Citrus Sinensis ID: 031573

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MAKKAANEPKESQSSSASNLKMVLRKRPTRHSVVAAVGIEKEGKSISAKRVTTKLKKKHEKLDSKMPKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMADYIKRKENGKVENSEEDSEFDEYE
cccccccccccccccHHHHHHHHHHccccccHHHHHHcHHHHccccccccccccHHccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccc
cccccccccccccHHHHHHHHHHHHccccccccHHcccHcHHHHHccHHHccccccccccccccccccccccHHHHEHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
makkaanepkesqsssaSNLKMVlrkrptrhSVVAAVGIekegksisAKRVTTKLKKKHEkldskmpkkpptaFFYFLEDFRkgfqeqnpdikSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMADYIKRkengkvenseedsefdeye
makkaanepkesqsssasnlkmvlrkrptrhsvvaavgiekegksisakrvttklkkkhekldskmpkkppTAFFYFLEDFRKGFqeqnpdiksmraigkacgekwktmtyeekvkyydiatekraeFDRAMADYikrkengkvenseedsefdeye
MAKKAANEPKESQSSSASNLKMVLRKRPTRHSVVAAVGIEKEGKSISAkrvttklkkkhekldskMPKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMADYIKRKENGKVENSEEDSEFDEYE
************************************************************************AFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMA************************
**********************************************************************PTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAM*************************
*******************LKMVLRKRPTRHSVVAAVGIEKEGKSISAKRVTTKLKKKHEKLDSKMPKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMADYIKRKEN****************
**************************************************************DSKMPKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMADYIKRK******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKKAANEPKESQSSSASNLKMVLRKRPTRHSVVAAVGIEKEGKSISAKRVTTKLKKKHEKLDSKMPKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMADYIKRKENGKVENSEEDSEFDEYE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
O64702151 High mobility group B pro yes no 0.598 0.622 0.723 7e-36
O49595178 High mobility group B pro no no 0.636 0.561 0.43 3e-17
P40620149 HMG1/2-like protein OS=Vi N/A no 0.503 0.530 0.443 3e-15
P93047141 High mobility group B pro no no 0.592 0.659 0.419 6e-15
Q42344138 High mobility group B pro no no 0.668 0.760 0.417 1e-14
O49596144 High mobility group B pro no no 0.592 0.645 0.397 1e-14
P26585152 HMG1/2-like protein OS=Gl no no 0.656 0.677 0.367 2e-14
O49597125 High mobility group B pro no no 0.509 0.64 0.462 4e-14
P27347157 DNA-binding protein MNB1B N/A no 0.477 0.477 0.44 1e-13
P40619144 HMG1/2-like protein OS=Ip N/A no 0.490 0.534 0.415 1e-13
>sp|O64702|HMG14_ARATH High mobility group B protein 14 OS=Arabidopsis thaliana GN=HMGB14 PE=2 SV=2 Back     alignment and function desciption
 Score =  149 bits (376), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%)

Query: 62  LDSKMPKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIA 121
           L +KMPKKP TAFF+FL+DFRK +QE+NPD+KSMR IGK CGEKWKTMTYEEKVKYYDIA
Sbjct: 58  LQTKMPKKPATAFFFFLDDFRKQYQEENPDVKSMREIGKTCGEKWKTMTYEEKVKYYDIA 117

Query: 122 TEKRAEFDRAMADYIKRKENGKVENSEEDSEFDE 155
           TEKR EF RAM +Y KR E+G  + SE DS++ E
Sbjct: 118 TEKREEFHRAMTEYTKRMESGAHDESETDSDYSE 151

Arabidopsis thaliana (taxid: 3702)
>sp|O49595|HMGB1_ARATH High mobility group B protein 1 OS=Arabidopsis thaliana GN=HMGB1 PE=1 SV=1 Back     alignment and function description
>sp|P40620|HMGL_VICFA HMG1/2-like protein OS=Vicia faba PE=2 SV=1 Back     alignment and function description
>sp|P93047|HMGB3_ARATH High mobility group B protein 3 OS=Arabidopsis thaliana GN=HMGB3 PE=1 SV=1 Back     alignment and function description
>sp|Q42344|HMGB4_ARATH High mobility group B protein 4 OS=Arabidopsis thaliana GN=HMGB4 PE=1 SV=1 Back     alignment and function description
>sp|O49596|HMGB2_ARATH High mobility group B protein 2 OS=Arabidopsis thaliana GN=HMGB2 PE=1 SV=1 Back     alignment and function description
>sp|P26585|HMGL_SOYBN HMG1/2-like protein OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|O49597|HMGB5_ARATH High mobility group B protein 5 OS=Arabidopsis thaliana GN=HMGB5 PE=2 SV=1 Back     alignment and function description
>sp|P27347|MNB1B_MAIZE DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1 Back     alignment and function description
>sp|P40619|HMGL_IPONI HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
225463454175 PREDICTED: high mobility group B protein 0.859 0.771 0.676 1e-43
255557355198 DNA-binding protein MNB1B, putative [Ric 0.605 0.479 0.842 4e-41
356524949148 PREDICTED: high mobility group B protein 0.598 0.635 0.744 2e-35
449433698161 PREDICTED: high mobility group B protein 0.611 0.596 0.729 7e-35
351724833150 uncharacterized protein LOC100305607 [Gl 0.598 0.626 0.723 7e-35
224080027165 high mobility group family [Populus tric 0.535 0.509 0.833 2e-34
297826905152 high mobility group family protein [Arab 0.585 0.605 0.752 3e-34
18403553151 high mobility group (HMG1/2) domain-cont 0.598 0.622 0.723 4e-34
388501678152 unknown [Medicago truncatula] 0.668 0.690 0.650 5e-34
388495062162 unknown [Lotus japonicus] 0.745 0.722 0.601 6e-34
>gi|225463454|ref|XP_002275908.1| PREDICTED: high mobility group B protein 14 [Vitis vinifera] gi|297740668|emb|CBI30850.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/139 (67%), Positives = 109/139 (78%), Gaps = 4/139 (2%)

Query: 17  ASNLKMVLRKRPT---RHSVVAAVGIEKEGKSISAKRVTTKLKKKHEKLDSKMPKKPPTA 73
            S  +MVLR R T   + +V+ +   EKE K  S  +   K KK+ +++DSK PKKPPTA
Sbjct: 35  TSTERMVLRVRSTEKIKRAVMESRVSEKEKKPRSGNKAKAKTKKRSQRVDSKKPKKPPTA 94

Query: 74  FFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMA 133
           FFYFLEDFRK FQEQNPD+KSMR IGKACGEKWKTMTYEEKV+YYDIATEKRAEFDRAMA
Sbjct: 95  FFYFLEDFRKEFQEQNPDVKSMRDIGKACGEKWKTMTYEEKVQYYDIATEKRAEFDRAMA 154

Query: 134 DYIKRKENGKVENSEEDSE 152
           DYIKR+E+G+ E   EDSE
Sbjct: 155 DYIKRQESGEDEEI-EDSE 172

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255557355|ref|XP_002519708.1| DNA-binding protein MNB1B, putative [Ricinus communis] gi|223541125|gb|EEF42681.1| DNA-binding protein MNB1B, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356524949|ref|XP_003531090.1| PREDICTED: high mobility group B protein 14-like [Glycine max] Back     alignment and taxonomy information
>gi|449433698|ref|XP_004134634.1| PREDICTED: high mobility group B protein 14-like [Cucumis sativus] gi|449505924|ref|XP_004162605.1| PREDICTED: high mobility group B protein 14-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351724833|ref|NP_001237839.1| uncharacterized protein LOC100305607 [Glycine max] gi|255626057|gb|ACU13373.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224080027|ref|XP_002305996.1| high mobility group family [Populus trichocarpa] gi|222848960|gb|EEE86507.1| high mobility group family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297826905|ref|XP_002881335.1| high mobility group family protein [Arabidopsis lyrata subsp. lyrata] gi|297327174|gb|EFH57594.1| high mobility group family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18403553|ref|NP_565788.1| high mobility group (HMG1/2) domain-containing protein [Arabidopsis thaliana] gi|75219838|sp|O64702.2|HMG14_ARATH RecName: Full=High mobility group B protein 14; AltName: Full=Nucleosome/chromatin assembly factor group D 14 gi|20197083|gb|AAC26692.2| putative HMG protein [Arabidopsis thaliana] gi|20197160|gb|AAM14948.1| putative HMG protein [Arabidopsis thaliana] gi|21536857|gb|AAM61189.1| putative HMG protein [Arabidopsis thaliana] gi|26452914|dbj|BAC43535.1| putative HMG protein [Arabidopsis thaliana] gi|28973511|gb|AAO64080.1| putative HMG protein [Arabidopsis thaliana] gi|330253881|gb|AEC08975.1| high mobility group (HMG1/2) domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388501678|gb|AFK38905.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388495062|gb|AFK35597.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
TAIR|locus:505006135144 HMGB2 "high mobility group B2" 0.566 0.618 0.404 1.4e-16
TAIR|locus:2128003125 HMGB5 "high mobility group B5" 0.547 0.688 0.448 2e-15
TAIR|locus:2053893138 HMGB4 "high mobility group B4" 0.573 0.652 0.417 3.3e-15
RGD|1589841 214 LOC690940 "similar to High mob 0.490 0.359 0.333 4e-12
RGD|1593466 214 LOC689398 "similar to High mob 0.490 0.359 0.333 4e-12
UNIPROTKB|P10103 215 HMGB1 "High mobility group pro 0.490 0.358 0.333 8.3e-12
UNIPROTKB|Q6YKA4 215 HMGB1 "High mobility group pro 0.490 0.358 0.333 8.3e-12
UNIPROTKB|P09429 215 HMGB1 "High mobility group pro 0.490 0.358 0.333 8.3e-12
UNIPROTKB|F2Z594 215 HMGB1 "High mobility group pro 0.490 0.358 0.333 8.3e-12
UNIPROTKB|P12682 215 HMGB1 "High mobility group pro 0.490 0.358 0.333 8.3e-12
TAIR|locus:505006135 HMGB2 "high mobility group B2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 205 (77.2 bits), Expect = 1.4e-16, P = 1.4e-16
 Identities = 36/89 (40%), Positives = 58/89 (65%)

Query:    67 PKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRA 126
             PK+P +AFF F+EDFR+ F+++NP  KS+  +GKA G+KWK+++  EK  Y   A +++ 
Sbjct:    38 PKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKV 97

Query:   127 EFDRAMADYIKRKENGKVENSEEDSEFDE 155
             E+++ +  Y K+ E G  E+ E D    E
Sbjct:    98 EYEKNIKAYNKKLEEGPKEDEESDKSVSE 126
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0000785 "chromatin" evidence=TAS
GO:0003682 "chromatin binding" evidence=TAS
GO:0006333 "chromatin assembly or disassembly" evidence=RCA;TAS
GO:0030527 "structural constituent of chromatin" evidence=TAS
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0003677 "DNA binding" evidence=ISS;IDA
TAIR|locus:2128003 HMGB5 "high mobility group B5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053893 HMGB4 "high mobility group B4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1589841 LOC690940 "similar to High mobility group protein 1 (HMG-1) (High mobility group protein B1) (Amphoterin) (Heparin-binding protein p30)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1593466 LOC689398 "similar to High mobility group protein 1 (HMG-1) (High mobility group protein B1) (Amphoterin) (Heparin-binding protein p30)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P10103 HMGB1 "High mobility group protein B1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6YKA4 HMGB1 "High mobility group protein B1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P09429 HMGB1 "High mobility group protein B1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z594 HMGB1 "High mobility group protein B1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P12682 HMGB1 "High mobility group protein B1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O64702HMG14_ARATHNo assigned EC number0.72340.59870.6225yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 7e-13
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 8e-13
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 2e-12
smart0039870 smart00398, HMG, high mobility group 2e-10
pfam0901169 pfam09011, DUF1898, Domain of unknown function (DU 2e-08
COG5648211 COG5648, NHP6B, Chromatin-associated proteins cont 2e-08
cd0138872 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I 4e-07
cd0138977 cd01389, MATA_HMG-box, MATA_HMG-box, class I membe 0.003
PTZ0019994 PTZ00199, PTZ00199, high mobility group protein; P 0.003
>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information 
 Score = 59.6 bits (145), Expect = 7e-13
 Identities = 24/67 (35%), Positives = 42/67 (62%), Gaps = 1/67 (1%)

Query: 67  PKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRA 126
           PK+P +A+F F ++ R   +++NPD  S+  + K  GEKWK ++ EEK KY + A + + 
Sbjct: 1   PKRPLSAYFLFSQEQRPKLKKENPDA-SVTEVTKILGEKWKELSEEEKKKYEEKAEKDKE 59

Query: 127 EFDRAMA 133
            +++ M 
Sbjct: 60  RYEKEMK 66

These proteins bind the minor groove of DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III members include nucleolar and mitochondrial transcription factors, UBF and mtTF1, which bind four-way DNA junctions. Length = 66
>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) Back     alignment and domain information
>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|238685 cd01389, MATA_HMG-box, MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
PTZ0019994 high mobility group protein; Provisional 99.9
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.83
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.81
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.81
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.8
smart0039870 HMG high mobility group. 99.8
COG5648211 NHP6B Chromatin-associated proteins containing the 99.79
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.78
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.74
KOG038196 consensus HMG box-containing protein [General func 99.72
KOG0527 331 consensus HMG-box transcription factor [Transcript 99.7
KOG0526615 consensus Nucleosome-binding factor SPN, POB3 subu 99.64
KOG4715 410 consensus SWI/SNF-related matrix-associated actin- 99.24
KOG3248 421 consensus Transcription factor TCF-4 [Transcriptio 99.19
KOG0528511 consensus HMG-box transcription factor SOX5 [Trans 99.05
KOG2746 683 consensus HMG-box transcription factor Capicua and 98.48
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 98.11
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 97.19
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 97.13
COG5648211 NHP6B Chromatin-associated proteins containing the 96.69
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 95.65
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 91.78
PF04769201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 89.2
TIGR03481198 HpnM hopanoid biosynthesis associated membrane pro 89.11
PRK15117211 ABC transporter periplasmic binding protein MlaC; 85.99
PF05494170 Tol_Tol_Ttg2: Toluene tolerance, Ttg2 ; InterPro: 82.72
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information 
Probab=99.90  E-value=1.6e-23  Score=148.37  Aligned_cols=79  Identities=30%  Similarity=0.644  Sum_probs=74.3

Q ss_pred             hcccCCCCCCCCCCchhHhHHHHHHHHHHHhCCCCC-cHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHHHHH
Q 031573           58 KHEKLDSKMPKKPPTAFFYFLEDFRKGFQEQNPDIK-SMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMADYI  136 (157)
Q Consensus        58 kk~~~dp~~PKrP~sAy~lF~~e~r~~ik~~~P~~~-~~~ei~k~lge~Wk~ls~eeK~~y~~~A~~~k~~y~~~~~~Y~  136 (157)
                      +++.+||+.||||+||||||+.++|..|..+||++. .+.+|+++||++|+.|++++|.+|+++|..++.+|..+|.+|.
T Consensus        14 ~k~~kdp~~PKrP~sAY~~F~~~~R~~i~~~~P~~~~~~~evsk~ige~Wk~ls~eeK~~y~~~A~~dk~rY~~e~~~Y~   93 (94)
T PTZ00199         14 KRKKKDPNAPKRALSAYMFFAKEKRAEIIAENPELAKDVAAVGKMVGEAWNKLSEEEKAPYEKKAQEDKVRYEKEKAEYA   93 (94)
T ss_pred             CCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCcCCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            345789999999999999999999999999999982 3899999999999999999999999999999999999999995

>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>KOG0381 consensus HMG box-containing protein [General function prediction only] Back     alignment and domain information
>KOG0527 consensus HMG-box transcription factor [Transcription] Back     alignment and domain information
>KOG0526 consensus Nucleosome-binding factor SPN, POB3 subunit [Transcription; Replication, recombination and repair; Chromatin structure and dynamics] Back     alignment and domain information
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3248 consensus Transcription factor TCF-4 [Transcription] Back     alignment and domain information
>KOG0528 consensus HMG-box transcription factor SOX5 [Transcription] Back     alignment and domain information
>KOG2746 consensus HMG-box transcription factor Capicua and related proteins [Transcription] Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM Back     alignment and domain information
>PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional Back     alignment and domain information
>PF05494 Tol_Tol_Ttg2: Toluene tolerance, Ttg2 ; InterPro: IPR008869 Toluene tolerance is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
2yqi_A81 Solution Structure Of The Second Hmg-Box Domain Fro 3e-07
2ly4_A83 Hmgb1-Facilitated P53 Dna Binding Occurs Via Hmg-Bo 5e-06
2lhj_A97 Nmr Structure Of The High Mobility Group Protein-Li 6e-06
1aab_A83 Nmr Structure Of Rat Hmg1 Hmga Fragment Length = 83 6e-06
2yrq_A173 Solution Structure Of The Tandem Hmg Box Domain Fro 1e-05
2eqz_A86 Solution Structure Of The First Hmg-Box Domain From 1e-05
1wxl_A73 Solution Structure Of The Hmg-Box Domain In The Ssr 3e-05
1j3x_A77 Solution Structure Of The N-Terminal Domain Of The 3e-05
1ckt_A71 Crystal Structure Of Hmg1 Domain A Bound To A Cispl 5e-05
1cg7_A93 Hmg Protein Nhp6a From Saccharomyces Cerevisiae Len 9e-05
1j5n_A93 Solution Structure Of The Non-Sequence-Specific Hmg 9e-05
1j3c_A79 Solution Structure Of The C-Terminal Domain Of The 3e-04
1nhm_A81 The Structure Of The Hmg Box And Its Interaction Wi 4e-04
1hsm_A79 The Structure Of The Hmg Box And Its Interaction Wi 5e-04
1hme_A77 Structure Of The Hmg Box Motif In The B-Domain Of H 7e-04
2gzk_A159 Structure Of A Complex Of Tandem Hmg Boxes And Dna 7e-04
1j3d_A78 Solution Structure Of The C-Terminal Domain Of The 7e-04
2yul_A82 Solution Structure Of The Hmg Box Of Human Transcri 7e-04
2lef_A86 Lef1 Hmg Domain (From Mouse), Complexed With Dna (1 8e-04
>pdb|2YQI|A Chain A, Solution Structure Of The Second Hmg-Box Domain From High Mobility Group Protein B3 Length = 81 Back     alignment and structure 
Iteration: 1

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
Query: 67  PKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRA 126
           PK+PP+ FF F  +FR   +  NP I S+  + K  GE W  +   EK  Y   A + + 
Sbjct: 10  PKRPPSGFFLFCSEFRPKIKSTNPGI-SIGDVAKKLGEMWNNLNDSEKQPYITKAAKLKE 68
Query: 127 EFDRAMADY 135
           ++++ +ADY
Sbjct: 69  KYEKDVADY 77
>pdb|2LY4|A Chain A, Hmgb1-Facilitated P53 Dna Binding Occurs Via Hmg-BoxP53 Transactivation Domain Interaction And Is Regulated By The Acidic Tail Length = 83 Back     alignment and structure
>pdb|2LHJ|A Chain A, Nmr Structure Of The High Mobility Group Protein-Like Protein Nhp1 From Babesia Bovis T2bo (Baboa.00841.A) Length = 97 Back     alignment and structure
>pdb|1AAB|A Chain A, Nmr Structure Of Rat Hmg1 Hmga Fragment Length = 83 Back     alignment and structure
>pdb|2YRQ|A Chain A, Solution Structure Of The Tandem Hmg Box Domain From Human High Mobility Group Protein B1 Length = 173 Back     alignment and structure
>pdb|2EQZ|A Chain A, Solution Structure Of The First Hmg-Box Domain From High Mobility Group Protein B3 Length = 86 Back     alignment and structure
>pdb|1WXL|A Chain A, Solution Structure Of The Hmg-Box Domain In The Ssrp1 Subunit Of Fact Length = 73 Back     alignment and structure
>pdb|1J3X|A Chain A, Solution Structure Of The N-Terminal Domain Of The Hmgb2 Length = 77 Back     alignment and structure
>pdb|1CKT|A Chain A, Crystal Structure Of Hmg1 Domain A Bound To A Cisplatin-modified Dna Duplex Length = 71 Back     alignment and structure
>pdb|1CG7|A Chain A, Hmg Protein Nhp6a From Saccharomyces Cerevisiae Length = 93 Back     alignment and structure
>pdb|1J5N|A Chain A, Solution Structure Of The Non-Sequence-Specific Hmgb Protein Nhp6a In Complex With Sry Dna Length = 93 Back     alignment and structure
>pdb|1J3C|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 79 Back     alignment and structure
>pdb|1NHM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 81 Back     alignment and structure
>pdb|1HSM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 79 Back     alignment and structure
>pdb|1HME|A Chain A, Structure Of The Hmg Box Motif In The B-Domain Of Hmg1 Length = 77 Back     alignment and structure
>pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 Back     alignment and structure
>pdb|1J3D|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 78 Back     alignment and structure
>pdb|2YUL|A Chain A, Solution Structure Of The Hmg Box Of Human Transcription Factor Sox-17 Length = 82 Back     alignment and structure
>pdb|2LEF|A Chain A, Lef1 Hmg Domain (From Mouse), Complexed With Dna (15bp), Nmr, 12 Structures Length = 86 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 5e-18
2lhj_A97 High mobility group protein homolog NHP1; structur 1e-17
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 2e-17
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 4e-17
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 7e-17
1hme_A77 High mobility group protein fragment-B; DNA-bindin 8e-17
1ckt_A71 High mobility group 1 protein; high-mobility group 6e-16
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 5e-15
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 1e-14
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 2e-14
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 3e-14
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 3e-14
2yrq_A173 High mobility group protein B1; HMG box domain, DN 4e-13
2yrq_A173 High mobility group protein B1; HMG box domain, DN 1e-09
1wgf_A90 Upstream binding factor 1; transcription factor, D 8e-13
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 4e-12
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 1e-11
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 1e-09
3tmm_A 238 Transcription factor A, mitochondrial; HMG, high m 3e-10
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 5e-06
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 1e-09
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 3e-09
3tq6_A 214 Transcription factor A, mitochondrial; transcripti 4e-09
3tq6_A214 Transcription factor A, mitochondrial; transcripti 2e-05
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 4e-09
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 2e-07
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 4e-07
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 5e-07
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 1e-06
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 1e-06
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 1e-06
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 2e-06
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 3e-06
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 3e-06
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 1e-05
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 1e-05
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
 Score = 73.1 bits (180), Expect = 5e-18
 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 53  TKLKKKHEKLDSKMPKKPPTAFFYFLEDFRKGFQEQNPDIK-SMRAIGKACGEKWKTMTY 111
           +       K D K PK   +A+ +F++  R+  +++NP++  +     K C E+WKTM+ 
Sbjct: 2   SSGSSGMAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSG 61

Query: 112 EEKVKYYDIATEKRAEFDRAMADY 135
           +EK K+ ++A   +  +DR M DY
Sbjct: 62  KEKSKFDEMAKADKVRYDREMKDY 85
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.93
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.91
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.9
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.9
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.9
2lhj_A97 High mobility group protein homolog NHP1; structur 99.89
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.89
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.89
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.89
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.89
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.88
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.88
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.88
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.87
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.87
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.86
1ckt_A71 High mobility group 1 protein; high-mobility group 99.86
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.86
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.86
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.86
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.86
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.86
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.85
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.85
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.85
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.85
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.85
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.85
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.82
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.82
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.82
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.82
3tmm_A 238 Transcription factor A, mitochondrial; HMG, high m 99.79
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.78
3tq6_A 214 Transcription factor A, mitochondrial; transcripti 99.78
2cto_A93 Novel protein; high mobility group box domain, hel 99.78
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.75
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.74
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.69
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
Probab=99.93  E-value=4.3e-25  Score=157.07  Aligned_cols=93  Identities=24%  Similarity=0.412  Sum_probs=86.8

Q ss_pred             hcccCCCCCCCCCCchhHhHHHHHHHHHHHhCCCCCcHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 031573           58 KHEKLDSKMPKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMADYIK  137 (157)
Q Consensus        58 kk~~~dp~~PKrP~sAy~lF~~e~r~~ik~~~P~~~~~~ei~k~lge~Wk~ls~eeK~~y~~~A~~~k~~y~~~~~~Y~~  137 (157)
                      +++.+||++||||+||||||++++|..|+.+||++ ++.+|+++||++|+.|++++|++|.++|..++++|..+|.+|+.
T Consensus         9 kk~~kdp~~pKrP~say~lF~~~~r~~i~~~~P~~-~~~eisk~lg~~Wk~ls~eeK~~Y~~~A~~~k~~y~~e~~~Y~~   87 (102)
T 2co9_A            9 KKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNA-TFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRA   87 (102)
T ss_dssp             CSSCCCCCSCCCCCCHHHHTHHHHHHHHHHHCTTS-CHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC-CHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            34568999999999999999999999999999999 99999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCCCCcCCC
Q 031573          138 RKENGKVENSEEDS  151 (157)
Q Consensus       138 ~~~~~~~~~~e~~~  151 (157)
                      .+......+.+-.+
T Consensus        88 ~~~~~~~~e~~~~~  101 (102)
T 2co9_A           88 SLVSKSYTDSGPSS  101 (102)
T ss_dssp             HHTSSCCCCCSTTC
T ss_pred             hcccccccccccCC
Confidence            99998877766543
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 4e-11
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 5e-11
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 2e-10
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 6e-10
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 1e-09
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 1e-09
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-09
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 4e-09
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 4e-09
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 6e-09
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-08
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 3e-07
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: High mobility group protein 1, HMG1
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 53.3 bits (128), Expect = 4e-11
 Identities = 21/70 (30%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 67  PKKPPTAFFYFLEDFRKGFQEQNPDIK-SMRAIGKACGEKWKTMTYEEKVKYYDIATEKR 125
           P+   +++ +F++  R+  ++++PD   +     K C E+WKTM+ +EK K+ D+A   +
Sbjct: 2   PRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADK 61

Query: 126 AEFDRAMADY 135
           A ++R M  Y
Sbjct: 62  ARYEREMKTY 71
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.9
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.89
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.87
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.86
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.86
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.84
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.82
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.81
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.8
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.78
d1l8ya_84 Nucleolar transcription factor 1 (Upstream binding 96.46
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.90  E-value=6.4e-24  Score=147.08  Aligned_cols=81  Identities=31%  Similarity=0.550  Sum_probs=77.5

Q ss_pred             hcccCCCCCCCCCCchhHhHHHHHHHHHHHhCCCCCcHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 031573           58 KHEKLDSKMPKKPPTAFFYFLEDFRKGFQEQNPDIKSMRAIGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRAMADYIK  137 (157)
Q Consensus        58 kk~~~dp~~PKrP~sAy~lF~~e~r~~ik~~~P~~~~~~ei~k~lge~Wk~ls~eeK~~y~~~A~~~k~~y~~~~~~Y~~  137 (157)
                      .+..++|+.||||+|||+||+.++|.+|+.+||++ ++.+|++.||++|+.|++++|.+|.+.|..++.+|..+|..|+.
T Consensus        12 ~k~~k~p~~PKrP~saf~lF~~e~r~~ik~~~p~~-~~~ei~k~l~~~W~~ls~~eK~~y~~~a~~~k~~y~~e~~~y~~   90 (93)
T d1lwma_          12 TRKKKDPNAPKRALSAYMFFANENRDIVRSENPDI-TFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNA   90 (93)
T ss_dssp             CSCCCCSSCCCCCCCHHHHHHHHHHHHHHHHCTTS-CHHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccCCCCcCCCCCCCCHHHHHHHHHHHHHHHhCCCC-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            34567999999999999999999999999999999 99999999999999999999999999999999999999999998


Q ss_pred             hh
Q 031573          138 RK  139 (157)
Q Consensus       138 ~~  139 (157)
                      ++
T Consensus        91 ~l   92 (93)
T d1lwma_          91 TL   92 (93)
T ss_dssp             HH
T ss_pred             cc
Confidence            76
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure