI  LR ++++  
Sbjct: 136 KEELNLFNIL-PPVILFSSKKGTGIDELRALIAEWL 170


The YihA (EngB) subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control. YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting). Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis. The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target. Length = 170

>gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
COG0218200 Predicted GTPase [General function prediction only 100.0
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.91
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.9
COG1160 444 Predicted GTPases [General function prediction onl 99.9
COG1159 298 Era GTPase [General function prediction only] 99.89
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.89
COG1160444 Predicted GTPases [General function prediction onl 99.89
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.87
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 99.87
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.87
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.86
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.86
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.86
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.85
PRK04213201 GTP-binding protein; Provisional 99.85
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.85
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.84
PRK00093435 GTP-binding protein Der; Reviewed 99.84
COG0486454 ThdF Predicted GTPase [General function prediction 99.84
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.84
PRK03003472 GTP-binding protein Der; Reviewed 99.83
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.83
PRK15494 339 era GTPase Era; Provisional 99.83
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.83
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.83
PRK00089 292 era GTPase Era; Reviewed 99.82
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.81
PRK12299335 obgE GTPase CgtA; Reviewed 99.8
cd00881189 GTP_translation_factor GTP translation factor fami 99.8
COG3276 447 SelB Selenocysteine-specific translation elongatio 99.8
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.79
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.79
PRK12298390 obgE GTPase CgtA; Reviewed 99.79
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.79
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.78
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.78
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.78
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.78
PRK12297424 obgE GTPase CgtA; Reviewed 99.78
PRK12736 394 elongation factor Tu; Reviewed 99.77
PRK12296 500 obgE GTPase CgtA; Reviewed 99.77
PRK12317 425 elongation factor 1-alpha; Reviewed 99.77
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.77
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.77
PRK03003 472 GTP-binding protein Der; Reviewed 99.77
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.76
KOG2486320 consensus Predicted GTPase [General function predi 99.76
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.76
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.75
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.75
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.75
PRK12735 396 elongation factor Tu; Reviewed 99.75
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.75
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.75
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 99.75
PRK00093 435 GTP-binding protein Der; Reviewed 99.74
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.74
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.74
PLN03127 447 Elongation factor Tu; Provisional 99.74
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.74
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.74
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.74
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.74
PRK05306 787 infB translation initiation factor IF-2; Validated 99.74
CHL00071 409 tufA elongation factor Tu 99.74
CHL00189 742 infB translation initiation factor 2; Provisional 99.74
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.74
PTZ00141 446 elongation factor 1- alpha; Provisional 99.74
KOG1423 379 consensus Ras-like GTPase ERA [Cell cycle control, 99.74
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 99.73
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.73
PRK00049 396 elongation factor Tu; Reviewed 99.73
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.73
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.71
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.71
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.71
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.7
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.7
KOG0462 650 consensus Elongation factor-type GTP-binding prote 99.7
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.7
PLN03126 478 Elongation factor Tu; Provisional 99.69
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.69
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.69
KOG1145 683 consensus Mitochondrial translation initiation fac 99.68
PLN00043 447 elongation factor 1-alpha; Provisional 99.68
PRK14845 1049 translation initiation factor IF-2; Provisional 99.68
PRK11058426 GTPase HflX; Provisional 99.68
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.68
PRK04004 586 translation initiation factor IF-2; Validated 99.67
PRK05433 600 GTP-binding protein LepA; Provisional 99.67
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.67
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.66
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.65
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.65
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.65
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.64
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.64
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.63
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.62
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.62
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.62
PRK09866 741 hypothetical protein; Provisional 99.61
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.61
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.61
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.61
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.61
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.6
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.6
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.6
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.6
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.6
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.59
KOG0461 522 consensus Selenocysteine-specific elongation facto 99.59
PRK10218 607 GTP-binding protein; Provisional 99.59
PLN00223181 ADP-ribosylation factor; Provisional 99.59
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.59
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.59
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.59
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.58
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.58
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.58
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.58
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.58
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.58
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.57
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.57
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.57
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.57
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.57
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.57
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.57
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.57
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.57
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.57
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.57
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.56
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.56
COG2262411 HflX GTPases [General function prediction only] 99.56
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.56
PLN03118211 Rab family protein; Provisional 99.56
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.56
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.56
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.55
cd01896233 DRG The developmentally regulated GTP-binding prot 99.55
COG0050 394 TufB GTPases - translation elongation factors [Tra 99.55
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.55
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.55
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.55
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.55
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.55
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.55
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.55
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.54
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.54
PTZ00133182 ADP-ribosylation factor; Provisional 99.54
PLN03110216 Rab GTPase; Provisional 99.54
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.53
KOG0458 603 consensus Elongation factor 1 alpha [Translation, 99.53
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.53
COG1084346 Predicted GTPase [General function prediction only 99.53
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.52
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.52
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.52
PRK12739 691 elongation factor G; Reviewed 99.52
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.52
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.52
PTZ00099176 rab6; Provisional 99.52
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.52
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.51
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.51
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.51
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.51
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.51
COG3596296 Predicted GTPase [General function prediction only 99.5
PTZ00369189 Ras-like protein; Provisional 99.5
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.5
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.5
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.5
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.49
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.49
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.49
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.49
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.48
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.48
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.48
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.47
PRK00007 693 elongation factor G; Reviewed 99.47
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.47
PLN03108210 Rab family protein; Provisional 99.46
KOG0466 466 consensus Translation initiation factor 2, gamma s 99.46
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.46
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.46
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.46
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.45
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.45
PRK13768253 GTPase; Provisional 99.44
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.44
KOG0460 449 consensus Mitochondrial translation elongation fac 99.44
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.44
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.43
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.43
COG0536369 Obg Predicted GTPase [General function prediction 99.43
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.43
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 99.43
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.43
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.43
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.43
COG2229187 Predicted GTPase [General function prediction only 99.42
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.42
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.42
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.42
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.42
PRK12740 668 elongation factor G; Reviewed 99.42
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.41
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.41
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.41
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.41
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.41
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.41
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.41
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.4
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.4
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.4
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.39
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.39
PRK13351 687 elongation factor G; Reviewed 99.38
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.38
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.38
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.38
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.37
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.37
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.37
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.37
COG5258 527 GTPBP1 GTPase [General function prediction only] 99.37
COG1163365 DRG Predicted GTPase [General function prediction 99.37
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.36
PRK09563 287 rbgA GTPase YlqF; Reviewed 99.35
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.35
cd04105203 SR_beta Signal recognition particle receptor, beta 99.35
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.34
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.34
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.34
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.33
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.32
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.32
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.32
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.32
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.32
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.31
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 99.29
KOG1143 591 consensus Predicted translation elongation factor 99.28
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.27
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.25
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.24
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.24
PTZ00416 836 elongation factor 2; Provisional 99.24
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.23
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.22
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 99.21
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.21
PRK09435332 membrane ATPase/protein kinase; Provisional 99.21
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.2
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.2
KOG0394210 consensus Ras-related GTPase [General function pre 99.18
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.17
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.16
KOG0090238 consensus Signal recognition particle receptor, be 99.16
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.15
PRK07560 731 elongation factor EF-2; Reviewed 99.15
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.15
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 99.14
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.14
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 99.13
KOG0463 641 consensus GTP-binding protein GP-1 [General functi 99.13
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.1
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.1
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.1
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.09
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.08
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.08
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.06
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.05
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 99.03
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 99.03
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.03
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.02
PRK09602 396 translation-associated GTPase; Reviewed 99.0
KOG0081219 consensus GTPase Rab27, small G protein superfamil 98.99
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.98
PRK12289 352 GTPase RsgA; Reviewed 98.98
TIGR00157 245 ribosome small subunit-dependent GTPase A. The Aqu 98.96
KOG2655 366 consensus Septin family protein (P-loop GTPase) [C 98.96
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.95
KOG0095213 consensus GTPase Rab30, small G protein superfamil 98.93
PTZ00258 390 GTP-binding protein; Provisional 98.93
KOG0086214 consensus GTPase Rab4, small G protein superfamily 98.92
COG5019 373 CDC3 Septin family protein [Cell division and chro 98.92
KOG0097215 consensus GTPase Rab14, small G protein superfamil 98.92
PRK00098 298 GTPase RsgA; Reviewed 98.92
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 98.89
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 98.89
KOG0079198 consensus GTP-binding protein H-ray, small G prote 98.89
cd01854 287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.89
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.88
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.87
KOG0459 501 consensus Polypeptide release factor 3 [Translatio 98.87
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 98.87
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.86
KOG0080209 consensus GTPase Rab18, small G protein superfamil 98.86
PRK13796 365 GTPase YqeH; Provisional 98.85
PRK12288 347 GTPase RsgA; Reviewed 98.84
COG1100219 GTPase SAR1 and related small G proteins [General 98.83
PRK01889 356 GTPase RsgA; Reviewed 98.81
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.77
KOG0465 721 consensus Mitochondrial elongation factor [Transla 98.74
KOG0395196 consensus Ras-related GTPase [General function pre 98.73
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 98.73
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.73
KOG0467 887 consensus Translation elongation factor 2/ribosome 98.65
PLN00023 334 GTP-binding protein; Provisional 98.65
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.57
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.57
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.56
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.53
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.53
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.49
KOG0464 753 consensus Elongation factor G [Translation, riboso 98.48
COG1161 322 Predicted GTPases [General function prediction onl 98.47
KOG3859 406 consensus Septins (P-loop GTPases) [Cell cycle con 98.45
KOG4252246 consensus GTP-binding protein [Signal transduction 98.44
KOG2485 335 consensus Conserved ATP/GTP binding protein [Gener 98.38
KOG2484 435 consensus GTPase [General function prediction only 98.38
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.35
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.31
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.3
COG1162 301 Predicted GTPases [General function prediction onl 98.24
PRK09601 364 GTP-binding protein YchF; Reviewed 98.2
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.2
KOG0410410 consensus Predicted GTP binding protein [General f 98.13
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 98.09
COG1161322 Predicted GTPases [General function prediction onl 98.07
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 98.07
KOG1424 562 consensus Predicted GTP-binding protein MMR1 [Gene 98.06
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.05
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 98.01
COG0012 372 Predicted GTPase, probable translation factor [Tra 97.96
PRK09563287 rbgA GTPase YlqF; Reviewed 97.89
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 97.83
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.79
KOG1673205 consensus Ras GTPases [General function prediction 97.78
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.76
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 97.71
KOG2423 572 consensus Nucleolar GTPase [General function predi 97.71
KOG1954 532 consensus Endocytosis/signaling protein EHD1 [Sign 97.7
KOG3883198 consensus Ras family small GTPase [Signal transduc 97.64
KOG0082354 consensus G-protein alpha subunit (small G protein 97.62
KOG0469 842 consensus Elongation factor 2 [Translation, riboso 97.61
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 97.6
cd03110179 Fer4_NifH_child This protein family's function is 97.59
KOG1534273 consensus Putative transcription factor FET5 [Tran 97.53
PRK13796365 GTPase YqeH; Provisional 97.52
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 97.51
TIGR00064272 ftsY signal recognition particle-docking protein F 97.48
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 97.44
KOG3886 295 consensus GTP-binding protein [Signal transduction 97.34
PRK10416318 signal recognition particle-docking protein FtsY; 97.34
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 97.34
PRK14974336 cell division protein FtsY; Provisional 97.33
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 97.3
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.26
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 97.18
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 97.15
PRK12288347 GTPase RsgA; Reviewed 97.13
PRK12289352 GTPase RsgA; Reviewed 97.02
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 96.79
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 96.74
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.7
KOG0447 980 consensus Dynamin-like GTP binding protein [Genera 96.67
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 96.62
COG1149284 MinD superfamily P-loop ATPase containing an inser 96.45
KOG3905 473 consensus Dynein light intermediate chain [Cell mo 96.31
PRK00771 437 signal recognition particle protein Srp54; Provisi 96.27
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.27
cd03114148 ArgK-like The function of this protein family is u 96.18
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 96.15
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 96.14
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 96.14
cd03112158 CobW_like The function of this protein family is u 96.11
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 96.06
PRK00098298 GTPase RsgA; Reviewed 96.06
KOG2484435 consensus GTPase [General function prediction only 95.98
COG1162301 Predicted GTPases [General function prediction onl 95.91
cd03115173 SRP The signal recognition particle (SRP) mediates 95.72
TIGR00959 428 ffh signal recognition particle protein. This mode 95.69
COG0523 323 Putative GTPases (G3E family) [General function pr 95.66
PRK10867 433 signal recognition particle protein; Provisional 95.6
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.44
KOG0446 657 consensus Vacuolar sorting protein VPS1, dynamin, 95.39
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.33
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 95.28
cd02036179 MinD Bacterial cell division requires the formatio 95.22
KOG0099379 consensus G protein subunit Galphas, small G prote 95.2
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.15
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.14
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 95.12
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 95.06
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.05
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.01
PF1060981 ParA: ParA/MinD ATPase like; InterPro: IPR019591 T 95.0
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.98
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 94.63
KOG1491 391 consensus Predicted GTP-binding protein (ODN super 94.62
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 94.55
KOG0052 391 consensus Translation elongation factor EF-1 alpha 94.54
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 94.52
cd03111106 CpaE_like This protein family consists of proteins 94.47
KOG2423572 consensus Nucleolar GTPase [General function predi 94.35
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.27
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 94.11
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 94.1
KOG3887 347 consensus Predicted small GTPase involved in nucle 93.96
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 93.94
KOG0085359 consensus G protein subunit Galphaq/Galphay, small 93.83
PF14331 266 ImcF-related_N: ImcF-related N-terminal domain 93.72
KOG0780 483 consensus Signal recognition particle, subunit Srp 93.63
PRK13505 557 formate--tetrahydrofolate ligase; Provisional 93.61
PHA02518211 ParA-like protein; Provisional 93.16
COG3523 1188 IcmF Type VI protein secretion system component Va 92.88
TIGR01968261 minD_bact septum site-determining protein MinD. Th 92.78
TIGR02475 341 CobW cobalamin biosynthesis protein CobW. A broade 92.77
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 92.76
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 92.74
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 92.11
COG0552340 FtsY Signal recognition particle GTPase [Intracell 92.03
CHL00175281 minD septum-site determining protein; Validated 91.8
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 91.6
PRK13849231 putative crown gall tumor protein VirC1; Provision 91.3
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 91.16
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 90.1
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 90.07
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 89.61
cd02032267 Bchl_like This family of proteins contains bchL an 89.59
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 89.4
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 88.79
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 88.25
PRK10818270 cell division inhibitor MinD; Provisional 87.98
PF08438109 MMR_HSR1_C: GTPase of unknown function C-terminal; 87.65
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 87.63
PRK11519719 tyrosine kinase; Provisional 86.42
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intr 85.69
cd02117212 NifH_like This family contains the NifH (iron prot 85.47
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 84.9
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 84.65
PRK11670369 antiporter inner membrane protein; Provisional 84.28
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 83.96
KOG1533290 consensus Predicted GTPase [General function predi 83.86
TIGR03029274 EpsG chain length determinant protein tyrosine kin 83.64
PRK11537 318 putative GTP-binding protein YjiA; Provisional 83.33
COG0489265 Mrp ATPases involved in chromosome partitioning [C 82.46
PRK13705388 plasmid-partitioning protein SopA; Provisional 82.33
KOG2743 391 consensus Cobalamin synthesis protein [Coenzyme tr 82.27
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 82.07
cd00477 524 FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca 81.44
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 81.35
CHL00072290 chlL photochlorophyllide reductase subunit L 80.76
PRK13507 587 formate--tetrahydrofolate ligase; Provisional 80.47
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=5.6e-32  Score=179.47  Aligned_cols=158  Identities=39%  Similarity=0.567  Sum_probs=143.7

Q ss_pred             ChhcccCCCCceeccCCCCcceEEEEEEeCCceEEEcCCCCcccccCHHHHHHHHHHHHHHHhcCcccceeEEEeecCCC
Q 031293            1 MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIDTKWG   80 (162)
Q Consensus         1 lin~L~~~~~~~~~~~~~g~t~~~~~~~~~~~~~ivDtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~vid~~~~   80 (162)
                      |||+|+++.+.+++|.+||.|+.+++|.++.++.+||.||||...++...++.|..++.+|+....+...+++++|++.+
T Consensus        40 lIN~l~~~k~LArtSktPGrTq~iNff~~~~~~~lVDlPGYGyAkv~k~~~e~w~~~i~~YL~~R~~L~~vvlliD~r~~  119 (200)
T COG0218          40 LINALTNQKNLARTSKTPGRTQLINFFEVDDELRLVDLPGYGYAKVPKEVKEKWKKLIEEYLEKRANLKGVVLLIDARHP  119 (200)
T ss_pred             HHHHHhCCcceeecCCCCCccceeEEEEecCcEEEEeCCCcccccCCHHHHHHHHHHHHHHHhhchhheEEEEEEECCCC
Confidence            68999998788999999999999999999988999999999999999999999999999999999889999999999999


Q ss_pred             CCccHHHHHHHHHHhCCceEEEEeccCCCCcHHHHHHHHHHHHHHHhcCCCCCCeEEeecCCCCCHHHHHHHHHHhhh
Q 031293           81 VKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIAR  158 (162)
Q Consensus        81 ~~~~~~~~~~~l~~~~~~~ivv~nK~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Sa~~~~g~~~l~~~i~~~~~  158 (162)
                      +...|.++++++...++|+++++||+|.+...+....+..+.+.+........-++.+|+.++.|+++++..|.+.+.
T Consensus       120 ~~~~D~em~~~l~~~~i~~~vv~tK~DKi~~~~~~k~l~~v~~~l~~~~~~~~~~~~~ss~~k~Gi~~l~~~i~~~~~  197 (200)
T COG0218         120 PKDLDREMIEFLLELGIPVIVVLTKADKLKKSERNKQLNKVAEELKKPPPDDQWVVLFSSLKKKGIDELKAKILEWLK  197 (200)
T ss_pred             CcHHHHHHHHHHHHcCCCeEEEEEccccCChhHHHHHHHHHHHHhcCCCCccceEEEEecccccCHHHHHHHHHHHhh
Confidence            999999999999999999999999999998888887777787766655442223899999999999999999988764



>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0085 consensus G protein subunit Galphaq/Galphay, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF14331 ImcF-related_N: ImcF-related N-terminal domain Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>PF08438 MMR_HSR1_C: GTPase of unknown function C-terminal; InterPro: IPR013646 This domain is found at the C terminus of IPR002917 from INTERPRO in archaeal and eukaryotic GTP-binding proteins Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PRK13507 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1pui_A210 Structure Of Engb Gtpase Length = 210 4e-18
3pqc_A195 Crystal Structure Of Thermotoga Maritima Ribosome B 2e-16
1sul_A195 Crystal Structure Of The Apo-Ysxc Length = 195 1e-15
4dhe_A223 Crystal Structure Of A Probable Gtp-Binding Protein 1e-11
4ac9_A 482 Crystal Structure Of Translation Elongation Factor 2e-05
>pdb|1PUI|A Chain A, Structure Of Engb Gtpase Length = 210 Back     alignment and structure

Iteration: 1

Score = 87.0 bits (214), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 59/155 (38%), Positives = 82/155 (52%), Gaps = 5/155 (3%) Query: 2 LNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEY 61 LN LT Q + RTS PG TQ IN F++ LVDLPGYG+A EE+K W+ + EY Sbjct: 43 LNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEY 102 Query: 62 VSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAM-- 119 + R SL+ + +L+D + +K D ++I S V+LTK D + AR+A Sbjct: 103 LEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKL--ASGARKAQLN 160 Query: 120 QIEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLS 154 + E++ A N VQ V SS G+ LR L Sbjct: 161 MVREAVLAFNGDVQ-VETFSSLKKQGVDKLRQKLD 194
>pdb|3PQC|A Chain A, Crystal Structure Of Thermotoga Maritima Ribosome Biogenesis Gtp- Binding Protein Engb (YsxcYIHA) IN COMPLEX WITH GDP Length = 195 Back     alignment and structure
>pdb|1SUL|A Chain A, Crystal Structure Of The Apo-Ysxc Length = 195 Back     alignment and structure
>pdb|4DHE|A Chain A, Crystal Structure Of A Probable Gtp-Binding Protein Engb From Burkholderia Thailandensis Length = 223 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 7e-46
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 3e-45
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 8e-44
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 2e-42
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 1e-25
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 1e-12
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 6e-05
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 3e-04
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 4e-04
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 Back     alignment and structure
 Score =  148 bits (375), Expect = 7e-46
 Identities = 55/156 (35%), Positives = 78/156 (50%), Gaps = 1/156 (0%)

Query: 1   MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKE 60
            LN LT Q  + RTS  PG TQ IN F++     LVDLPGYG+A   EE+K  W+  + E
Sbjct: 42  ALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGE 101

Query: 61  YVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQ 120
           Y+  R SL+ + +L+D +  +K  D ++I     S     V+LTK D +       +   
Sbjct: 102 YLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNM 161

Query: 121 IEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKI 156
           + E++ A N  V  V   SS    G+  LR  L   
Sbjct: 162 VREAVLAFNGDV-QVETFSSLKKQGVDKLRQKLDTW 196


>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Length = 301 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 361 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.93
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.92
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.92
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.86
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.85
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.83
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.82
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.82
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.82
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.81
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.8
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.79
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.79
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.79
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.78
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.78
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.77
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.77
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.77
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.76
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.76
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.76
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.75
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.74
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.74
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.74
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.73
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.73
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.73
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 99.73
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.72
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.72
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.71
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.71
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.71
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 99.71
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.7
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.69
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.69
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.69
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.69
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.69
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.68
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.68
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.68
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.68
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.68
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.67
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.67
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.67
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.67
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.67
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.67
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.67
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.67
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.67
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.67
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.67
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.67
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.66
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.66
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.66
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.66
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.66
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.65
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.65
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.65
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.65
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.65
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.65
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.65
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.65
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.64
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.64
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.64
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.64
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.64
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.64
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.64
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.63
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.63
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.63
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.63
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.63
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.63
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.63
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.63
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.63
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.63
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.62
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.62
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.62
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.62
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.62
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.62
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.62
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.61
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.61
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.61
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.61
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.61
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.61
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.61
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.61
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.6
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.6
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.6
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.6
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.6
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.6
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.6
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.6
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.6
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.6
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.6
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.59
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.59
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.59
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.59
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.59
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.59
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.59
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.59
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.59
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.59
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.59
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.58
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.58
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.58
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.58
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.58
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.58
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.58
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.58
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.57
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.57
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.56
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.56
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.56
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.56
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.56
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.55
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.55
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.54
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.54
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.53
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.53
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.53
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.53
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.52
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.52
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.51
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.51
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.51
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.51
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.5
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.5
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.49
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.49
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.49
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.23
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.48
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 99.47
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.47
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.46
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.45
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.44
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.42
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.42
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.42
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.41
1wxq_A 397 GTP-binding protein; structural genomics, riken st 99.41
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.4
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.39
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.37
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.35
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 99.34
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.32
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.31
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.31
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.3
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.29
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.27
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.27
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.27
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.25
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.22
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.16
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.15
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.13
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.12
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.11
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.11
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.1
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.09
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 99.08
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.07
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.06
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 99.06
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.04
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 99.02
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.02
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 99.01
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.01
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.99
2ged_A193 SR-beta, signal recognition particle receptor beta 98.95
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.92
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.9
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 98.87
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 98.86
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.86
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 98.84
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 98.81
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 98.81
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.8
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 98.74
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.73
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.58
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.41
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.41
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.25
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.21
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.13
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 97.84
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.73
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 97.51
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.45
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.38
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.23
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.22
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 96.72
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 96.69
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 95.43
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 95.42
2xxa_A 433 Signal recognition particle protein; protein trans 95.17
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 94.74
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 94.42
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 94.29
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 94.12
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 94.12
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.04
3cwq_A209 Para family chromosome partitioning protein; alpha 93.98
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 93.93
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 93.48
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 93.43
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.36
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 92.9
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 92.75
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 92.45
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 92.33
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 92.08
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 91.85
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 91.84
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 91.56
3end_A307 Light-independent protochlorophyllide reductase ir 90.89
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 90.35
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 89.36
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 86.84
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 85.83
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 85.33
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 85.26
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 84.37
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 84.08
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 82.86
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 80.66
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 80.49
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
Probab=99.93  E-value=1.4e-24  Score=149.41  Aligned_cols=158  Identities=28%  Similarity=0.430  Sum_probs=129.1

Q ss_pred             ChhcccCCCCceeccCCCCcceEEEEEEeC----CceEEEcCCCCcccccCHHHHHHHHHHHHHHHhcCcccceeEEEee
Q 031293            1 MLNALTRQWGVVRTSDKPGLTQTINFFKLG----TKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLID   76 (162)
Q Consensus         1 lin~L~~~~~~~~~~~~~g~t~~~~~~~~~----~~~~ivDtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~vid   76 (162)
                      |+|+|++....+.++..+|+|+....+...    .++.+|||||++........++.+..++..|+.....+|++++|+|
T Consensus        45 lin~l~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~l~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~vi~v~d  124 (223)
T 4dhe_A           45 AINVLCNQKRLAFASKTPGRTQHINYFSVGPAAEPVAHLVDLPGYGYAEVPGAAKAHWEQLLSSYLQTRPQLCGMILMMD  124 (223)
T ss_dssp             HHHHHTTCSSSSCTTCCCCSCCCEEEEEESCTTSCSEEEEECCCCCSSCCCSTHHHHHHHHHHHHHHHCTTEEEEEEEEE
T ss_pred             HHHHHhCCCcceeecCCCCcccceEEEEecCCCCCcEEEEcCCCCCcccCChhhHHHHHHHHHHHHhcCcCcCEEEEEEe
Confidence            589999984357889999999988877765    6799999999987655555677778888899988888899999999


Q ss_pred             cCCCCCccHHHHHHHHHHhCCceEEEEeccCCCCcHHHHHHHHHHHHHHHhc----CCCCCCeEEeecCCCCCHHHHHHH
Q 031293           77 TKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKAN----NSLVQPVMMVSSKSGAGIRSLRTV  152 (162)
Q Consensus        77 ~~~~~~~~~~~~~~~l~~~~~~~ivv~nK~Dl~~~~~~~~~~~~~~~~~~~~----~~~~~~i~~~Sa~~~~g~~~l~~~  152 (162)
                      +..+++..+..++..+...++|+++|+||+|+.+........+.+.+.+...    .....+++++||++|.|+++++++
T Consensus       125 ~~~~~~~~~~~~~~~l~~~~~p~i~v~nK~Dl~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~SA~~g~gv~~l~~~  204 (223)
T 4dhe_A          125 ARRPLTELDRRMIEWFAPTGKPIHSLLTKCDKLTRQESINALRATQKSLDAYRDAGYAGKLTVQLFSALKRTGLDDAHAL  204 (223)
T ss_dssp             TTSCCCHHHHHHHHHHGGGCCCEEEEEECGGGSCHHHHHHHHHHHHHHHHHHHHHTCCSCEEEEEEBTTTTBSHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHhcCCCEEEEEeccccCChhhHHHHHHHHHHHHHhhhhcccCCCCeEEEeecCCCcCHHHHHHH
Confidence            9988888788888888888899999999999997776655555665555442    012358999999999999999999


Q ss_pred             HHHhhh
Q 031293          153 LSKIAR  158 (162)
Q Consensus       153 i~~~~~  158 (162)
                      |.+.+.
T Consensus       205 l~~~~~  210 (223)
T 4dhe_A          205 IESWLR  210 (223)
T ss_dssp             HHHHHC
T ss_pred             HHHhcC
Confidence            998765



>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 7e-10
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 1e-09
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 4e-06
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 5e-05
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 5e-04
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngB
species: Bacillus subtilis [TaxId: 1423]
 Score = 53.2 bits (126), Expect = 7e-10
 Identities = 42/156 (26%), Positives = 80/156 (51%), Gaps = 2/156 (1%)

Query: 1   MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKE 60
            +N+L  +  + RTS KPG TQT+NF+ +  +L  VD+PGYGFA   +  ++AW  +++ 
Sbjct: 39  FINSLINRKNLARTSSKPGKTQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIET 98

Query: 61  YVSTRVSLKRVCLLIDTKWGVKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQ 120
           Y++TR  LK V  ++D +      D ++   ++       V+ TK D +      + A  
Sbjct: 99  YITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKV 158

Query: 121 IEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKI 156
           + ++L  +      +++ SS++  G       + K+
Sbjct: 159 VRQTLNIDPE--DELILFSSETKKGKDEAWGAIKKM 192


>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.92
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.9
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.88
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.88
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.87
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.86
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.85
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.82
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.81
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.81
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.8
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.78
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.77
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.77
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.76
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.72
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.72
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.67
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.66
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.66
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.65
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.65
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.64
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.61
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.6
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.59
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.58
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.57
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.56
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.55
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.53
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.53
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.53
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.5
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.48
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.47
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.45
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.45
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.44
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.43
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.42
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.39
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.39
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.36
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.34
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.34
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.34
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.33
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.33
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.3
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.27
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.27
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.24
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.23
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.22
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.19
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.15
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.13
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.12
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.11
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.06
d1u0la2 225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.93
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.82
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.7
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.65
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.64
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.59
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.5
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.39
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.29
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.08
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.08
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.03
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 97.6
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 97.48
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.93
d2qy9a2211 GTPase domain of the signal recognition particle r 96.57
d1vmaa2213 GTPase domain of the signal recognition particle r 96.23
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.95
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 94.66
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.53
d1okkd2207 GTPase domain of the signal recognition particle r 94.34
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.3
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 91.45
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 87.44
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngB
species: Bacillus subtilis [TaxId: 1423]
Probab=99.92  E-value=1.1e-23  Score=140.86  Aligned_cols=156  Identities=27%  Similarity=0.488  Sum_probs=120.6

Q ss_pred             ChhcccCCCCceeccCCCCcceEEEEEEeCCceEEEcCCCCcccccCHHHHHHHHHHHHHHHhcCcccceeEEEeecCCC
Q 031293            1 MLNALTRQWGVVRTSDKPGLTQTINFFKLGTKLCLVDLPGYGFAYAKEEVKDAWEELVKEYVSTRVSLKRVCLLIDTKWG   80 (162)
Q Consensus         1 lin~L~~~~~~~~~~~~~g~t~~~~~~~~~~~~~ivDtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~vid~~~~   80 (162)
                      |+|+|+|....+.++..+++|...........+.++|++|.+.........+....++..+......++++++++|++.+
T Consensus        39 Lin~L~g~~~~~~~~~~~~~t~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~viD~~~~  118 (195)
T d1svia_          39 FINSLINRKNLARTSSKPGKTQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHA  118 (195)
T ss_dssp             HHHHHHTC-------------CCEEEEEETTTEEEEECCCBCCCSSCHHHHHHHHHHHHHHHHHCTTEEEEEEEEETTSC
T ss_pred             HHHHhcCCCceEEeecccceeeecccccccccceEEEEEeeccccccccccchhhhHHhhhhccccchhhhhhhhhcccc
Confidence            68999998667789999999999888888888999999998777666665555566677777888888999999999999


Q ss_pred             CCccHHHHHHHHHHhCCceEEEEeccCCCCcHHHHHHHHHHHHHHHhcCCCCCCeEEeecCCCCCHHHHHHHHHHhhh
Q 031293           81 VKPRDHELISLMERSQTKYQVVLTKTDTVFPIDVARRAMQIEESLKANNSLVQPVMMVSSKSGAGIRSLRTVLSKIAR  158 (162)
Q Consensus        81 ~~~~~~~~~~~l~~~~~~~ivv~nK~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Sa~~~~g~~~l~~~i~~~~~  158 (162)
                      +...+.++++.+...++|+++|+||+|+..+....+..+.+++.+....  ..+++++||++|.|+++++++|.+.+.
T Consensus       119 ~~~~~~~~~~~l~~~~~piivv~NK~D~~~~~~~~~~~~~~~~~l~~~~--~~~~~~~SA~~~~gi~el~~~i~~~l~  194 (195)
T d1svia_         119 PSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDP--EDELILFSSETKKGKDEAWGAIKKMIN  194 (195)
T ss_dssp             CCHHHHHHHHHHHHTTCCEEEEEECGGGSCGGGHHHHHHHHHHHHTCCT--TSEEEECCTTTCTTHHHHHHHHHHHHT
T ss_pred             ccccccccccccccccCcceechhhccccCHHHHHHHHHHHHHHhcccC--CCCEEEEeCCCCCCHHHHHHHHHHHhC
Confidence            9888899999999999999999999999877777777777766665433  358999999999999999999988763



>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure