Citrus Sinensis ID: 031936

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MSLMSSSASTVSVTVDAQLNESVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSALFEIGCSQSVETNKFKDLLVRVQDGRAISKEDINGGLKARKLIVNQMCKGYSVSNALKKEESLLLI
cccccHHHHHHHccccHHHHHHHHHHHcccccEEEEEEEccEEEEcHHHHHHHHcccHHHHHHHHccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHcccccEEEEEEEEEEEEcccccccccccc
cccHcHHHHHccccccHEEEHHHEEEEccccEEEEEEccccEEEEcHHHHHHHHcccHHEEEEEcccccccccHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHcEEEHHHEccEEccccccccHHEHcc
mslmsssastVSVTVDAQLNESVIKKFGlfvglpaqdikrETRVLTDEGKKYAAEGSSEIQLFLAvpaecsilkdelqkkpdsalfeigcsqsvetnKFKDLLVRVQdgraiskedingGLKARKLIVNQMCKGYSVSNALKKEESLLLI
mslmsssastvSVTVDAQLNESVIKKfglfvglpaqdikRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSALFEIGcsqsvetnkfkDLLVRVQDgraiskedingglkarKLIVNQMCKgysvsnalkkeesllli
MSLMsssastvsvtvDAQLNESVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSALFEIGCSQSVETNKFKDLLVRVQDGRAISKEDINGGLKARKLIVNQMCKGYSVSNALKKEESLLLI
************VTVDAQLNESVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSALFEIGCSQSVETNKFKDLLVRVQDGRAISKEDINGGLKARKLIVNQMCKGYSV*************
*S*MSSSASTVSVTVDAQLNESVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAE*************SALFEIGCSQSVETNKFKDLLVR*************GGLKARKLIVNQMCKGYSVSNALKKEE*LLLI
************VTVDAQLNESVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSALFEIGCSQSVETNKFKDLLVRVQDGRAISKEDINGGLKARKLIVNQMCKGYSVSNALKKEESLLLI
*SLMSSSASTVSVTVDAQLNESVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSALFEIGCSQSVETNKFKDLLVRVQDGRAISKEDINGGLKARKLIVNQMCKGYSVSNALKKEES**LI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLMSSSASTVSVTVDAQLNESVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSALFEIGCSQSVETNKFKDLLVRVQDGRAISKEDINGGLKARKLIVNQMCKGYSVSNALKKEESLLLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q9T034 485 Probable phenylalanine--t yes no 0.766 0.237 0.556 3e-27
>sp|Q9T034|SYFA_ARATH Probable phenylalanine--tRNA ligase alpha subunit OS=Arabidopsis thaliana GN=At4g39280 PE=2 SV=3 Back     alignment and function desciption
 Score =  120 bits (301), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 74/133 (55%), Positives = 89/133 (66%), Gaps = 18/133 (13%)

Query: 22  SVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKP 81
           +VIK    F  +  QDIK+ET +LTDEGKKYAAEGS E+QLFLAVP E SI KDELQKK 
Sbjct: 35  NVIKSLHGFRYIDVQDIKKETWILTDEGKKYAAEGSPEVQLFLAVPEEGSISKDELQKKL 94

Query: 82  DSALFEIGCSQS-----VE-----TNKFKDL-------LVRVQDGRAISKEDINGGLKAR 124
             A+F+IGCSQ+     VE     + K KD+       L+++Q G+   KE IN  LKAR
Sbjct: 95  APAVFKIGCSQAGKNKWVEMGKQVSRKVKDVEDKVKGQLLQIQQGKEFDKESIN-SLKAR 153

Query: 125 KLIVNQMCKGYSV 137
           KLIV Q+ KGYSV
Sbjct: 154 KLIVPQIWKGYSV 166

Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 0

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
255536841 492 phenylalanyl-tRNA synthetase beta chain, 0.766 0.233 0.556 4e-26
22329256 485 phenylalanyl-tRNA synthetase alpha chain 0.766 0.237 0.556 2e-25
334187316 485 phenylalanyl-tRNA synthetase alpha chain 0.766 0.237 0.556 2e-25
224105393 484 predicted protein [Populus trichocarpa] 0.766 0.237 0.518 3e-25
224077834 492 predicted protein [Populus trichocarpa] 0.766 0.233 0.518 3e-25
297802028 485 hypothetical protein ARALYDRAFT_912388 [ 0.766 0.237 0.541 1e-24
356538771 493 PREDICTED: probable phenylalanyl-tRNA sy 0.76 0.231 0.477 1e-21
255640993 349 unknown [Glycine max] 0.76 0.326 0.477 1e-21
356545225 488 PREDICTED: probable phenylalanyl-tRNA sy 0.76 0.233 0.485 1e-21
356564085 493 PREDICTED: probable phenylalanyl-tRNA sy 0.766 0.233 0.466 1e-21
>gi|255536841|ref|XP_002509487.1| phenylalanyl-tRNA synthetase beta chain, putative [Ricinus communis] gi|223549386|gb|EEF50874.1| phenylalanyl-tRNA synthetase beta chain, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 74/133 (55%), Positives = 89/133 (66%), Gaps = 18/133 (13%)

Query: 22  SVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKP 81
           +V+K    F  +  QDIKRET VLTDEG+KYA EGS E+QLFLAVP E SI KDELQKK 
Sbjct: 35  NVLKSLFGFRFVDVQDIKRETWVLTDEGRKYADEGSPEVQLFLAVPPEGSISKDELQKKL 94

Query: 82  DSALFEIGCSQS-----VET------------NKFKDLLVRVQDGRAISKEDINGGLKAR 124
           D A+F+IGCSQ+     VE             +K K LL++++DG+ I K+ IN  LKAR
Sbjct: 95  DPAVFKIGCSQAGKNKWVEMGKQISRKVQNVEDKVKHLLLQIRDGKEIDKDGIN-SLKAR 153

Query: 125 KLIVNQMCKGYSV 137
           KLIV Q  KGYSV
Sbjct: 154 KLIVLQTWKGYSV 166

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|22329256|ref|NP_195639.2| phenylalanyl-tRNA synthetase alpha chain [Arabidopsis thaliana] gi|30316394|sp|Q9T034.3|SYFA_ARATH RecName: Full=Probable phenylalanine--tRNA ligase alpha subunit; AltName: Full=Phenylalanyl-tRNA synthetase alpha subunit; Short=PheRS gi|20453179|gb|AAM19830.1| AT4g39280/T22F8_180 [Arabidopsis thaliana] gi|25141225|gb|AAN73307.1| At4g39280/T22F8_180 [Arabidopsis thaliana] gi|332661650|gb|AEE87050.1| phenylalanyl-tRNA synthetase alpha chain [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334187316|ref|NP_001190964.1| phenylalanyl-tRNA synthetase alpha chain [Arabidopsis thaliana] gi|332661651|gb|AEE87051.1| phenylalanyl-tRNA synthetase alpha chain [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224105393|ref|XP_002313796.1| predicted protein [Populus trichocarpa] gi|222850204|gb|EEE87751.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224077834|ref|XP_002305428.1| predicted protein [Populus trichocarpa] gi|222848392|gb|EEE85939.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297802028|ref|XP_002868898.1| hypothetical protein ARALYDRAFT_912388 [Arabidopsis lyrata subsp. lyrata] gi|297314734|gb|EFH45157.1| hypothetical protein ARALYDRAFT_912388 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356538771|ref|XP_003537874.1| PREDICTED: probable phenylalanyl-tRNA synthetase alpha chain-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|255640993|gb|ACU20776.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356545225|ref|XP_003541045.1| PREDICTED: probable phenylalanyl-tRNA synthetase alpha chain-like [Glycine max] Back     alignment and taxonomy information
>gi|356564085|ref|XP_003550287.1| PREDICTED: probable phenylalanyl-tRNA synthetase alpha chain-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
TAIR|locus:2136328 485 AT4G39280 [Arabidopsis thalian 0.766 0.237 0.533 1.1e-21
TAIR|locus:2136328 AT4G39280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 259 (96.2 bits), Expect = 1.1e-21, P = 1.1e-21
 Identities = 71/133 (53%), Positives = 87/133 (65%)

Query:    22 SVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKP 81
             +VIK    F  +  QDIK+ET +LTDEGKKYAAEGS E+QLFLAVP E SI KDELQKK 
Sbjct:    35 NVIKSLHGFRYIDVQDIKKETWILTDEGKKYAAEGSPEVQLFLAVPEEGSISKDELQKKL 94

Query:    82 DSALFEIGCSQS-----VE-----TNKFKDLLVRVQDGRAIS----KE---DINGGLKAR 124
               A+F+IGCSQ+     VE     + K KD+  +V+ G+ +     KE   +    LKAR
Sbjct:    95 APAVFKIGCSQAGKNKWVEMGKQVSRKVKDVEDKVK-GQLLQIQQGKEFDKESINSLKAR 153

Query:   125 KLIVNQMCKGYSV 137
             KLIV Q+ KGYSV
Sbjct:   154 KLIVPQIWKGYSV 166


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.315   0.133   0.357    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      150       139   0.00091  102 3  11 22  0.46    31
                                                     30  0.46    33


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  495 (53 KB)
  Total size of DFA:  103 KB (2073 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  14.03u 0.16s 14.19t   Elapsed:  00:00:01
  Total cpu time:  14.03u 0.16s 14.19t   Elapsed:  00:00:01
  Start:  Fri May 10 07:44:38 2013   End:  Fri May 10 07:44:39 2013
GO:0000049 "tRNA binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004812 "aminoacyl-tRNA ligase activity" evidence=IEA
GO:0004826 "phenylalanine-tRNA ligase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0006418 "tRNA aminoacylation for protein translation" evidence=IEA
GO:0006432 "phenylalanyl-tRNA aminoacylation" evidence=IEA;ISS
GO:0043039 "tRNA aminoacylation" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_IX0484
phenylalanyl-tRNA synthetase alpha chain (EC-6.1.1.20) (484 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_1450059
phenylalanine-tRNA ligase (EC-6.1.1.20) (596 aa)
• ••••• 0.992
estExt_Genewise1_v1.C_LG_XIII2276
phenylalanine-tRNA ligase (EC-6.1.1.20) (599 aa)
• ••••• 0.990
estExt_Genewise1_v1.C_LG_IX0414
SubName- Full=Putative uncharacterized protein; (404 aa)
•  •  • 0.955
eugene3.00021932
SubName- Full=Putative uncharacterized protein; (498 aa)
   •  • 0.800
gw1.XIX.1762.1
histidine-tRNA ligase (475 aa)
   •  • 0.793
gw1.28.724.1
histidine-tRNA ligase (EC-6.1.1.21) (441 aa)
      • 0.778
gw1.XIV.2092.1
hypothetical protein (507 aa)
   •  • 0.774
gw1.X.3221.1
hypothetical protein (345 aa)
•  •  • 0.769
fgenesh4_pm.C_LG_VIII000033
hypothetical protein (352 aa)
•  •  • 0.762
gw1.VIII.2106.1
threonine-tRNA ligase (EC-6.1.1.3) (669 aa)
•  •  • 0.736

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
PLN02853 492 PLN02853, PLN02853, Probable phenylalanyl-tRNA syn 3e-34
PTZ00326 494 PTZ00326, PTZ00326, phenylalanyl-tRNA synthetase a 3e-07
PRK04172 489 PRK04172, pheS, phenylalanyl-tRNA synthetase subun 0.001
>gnl|CDD|215458 PLN02853, PLN02853, Probable phenylalanyl-tRNA synthetase alpha chain Back     alignment and domain information 
 Score =  124 bits (313), Expect = 3e-34
 Identities = 68/144 (47%), Positives = 86/144 (59%), Gaps = 21/144 (14%)

Query: 15  VDAQLNESVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILK 74
           +D      VIK    F  + AQDIKRET VLT+EGKKYAAEGS E+QLF AVPAE SI K
Sbjct: 30  LDHNEVVGVIKSLHGFRYVDAQDIKRETWVLTEEGKKYAAEGSPEVQLFAAVPAEGSISK 89

Query: 75  DELQKKPDSALFEIGCSQ--------------------SVETNKFKDLLVRVQDGRAISK 114
           DELQKK D A+F+IG  Q                     VE ++ K+LL+ +Q+G+ +  
Sbjct: 90  DELQKKLDPAVFDIGFKQAMKNKWLEMGGKPQVSRKVQHVE-DEVKELLLAIQEGKEVDD 148

Query: 115 EDINGGLKARKLIVNQMCKGYSVS 138
           +DI+   K RKLI  +  KGYS+ 
Sbjct: 149 KDIDALKKRRKLITLETWKGYSIK 172

Length = 492
>gnl|CDD|240361 PTZ00326, PTZ00326, phenylalanyl-tRNA synthetase alpha chain; Provisional Back     alignment and domain information
>gnl|CDD|235239 PRK04172, pheS, phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
PLN02853 492 Probable phenylalanyl-tRNA synthetase alpha chain 99.96
PTZ00326 494 phenylalanyl-tRNA synthetase alpha chain; Provisio 99.95
KOG2784 483 consensus Phenylalanyl-tRNA synthetase, beta subun 99.95
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 99.87
PF0355175 PadR: Transcriptional regulator PadR-like family; 97.18
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 96.91
PTZ00034124 40S ribosomal protein S10; Provisional 96.47
PF0350195 S10_plectin: Plectin/S10 domain; InterPro: IPR0053 96.41
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 96.39
TIGR03433100 padR_acidobact transcriptional regulator, Acidobac 96.18
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 96.16
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 96.1
COG1846126 MarR Transcriptional regulators [Transcription] 95.81
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 95.79
COG5045105 Ribosomal protein S10E [Translation, ribosomal str 95.65
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 95.56
PRK03573144 transcriptional regulator SlyA; Provisional 95.54
TIGR02719138 repress_PhaQ poly-beta-hydroxybutyrate-responsive 95.45
COG1695138 Predicted transcriptional regulators [Transcriptio 95.4
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory 95.34
PRK10870176 transcriptional repressor MprA; Provisional 95.3
PRK09416135 lstR lineage-specific thermal regulator protein; P 95.07
PRK03902142 manganese transport transcriptional regulator; Pro 94.97
PRK14165217 winged helix-turn-helix domain-containing protein/ 94.2
COG4754157 Uncharacterized conserved protein [Function unknow 94.16
COG343295 Predicted transcriptional regulator [Transcription 93.89
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 93.85
PF0163890 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002 93.8
COG1497260 Predicted transcriptional regulator [Transcription 93.13
KOG3344150 consensus 40s ribosomal protein s10 [Translation, 92.97
TIGR02277 280 PaaX_trns_reg phenylacetic acid degradation operon 92.9
PRK13777185 transcriptional regulator Hpr; Provisional 92.59
PF1077165 DUF2582: Protein of unknown function (DUF2582); In 92.13
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 92.12
COG1321154 TroR Mn-dependent transcriptional regulator [Trans 91.53
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 91.33
PF09821120 AAA_assoc_C: C-terminal AAA-associated domain; Int 91.3
PF0738190 DUF1495: Winged helix DNA-binding domain (DUF1495) 91.29
PRK11050152 manganese transport regulator MntR; Provisional 91.2
PF0784870 PaaX: PaaX-like protein; InterPro: IPR012906 This 91.16
PF0012660 HTH_1: Bacterial regulatory helix-turn-helix prote 90.65
PF1000792 DUF2250: Uncharacterized protein conserved in arch 90.36
PF14277163 DUF4364: Domain of unknown function (DUF4364) 90.17
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 89.77
COG1733120 Predicted transcriptional regulators [Transcriptio 89.75
PRK11242 296 DNA-binding transcriptional regulator CynR; Provis 89.7
TIGR02702203 SufR_cyano iron-sulfur cluster biosynthesis transc 89.03
TIGR0264777 DNA conserved hypothetical protein TIGR02647. Memb 88.41
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 88.26
PRK03601 275 transcriptional regulator HdfR; Provisional 87.94
TIGR02036 302 dsdC D-serine deaminase transcriptional activator. 87.28
PRK11062 296 nhaR transcriptional activator NhaR; Provisional 87.01
TIGR03339 279 phn_lysR aminoethylphosphonate catabolism associat 86.31
PF09382106 RQC: RQC domain; InterPro: IPR018982 This entry re 86.2
COG4742260 Predicted transcriptional regulator [Transcription 86.15
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 85.86
PRK10341 312 DNA-binding transcriptional activator TdcA; Provis 85.58
TIGR02424 300 TF_pcaQ pca operon transcription factor PcaQ. Memb 85.56
PRK05638442 threonine synthase; Validated 85.38
PRK11233 305 nitrogen assimilation transcriptional regulator; P 84.85
PRK10094 308 DNA-binding transcriptional activator AllS; Provis 84.83
PRK10837 290 putative DNA-binding transcriptional regulator; Pr 84.78
PF1433892 Mrr_N: Mrr N-terminal domain 84.77
PRK15421 317 DNA-binding transcriptional regulator MetR; Provis 84.68
TIGR03418 291 chol_sulf_TF putative choline sulfate-utilization 84.61
PF04458 591 DUF505: Protein of unknown function (DUF505); Inte 84.15
COG1339214 Transcriptional regulator of a riboflavin/FAD bios 83.75
TIGR0063799 ModE_repress ModE molybdate transport repressor do 83.68
PRK14997 301 LysR family transcriptional regulator; Provisional 83.17
PRK09986 294 DNA-binding transcriptional activator XapR; Provis 83.16
PRK11013 309 DNA-binding transcriptional regulator LysR; Provis 82.93
PRK09791 302 putative DNA-binding transcriptional regulator; Pr 82.73
PRK09906 296 DNA-binding transcriptional regulator HcaR; Provis 82.62
PRK10632 309 transcriptional regulator; Provisional 82.58
PRK10082 303 cell density-dependent motility repressor; Provisi 82.55
PRK12682 309 transcriptional regulator CysB-like protein; Revie 82.51
PRK15092 310 DNA-binding transcriptional repressor LrhA; Provis 82.35
PRK09801 310 transcriptional activator TtdR; Provisional 82.24
PF04458591 DUF505: Protein of unknown function (DUF505); Inte 82.18
PRK15243 297 transcriptional regulator SpvR; Provisional 81.51
PRK10086 311 DNA-binding transcriptional regulator DsdC; Provis 81.26
PF1131385 DUF3116: Protein of unknown function (DUF3116); In 80.75
COG1542 593 Uncharacterized conserved protein [Function unknow 80.57
PF05158 327 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter 80.47
PRK11074 300 putative DNA-binding transcriptional regulator; Pr 80.43
PRK11139 297 DNA-binding transcriptional activator GcvA; Provis 80.29
>PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain Back     alignment and domain information 
Probab=99.96  E-value=1.4e-28  Score=214.90  Aligned_cols=138  Identities=49%  Similarity=0.666  Sum_probs=125.1

Q ss_pred             ccccccCCChHHHHHHHHhhccCCceEEeeEeeeEEEcCHhHHHHHHcCChHHHHHhhcccCCCCChHHHhcCCCchhhh
Q 031936            8 ASTVSVTVDAQLNESVIKKFGLFVGLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSALFE   87 (150)
Q Consensus         8 ~~~~~~~~~~~~v~~~l~sL~~kglI~~e~~~~~~~~LTeEG~~yl~~GsPE~rl~~~l~~~g~~~~~eL~~~lg~~~~k   87 (150)
                      .-|...|++|++|+++++||+++|+|++++.+.+.|+||+||++|+++||||+||+++|+++|+++++||.+.+++++++
T Consensus        23 ~la~~~g~~~~~v~~~~~~L~~kg~v~~~~~~~~~~~LT~eG~~~l~~G~PE~rl~~~l~~~~~~~~~eL~~~l~~~~~~  102 (492)
T PLN02853         23 QFAASHGLDHNEVVGVIKSLHGFRYVDAQDIKRETWVLTEEGKKYAAEGSPEVQLFAAVPAEGSISKDELQKKLDPAVFD  102 (492)
T ss_pred             HHHHHcCCCHHHHHHHHHHHHhCCCEEEEEEEEEEEEECHHHHHHHHcCCHHHHHHHHHhhcCCccHHHHHHhhCchhHH
Confidence            34567899999999999999999999999999999999999999999999999999999874548999999989867899


Q ss_pred             hHhhhhhc-------------------chHHHHHHHHHhcCCCCCHhhHHhHhhhcC-ceeeEEEEEEEEecCCCchhh
Q 031936           88 IGCSQSVE-------------------TNKFKDLLVRVQDGRAISKEDINGGLKARK-LIVNQMCKGYSVSNALKKEES  146 (150)
Q Consensus        88 Ig~g~a~K-------------------~d~~~~~L~~i~~g~~~~~~~l~~~LKKRk-Li~~~~~~~~~V~kg~~f~~~  146 (150)
                      ||+|||+|                   .|.++..|+.+..+..++++.+ ++||||| ||+.++.++|.|++|++|++.
T Consensus       103 i~~g~a~k~gwi~i~~~~~v~~~~~~~~d~~~~~L~~l~~~~~~~~~~l-~~LkkRk~Li~~~~~~~~~v~~~~~~~~~  180 (492)
T PLN02853        103 IGFKQAMKNKWLEMGGKPQVSRKVQHVEDEVKELLLAIQEGKEVDDKDI-DALKKRRKLITLETWKGYSIKKGPNYAPE  180 (492)
T ss_pred             HHHHHHHHCCcEEECCCCcEEeccCccchHHHHHHHHHhcCCCCCHHHH-HHHHhhhcceEEEEEEEEEEEECCccccc
Confidence            99999999                   4667889999987766777789 9999998 999999999999999999753

>PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional Back     alignment and domain information
>KOG2784 consensus Phenylalanyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PF03551 PadR: Transcriptional regulator PadR-like family; InterPro: IPR005149 Phenolic acids, also called substituted hydroxycinnamic acids, are abundant in the plant kingdom because they are involved in the structure of plant cell walls and are present in some vacuoles Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>PTZ00034 40S ribosomal protein S10; Provisional Back     alignment and domain information
>PF03501 S10_plectin: Plectin/S10 domain; InterPro: IPR005326 This presumed domain is found at the N terminus of some isoforms of the cytoskeletal muscle protein plectin as well as the ribosomal S10 protein Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>TIGR03433 padR_acidobact transcriptional regulator, Acidobacterial, PadR-family Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>COG5045 Ribosomal protein S10E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>TIGR02719 repress_PhaQ poly-beta-hydroxybutyrate-responsive repressor Back     alignment and domain information
>COG1695 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>PRK09416 lstR lineage-specific thermal regulator protein; Provisional Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>COG4754 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3432 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>PF01638 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002577 The hxlR-type HTH domain is a domain of ~90-100 amino acids present in putative transcription regulators with a winged helix-turn-helix (wHTH) structure Back     alignment and domain information
>COG1497 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>KOG3344 consensus 40s ribosomal protein s10 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02277 PaaX_trns_reg phenylacetic acid degradation operon negative regulatory protein PaaX Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>PF10771 DUF2582: Protein of unknown function (DUF2582); InterPro: IPR019707 This entry represents conserved proteins found in bacteria and archaea Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PF09821 AAA_assoc_C: C-terminal AAA-associated domain; InterPro: IPR018632 Members of this family are found in various prokaryotic ABC transporters, predominantly involved in nitrate, sulphonate and bicarbonate translocation Back     alignment and domain information
>PF07381 DUF1495: Winged helix DNA-binding domain (DUF1495); InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PF07848 PaaX: PaaX-like protein; InterPro: IPR012906 This entry describes the N-terminal region of proteins that are similar to, and nclude, the product of the paaX gene of Escherichia coli (P76086 from SWISSPROT) Back     alignment and domain information
>PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF10007 DUF2250: Uncharacterized protein conserved in archaea (DUF2250); InterPro: IPR019254 Members of this family of hypothetical archaeal proteins have no known function Back     alignment and domain information
>PF14277 DUF4364: Domain of unknown function (DUF4364) Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>COG1733 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>TIGR02647 DNA conserved hypothetical protein TIGR02647 Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PRK03601 transcriptional regulator HdfR; Provisional Back     alignment and domain information
>TIGR02036 dsdC D-serine deaminase transcriptional activator Back     alignment and domain information
>PRK11062 nhaR transcriptional activator NhaR; Provisional Back     alignment and domain information
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>PF09382 RQC: RQC domain; InterPro: IPR018982 This entry represents the RQC domain, which is a DNA-binding domain found only in RecQ family enzymes Back     alignment and domain information
>COG4742 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>PRK10094 DNA-binding transcriptional activator AllS; Provisional Back     alignment and domain information
>PRK10837 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PF14338 Mrr_N: Mrr N-terminal domain Back     alignment and domain information
>PRK15421 DNA-binding transcriptional regulator MetR; Provisional Back     alignment and domain information
>TIGR03418 chol_sulf_TF putative choline sulfate-utilization transcription factor Back     alignment and domain information
>PF04458 DUF505: Protein of unknown function (DUF505); InterPro: IPR007548 This is a family of uncharacterised prokaryotic proteins Back     alignment and domain information
>COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon [Transcription / Coenzyme metabolism] Back     alignment and domain information
>TIGR00637 ModE_repress ModE molybdate transport repressor domain Back     alignment and domain information
>PRK14997 LysR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK09986 DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>PRK11013 DNA-binding transcriptional regulator LysR; Provisional Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK09906 DNA-binding transcriptional regulator HcaR; Provisional Back     alignment and domain information
>PRK10632 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10082 cell density-dependent motility repressor; Provisional Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK15092 DNA-binding transcriptional repressor LrhA; Provisional Back     alignment and domain information
>PRK09801 transcriptional activator TtdR; Provisional Back     alignment and domain information
>PF04458 DUF505: Protein of unknown function (DUF505); InterPro: IPR007548 This is a family of uncharacterised prokaryotic proteins Back     alignment and domain information
>PRK15243 transcriptional regulator SpvR; Provisional Back     alignment and domain information
>PRK10086 DNA-binding transcriptional regulator DsdC; Provisional Back     alignment and domain information
>PF11313 DUF3116: Protein of unknown function (DUF3116); InterPro: IPR021464 This family of proteins with unknown function appears to be restricted to Bacillales Back     alignment and domain information
>COG1542 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase Back     alignment and domain information
>PRK11074 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11139 DNA-binding transcriptional activator GcvA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3l4g_A 508 Phenylalanyl-tRNA synthetase alpha chain; aminoacy 1e-08
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Length = 508 Back     alignment and structure
 Score = 51.8 bits (124), Expect = 1e-08
 Identities = 30/137 (21%), Positives = 56/137 (40%), Gaps = 28/137 (20%)

Query: 35  AQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSALFEIGCSQ-- 92
           A+    +   LT EG++ A EGS E ++F ++P E  + + EL + P     ++G S+  
Sbjct: 53  AELRSTKHWELTAEGEEIAREGSHEARVFRSIPPEG-LAQSELMRLPS---GKVGFSKAM 108

Query: 93  ----------SVETNKFKDLLVRVQDGRAISKEDINGG------------LKARKLIVNQ 130
                     + +  +   ++  ++D      + + GG            L+ RKL+   
Sbjct: 109 SNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEV 168

Query: 131 MCKGYSVSNALKKEESL 147
             K Y VS       S+
Sbjct: 169 TLKTYWVSKGSAFSTSI 185

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
3l4g_A 508 Phenylalanyl-tRNA synthetase alpha chain; aminoacy 99.94
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 96.79
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 96.79
2nnn_A140 Probable transcriptional regulator; structural gen 96.78
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 96.77
3l7w_A108 Putative uncharacterized protein SMU.1704; PADR, t 96.65
3f8b_A116 Transcriptional regulator, PADR-like family; winge 96.59
3bdd_A142 Regulatory protein MARR; putative multiple antibio 96.57
3hhh_A116 Transcriptional regulator, PADR family; PF03551, s 96.46
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 96.45
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 96.43
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 96.39
3oop_A143 LIN2960 protein; protein structure initiative, PSI 96.35
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 96.33
3ri2_A123 Transcriptional regulator, PADR-like family; PSI-b 96.32
4esf_A117 PADR-like transcriptional regulator; PADR family, 96.31
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 96.3
4esb_A115 Transcriptional regulator, PADR family; DNA bindin 96.29
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 96.26
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 96.25
3s2w_A159 Transcriptional regulator, MARR family; structural 96.22
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 96.2
3f3x_A144 Transcriptional regulator, MARR family, putative; 96.19
1xma_A145 Predicted transcriptional regulator; southea colla 96.18
2gxg_A146 146AA long hypothetical transcriptional regulator; 96.16
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 96.16
2dql_A115 PEX protein; circadian clock associated protein, c 96.15
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 96.14
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 96.12
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 96.12
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 96.12
2xzm_7162 Plectin/S10 domain containing protein; ribosome, t 96.1
3e6m_A161 MARR family transcriptional regulator; APC88769, s 96.1
2eth_A154 Transcriptional regulator, putative, MAR family; M 96.09
2pex_A153 Transcriptional regulator OHRR; transcription regu 96.09
2pg4_A95 Uncharacterized protein; structural genomics, join 96.08
3cjn_A162 Transcriptional regulator, MARR family; silicibact 96.03
3df8_A111 Possible HXLR family transcriptional factor; APC89 96.02
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 96.01
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 96.0
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 96.0
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 95.97
2co5_A99 Viral protein F93; viral protein-winged helix comp 95.95
3elk_A117 Putative transcriptional regulator TA0346; structu 95.93
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 95.93
3hrs_A214 Metalloregulator SCAR; DTXR/MNTR family member, tr 95.93
3nqo_A189 MARR-family transcriptional regulator; structural 95.92
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 95.92
1bja_A95 Transcription regulatory protein MOTA; activation 95.91
3bja_A139 Transcriptional regulator, MARR family, putative; 95.91
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 95.89
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 95.88
2hr3_A147 Probable transcriptional regulator; MCSG, structur 95.85
4aik_A151 Transcriptional regulator SLYA; transcription, tra 95.8
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 95.76
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 95.76
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 95.75
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 95.73
2esh_A118 Conserved hypothetical protein TM0937; APC5794, st 95.71
1s3j_A155 YUSO protein; structural genomics, MARR transcript 95.69
3u5c_K105 40S ribosomal protein S10-A; translation, ribosome 95.66
1z91_A147 Organic hydroperoxide resistance transcriptional; 95.65
2p8t_A200 Hypothetical protein PH0730; pyrococcus horikoshii 95.65
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 95.57
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 95.56
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 95.54
3ech_A142 MEXR, multidrug resistance operon repressor; winge 95.51
2qq9_A226 Diphtheria toxin repressor; regulator, DTXR, helix 95.36
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 95.35
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 95.34
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 95.31
1yg2_A179 Gene activator APHA; virulence factor, winged heli 95.21
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 95.2
3boq_A160 Transcriptional regulator, MARR family; MARR famil 95.11
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 95.1
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 95.04
1yyv_A131 Putative transcriptional regulator; reductive meth 95.01
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 94.95
2frh_A127 SARA, staphylococcal accessory regulator A; winged 94.92
4fx0_A148 Probable transcriptional repressor protein; helix- 94.92
2nyx_A168 Probable transcriptional regulatory protein, RV14; 94.85
2e1n_A138 PEX, period extender; circadian clock, DNA binding 94.78
3l9f_A204 Putative uncharacterized protein SMU.1604C; PADR, 94.65
1bm9_A122 RTP, TER, replication terminator protein; DNA-bind 94.51
1fx7_A230 Iron-dependent repressor IDER; DTXR, iron-dependen 94.45
1okr_A123 MECI, methicillin resistance regulatory protein ME 94.37
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 94.08
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 93.98
3cta_A230 Riboflavin kinase; structural genomics, transferas 93.89
2fxa_A207 Protease production regulatory protein HPR; protea 93.75
2obp_A96 Putative DNA-binding protein; structural genomics, 93.37
1sfx_A109 Conserved hypothetical protein AF2008; structural 93.37
2zfw_A148 PEX; five alpha-helices + one beta-sheet, circadia 93.34
2h09_A155 Transcriptional regulator MNTR; transcription regu 93.22
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 93.02
2oqg_A114 Possible transcriptional regulator, ARSR family P; 91.97
1y0u_A96 Arsenical resistance operon repressor, putative; s 91.8
2wte_A244 CSA3; antiviral protein, viral resistance, winged 91.49
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 91.24
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 91.06
2l02_A82 Uncharacterized protein; structural genomics, nort 91.01
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 90.62
2rkh_A180 Putative APHA-like transcription factor; ZP_002083 90.48
3f6o_A118 Probable transcriptional regulator, ARSR family pr 90.06
3l09_A266 Putative transcriptional regulator; structural gen 89.9
3u1d_A151 Uncharacterized protein; GNTR-superfamily, structu 89.88
2l01_A77 Uncharacterized protein; structural genomics, nort 89.65
1hsj_A487 Fusion protein consisting of staphylococcus access 87.53
3f6v_A151 Possible transcriptional regulator, ARSR family pr 86.82
2ijl_A135 AGR_C_4647P, molybdenum-binding transcriptional re 86.63
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 86.52
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 86.41
3jth_A98 Transcription activator HLYU; transcription factor 85.81
2kko_A108 Possible transcriptional regulatory protein (possi 85.35
3szp_A 291 Transcriptional regulator, LYSR family; winged hel 85.35
2esn_A 310 Probable transcriptional regulator; PA0477, APC582 85.1
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 85.07
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 84.59
2h9b_A 312 HTH-type transcriptional regulator BENM; LTTR, tra 84.29
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 84.2
3fxq_A 305 LYSR type regulator of TSAMBCD; transcriptional re 83.64
1ixc_A 294 CBNR, LYSR-type regulatory protein; long alpha hel 83.55
1ku9_A152 Hypothetical protein MJ223; putative transcription 83.06
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 82.62
2o0m_A 345 Transcriptional regulator, SORC family; structural 82.61
2vn2_A128 DNAD, chromosome replication initiation protein; D 82.49
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 82.46
1uth_A 315 LYSR-type regulatory protein; transcription regula 82.3
2h98_A 313 HTH-type transcriptional regulator CATM; BENM, LTT 82.23
3mz1_A 300 Putative transcriptional regulator; structural gen 81.83
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 81.56
1al3_A 324 Cys regulon transcriptional activator CYSB; LYSR f 81.48
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 81.24
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 80.71
2hgc_A102 YJCQ protein; SR346, structure, autostructure, NES 80.68
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 80.48
3isp_A 303 HTH-type transcriptional regulator RV1985C/MT2039; 80.32
3fzv_A 306 Probable transcriptional regulator; LYSR, structur 80.3
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
Probab=99.94  E-value=2.2e-28  Score=214.03  Aligned_cols=135  Identities=24%  Similarity=0.323  Sum_probs=1.0

Q ss_pred             cccccccCCChHHHHHHHHhhccCC-ceEEeeEeeeEEEcCHhHHHHHHcCChHHHHHhhcccCCCCChHHHhcCCCchh
Q 031936            7 SASTVSVTVDAQLNESVIKKFGLFV-GLPAQDIKRETRVLTDEGKKYAAEGSSEIQLFLAVPAECSILKDELQKKPDSAL   85 (150)
Q Consensus         7 ~~~~~~~~~~~~~v~~~l~sL~~kg-lI~~e~~~~~~~~LTeEG~~yl~~GsPE~rl~~~l~~~g~~~~~eL~~~lg~~~   85 (150)
                      ..-|...|++|++|+++++||+++| ||++++.+.+.|+||+||++|+++||||+|||++++.+| ++++||.+ +  +.
T Consensus        24 ~~~a~~~~~~~~~v~~~~~~L~~~~~~v~~~~~~~~~~~Lt~eg~~~~~~G~pE~~~~~~~~~~~-~~~~~l~~-~--~~   99 (508)
T 3l4g_A           24 AELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKHWELTAEGEEIAREGSHEARVFRSIPPEG-LAQSELMR-L--PS   99 (508)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHcCCCHHHHHHHHHHHHhCCCeEEEEEEEEEEEEECHHHHHHHHcCCHHHHHHHHhhhcC-ccHHHHhc-C--cc
Confidence            3345568999999999999999998 999999999999999999999999999999999998766 89999987 3  46


Q ss_pred             hhhHhhhhhc-------c----------------hHHHHHHHHHhcCCC--CCHhhHHhHhhhcCceeeEEEEEEEEecC
Q 031936           86 FEIGCSQSVE-------T----------------NKFKDLLVRVQDGRA--ISKEDINGGLKARKLIVNQMCKGYSVSNA  140 (150)
Q Consensus        86 ~kIg~g~a~K-------~----------------d~~~~~L~~i~~g~~--~~~~~l~~~LKKRkLi~~~~~~~~~V~kg  140 (150)
                      ++||+|||+|       .                |.++..|..|..++.  ++++.+ ++|||||||+.++.++|.|+||
T Consensus       100 ~~i~~~~~~k~~wi~~~~~~~~~~~~~~~~~~~~d~~~~~l~~~~~~~~~~~~~~~~-~~lkkRklv~~~~~~~~~v~~g  178 (508)
T 3l4g_A          100 GKVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKER-SELRKRKLLAEVTLKTYWVSKG  178 (508)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             hhHHHHHHHHCCCEEecCCCcCcceEeeccCccchHHHHHHHHHHcCCCCCCCHHHH-HHHHhcCCeEEEEEEEEEEecc
Confidence            8999999999       1                334567888876653  567889 9999999999999999999999


Q ss_pred             CCchhh
Q 031936          141 LKKEES  146 (150)
Q Consensus       141 ~~f~~~  146 (150)
                      ++|++.
T Consensus       179 ~~~~~~  184 (508)
T 3l4g_A          179 SAFSTS  184 (508)
T ss_dssp             ----CC
T ss_pred             hhhhhh
Confidence            999754
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 Back     alignment and structure
>3f8b_A Transcriptional regulator, PADR-like family; winged helix turn helix, transcription regulator; 2.00A {Lactococcus lactis subsp} SCOP: a.4.5.0 PDB: 3f8c_A* 3f8f_A* Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>4esb_A Transcriptional regulator, PADR family; DNA binding protein, HTH fold; 2.50A {Bacillus cereus} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>2dql_A PEX protein; circadian clock associated protein, circadian clock protein; 1.70A {Anabaena SP} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>2xzm_7 Plectin/S10 domain containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_7 Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2co5_A Viral protein F93; viral protein-winged helix complex, winged helix, DNA-bindin WHTH, disulfide bond, STIV; 2.2A {Sulfolobus turreted icosahedral virus} SCOP: a.4.5.48 Back     alignment and structure
>3elk_A Putative transcriptional regulator TA0346; structural genomics, PSI-2, prote structure initiative; 1.70A {Thermoplasma acidophilum} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3u5c_K 40S ribosomal protein S10-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_K Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2e1n_A PEX, period extender; circadian clock, DNA binding protein, circadian clock protei; 1.80A {Synechococcus elongatus pcc 7942} Back     alignment and structure
>3l9f_A Putative uncharacterized protein SMU.1604C; PADR, transcription regulator; 1.80A {Streptococcus mutans} Back     alignment and structure
>1bm9_A RTP, TER, replication terminator protein; DNA-binding protein, contrahelicase; 2.00A {Bacillus subtilis} SCOP: a.4.5.7 PDB: 1f4k_A 1j0r_A 2dpd_A 2dpu_A 2efw_A* 2dqr_A Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2zfw_A PEX; five alpha-helices + one beta-sheet, circadian clock protein; 2.90A {Synechococcus SP} Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>2l02_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>2rkh_A Putative APHA-like transcription factor; ZP_00208345.1, STRU genomics, joint center for structural genomics, JCSG; 2.00A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>3l09_A Putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG, protein structure initiative transcription regulator; 2.81A {Jannaschia SP} Back     alignment and structure
>3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} Back     alignment and structure
>2l01_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural GE DNA-binding protein, PSI-2, PROT structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3szp_A Transcriptional regulator, LYSR family; winged helix-turn helix, DNA-binding, transcription factor; 2.20A {Vibrio cholerae} PDB: 3t1b_B Back     alignment and structure
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein struc initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2h9b_A HTH-type transcriptional regulator BENM; LTTR, transcriptional activator, LYSR-type transcripti regulator; 1.80A {Acinetobacter SP} PDB: 2h99_A 3k1m_A 3k1n_A 3k1p_A 2f7a_A* 2f6p_A 2f78_A 2f6g_A* 2f8d_A 2f97_A* Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A 3n6t_A 3n6u_A* Back     alignment and structure
>1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domai binding protein; 2.20A {Cupriavidus necator} SCOP: a.4.5.37 c.94.1.1 PDB: 1iz1_A Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>1uth_A LYSR-type regulatory protein; transcription regulation, transcriptional regulator; 2.2A {Burkholderia SP} SCOP: c.94.1.1 PDB: 1utb_A 1utb_B 1uth_B 2uyf_A 2uye_A Back     alignment and structure
>2h98_A HTH-type transcriptional regulator CATM; BENM, LTTR; 1.80A {Acinetobacter SP} PDB: 2h9q_A* 2f7b_A 2f7c_A* 3glb_A* 3m1e_A Back     alignment and structure
>3mz1_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative, MI center for STR uctural genomics, MCSG; 1.88A {Sinorhizobium meliloti} Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1 Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2hgc_A YJCQ protein; SR346, structure, autostructure, NESG, PSI-2, northeast structural genomics consortium, protein structure initiative; NMR {Bacillus subtilis} SCOP: a.4.5.77 Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>3isp_A HTH-type transcriptional regulator RV1985C/MT2039; ROD shaped structure, DNA binding domain, regulatory domain, DNA-binding; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, structure initiative; 2.71A {Pseudomonas aeruginosa PA01} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 96.88
d1xmaa_103 Predicted transcriptional regulator {Clostridium t 96.66
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 96.63
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 96.17
d2esha1114 Hypothetical protein TM0937 {Thermotoga maritima [ 96.12
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 95.98
d1yg2a_178 Hypothetical protein AphA {Vibrio cholerae [TaxId: 95.89
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 95.89
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 95.79
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 95.7
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 95.61
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 95.41
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 95.4
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 95.35
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 95.35
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 95.3
d1z91a1137 Organic hydroperoxide resistance transcriptional r 94.86
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 94.86
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 94.81
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 94.56
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 93.97
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 93.36
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 92.6
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 92.42
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 92.25
d1z7ua1108 Hypothetical protein EF0647 {Enterococcus faecalis 90.23
d1yyva1114 Putative transcriptional regulator YtfH {Salmonell 89.74
d2fswa1102 Hypothetical protein PG0823 {Porphyromonas gingiva 89.69
d2esna189 Probable LysR-type transcriptional regulator PA047 88.82
d2hzta195 Putative transcriptional regulator YtcD {Bacillus 87.79
d2p8ta169 Hypothetical protein PH0730 {Pyrococcus horikoshii 87.15
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 85.73
d1ixca189 LysR-type regulatory protein CbnR {Ralstonia eutro 85.24
d1sd4a_122 Penicillinase repressor BlaI {Staphylococcus aureu 83.43
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 81.85
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: MarR-like transcriptional regulators
domain: Ta1064 (RFK), N-terminal domain
species: Thermoplasma acidophilum [TaxId: 2303]

Probab=96.88  E-value=0.00019  Score=46.67  Aligned_cols=56  Identities=13%  Similarity=0.054  Sum_probs=45.1

Q ss_pred             cCcccccccCCChHHHHHHHHhhccCCceEEeeEe-eeEEEcCHhHHHHHHcCChHH
Q 031936            5 SSSASTVSVTVDAQLNESVIKKFGLFVGLPAQDIK-RETRVLTDEGKKYAAEGSSEI   60 (150)
Q Consensus         5 ~~~~~~~~~~~~~~~v~~~l~sL~~kglI~~e~~~-~~~~~LTeEG~~yl~~GsPE~   60 (150)
                      +.+.-+..+++++..+-+.++.|+.+|+|.-.... ...+.||++|++++++=.|++
T Consensus        23 t~~eLa~~l~i~~~~vs~~l~~Le~~GlV~r~~D~R~~~i~LT~~G~~~l~~~~~~~   79 (85)
T d3ctaa1          23 TSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADL   79 (85)
T ss_dssp             CHHHHHHHHTSCHHHHHHHHHHHHHTTSEEEEEETTEEEEEECHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHCCCeeeecccccccceECHHHHHHHHHHHHHH
Confidence            33444666899999999999999999999974433 355799999999998877776
>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2esha1 a.4.5.61 (A:4-117) Hypothetical protein TM0937 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yg2a_ a.4.5.61 (A:) Hypothetical protein AphA {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2esna1 a.4.5.37 (A:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ixca1 a.4.5.37 (A:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure