Citrus Sinensis ID: 032211


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLASEKYLEDAAQNSSKAVGEANKTGFVGGTSGQMNRSAKIAAIKNKLKALEEESSSAKKQKQADNSSCNGSLNCLSGKDGLNNLQN
ccccccccEEEEEEEccccccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHccccccccccccccccccccccccc
cccccccEEEEEEEEEccccccccccEEEEEEEccHHHHHHHHHHHcccEccccEEEEEEccccccccHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHccccccccccccccccccccccHHcccc
mfspygkivsedflwhtrgpkrgvprgfaFIEYSTKEEAKLAKEKMhgrlacgrPLVVRLASEKYLEDAAQNSSkavgeanktgfvggtsgqmNRSAKIAAIKNKLKALEEESSsakkqkqadnsscngslnclsgkdglnnlqn
mfspygkivsedflwhtrgpkrgvprGFAFIEYSTKEEAKLAKekmhgrlacgRPLVVRLASEKYLEDAAqnsskavgeanktgfvggtsgqmnrSAKIAAIKNKLKALEEESSsakkqkqadnsscngslnclsgkdglnnlqn
MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLASEKYLEDAAQNSSKAVGEANKTGFVGGTSGQMNRSakiaaiknklkalEEESSSAKKQKQADnsscngslnclsgKDGLNNLQN
***********************************************GRLACGRPLVVRLAS***********************************************************************************
MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVR*******************************************************************************GL*****
MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLASEKYLE**********GEANKTGFVGGTSGQMNRSAKIAAIKNKL*********************NGSLNCLSGKDGLNNLQN
MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLASE*****************************************KLKA*E*E*********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLASEKYLEDAAQNSSKAVGEANKTGFVGGTSGxxxxxxxxxxxxxxxxxxxxxxxxxxxxKQADNSSCNGSLNCLSGKDGLNNLQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query145 2.2.26 [Sep-21-2011]
Q6PBM8188 Probable RNA-binding prot yes no 0.689 0.531 0.368 2e-11
Q66J99190 Probable RNA-binding prot N/A no 0.751 0.573 0.342 1e-10
Q5R6W3190 Probable RNA-binding prot yes no 0.751 0.573 0.333 2e-09
Q96H35190 Probable RNA-binding prot yes no 0.751 0.573 0.333 2e-09
Q9CR83190 Probable RNA-binding prot yes no 0.751 0.573 0.324 7e-09
Q3ZCC5190 Probable RNA-binding prot yes no 0.751 0.573 0.315 3e-08
Q05196 682 Polyadenylate-binding pro no no 0.413 0.087 0.406 5e-06
Q4P8R9 651 Polyadenylate-binding pro N/A no 0.406 0.090 0.444 2e-05
Q5RC80 524 RNA-binding protein 39 OS no no 0.655 0.181 0.326 5e-05
Q8VH51 530 RNA-binding protein 39 OS no no 0.655 0.179 0.326 5e-05
>sp|Q6PBM8|RBM18_DANRE Probable RNA-binding protein 18 OS=Danio rerio GN=rbm18 PE=2 SV=1 Back     alignment and function desciption
 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 63/114 (55%), Gaps = 14/114 (12%)

Query: 5   YGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLASEK 64
           +GK+   DFL+H  GP  G PRG+ F+ + TKEEA+ A + ++G+LA  + LVVR A   
Sbjct: 46  FGKVKQFDFLFHKSGPLEGQPRGYCFVNFHTKEEAERAIQCLNGKLALSKKLVVRWAH-- 103

Query: 65  YLEDAAQNSSKAVGEANKTGFVGGTSGQ-------MNRSAKIAAIKNKLKALEE 111
                AQ      GE N    +  +S +       ++ +AKI AI+ KL+ +EE
Sbjct: 104 -----AQRFEPFRGEKNMPASLEPSSSEAEDLPTSLSVNAKIRAIEAKLQMMEE 152





Danio rerio (taxid: 7955)
>sp|Q66J99|RBM18_XENLA Probable RNA-binding protein 18 OS=Xenopus laevis GN=rbm18 PE=2 SV=1 Back     alignment and function description
>sp|Q5R6W3|RBM18_PONAB Probable RNA-binding protein 18 OS=Pongo abelii GN=RBM18 PE=2 SV=1 Back     alignment and function description
>sp|Q96H35|RBM18_HUMAN Probable RNA-binding protein 18 OS=Homo sapiens GN=RBM18 PE=2 SV=1 Back     alignment and function description
>sp|Q9CR83|RBM18_MOUSE Probable RNA-binding protein 18 OS=Mus musculus GN=Rbm18 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZCC5|RBM18_BOVIN Probable RNA-binding protein 18 OS=Bos taurus GN=RBM18 PE=2 SV=1 Back     alignment and function description
>sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 Back     alignment and function description
>sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 Back     alignment and function description
>sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 Back     alignment and function description
>sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
255545196170 conserved hypothetical protein [Ricinus 0.944 0.805 0.781 1e-55
224077392138 predicted protein [Populus trichocarpa] 0.910 0.956 0.772 3e-54
356561522212 PREDICTED: probable RNA-binding protein 0.868 0.594 0.742 2e-48
356529159157 PREDICTED: probable RNA-binding protein 0.868 0.802 0.734 4e-47
357438285157 Polyadenylate-binding protein [Medicago 0.868 0.802 0.738 5e-47
388504432157 unknown [Medicago truncatula] 0.868 0.802 0.730 6e-47
302143805188 unnamed protein product [Vitis vinifera] 0.910 0.702 0.674 7e-47
359490617218 PREDICTED: probable RNA-binding protein 0.910 0.605 0.674 8e-47
358344347157 Polyadenylate-binding protein [Medicago 0.868 0.802 0.722 2e-45
147815698216 hypothetical protein VITISV_021345 [Viti 0.910 0.611 0.654 4e-45
>gi|255545196|ref|XP_002513659.1| conserved hypothetical protein [Ricinus communis] gi|223547567|gb|EEF49062.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 120/137 (87%)

Query: 1   MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRL 60
           MFSPYGKIVSEDFLWHTRGPKRG PRGFAF+++STKEEA+LAKEKMHGRLACGRPLVVRL
Sbjct: 33  MFSPYGKIVSEDFLWHTRGPKRGEPRGFAFVQFSTKEEAELAKEKMHGRLACGRPLVVRL 92

Query: 61  ASEKYLEDAAQNSSKAVGEANKTGFVGGTSGQMNRSAKIAAIKNKLKALEEESSSAKKQK 120
           ASEKYLE+AAQNS +AVGE  KT   GGTSGQM+R+AKIAAIKNKL+ LEEE SS KKQK
Sbjct: 93  ASEKYLEEAAQNSCRAVGEMKKTSTAGGTSGQMSRNAKIAAIKNKLRTLEEEGSSVKKQK 152

Query: 121 QADNSSCNGSLNCLSGK 137
           Q+ +   N  L+ LSG+
Sbjct: 153 QSGSILGNSRLDRLSGE 169




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224077392|ref|XP_002305243.1| predicted protein [Populus trichocarpa] gi|222848207|gb|EEE85754.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356561522|ref|XP_003549030.1| PREDICTED: probable RNA-binding protein 18-like [Glycine max] Back     alignment and taxonomy information
>gi|356529159|ref|XP_003533164.1| PREDICTED: probable RNA-binding protein 18-like [Glycine max] Back     alignment and taxonomy information
>gi|357438285|ref|XP_003589418.1| Polyadenylate-binding protein [Medicago truncatula] gi|357473041|ref|XP_003606805.1| Polyadenylate-binding protein [Medicago truncatula] gi|355478466|gb|AES59669.1| Polyadenylate-binding protein [Medicago truncatula] gi|355507860|gb|AES89002.1| Polyadenylate-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388504432|gb|AFK40282.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|302143805|emb|CBI22666.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490617|ref|XP_002272950.2| PREDICTED: probable RNA-binding protein 18-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|358344347|ref|XP_003636251.1| Polyadenylate-binding protein [Medicago truncatula] gi|355502186|gb|AES83389.1| Polyadenylate-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|147815698|emb|CAN68282.1| hypothetical protein VITISV_021345 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
TAIR|locus:50495505179 AT5G52545 "AT5G52545" [Arabido 0.517 0.949 0.538 4.9e-14
ZFIN|ZDB-GENE-040426-1764188 rbm18 "RNA binding motif prote 0.462 0.356 0.417 2.5e-10
UNIPROTKB|E1BQ47190 RBM18 "Uncharacterized protein 0.420 0.321 0.409 4.7e-09
UNIPROTKB|Q96H35190 RBM18 "Probable RNA-binding pr 0.420 0.321 0.409 4.7e-09
MGI|MGI:1915139190 Rbm18 "RNA binding motif prote 0.420 0.321 0.409 4.7e-09
RGD|1307411190 Rbm18 "RNA binding motif prote 0.393 0.3 0.438 5.9e-09
UNIPROTKB|Q3ZCC5190 RBM18 "Probable RNA-binding pr 0.420 0.321 0.393 2e-08
UNIPROTKB|J9NUA3190 RBM18 "Uncharacterized protein 0.420 0.321 0.393 2e-08
UNIPROTKB|F1SLQ8190 RBM18 "Uncharacterized protein 0.420 0.321 0.393 3.3e-08
TAIR|locus:2173338 303 SC35 "ortholog of human splici 0.510 0.244 0.392 1.3e-06
TAIR|locus:504955051 AT5G52545 "AT5G52545" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 181 (68.8 bits), Expect = 4.9e-14, P = 4.9e-14
 Identities = 42/78 (53%), Positives = 51/78 (65%)

Query:    46 MHGRLACGRPLVVRLASEKYLEDAAQNSSK-AVGEANKTGFVGGTS-GQMNRSXXXXXXX 103
             MHGRLACGRPLVVRLASEK+LED++ + SK ++ E N+T FV G+S GQM+R        
Sbjct:     1 MHGRLACGRPLVVRLASEKHLEDSSHDHSKRSLPEGNRTRFVNGSSSGQMSRDEKVTAIK 60

Query:   104 XXXXXXEE-ESSSAKKQK 120
                   EE E    KKQK
Sbjct:    61 NKLKALEEDEKRDPKKQK 78




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
ZFIN|ZDB-GENE-040426-1764 rbm18 "RNA binding motif protein 18" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQ47 RBM18 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q96H35 RBM18 "Probable RNA-binding protein 18" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1915139 Rbm18 "RNA binding motif protein 18" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307411 Rbm18 "RNA binding motif protein 18" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCC5 RBM18 "Probable RNA-binding protein 18" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NUA3 RBM18 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLQ8 RBM18 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2173338 SC35 "ortholog of human splicing factor SC35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 7e-21
smart0036073 smart00360, RRM, RNA recognition motif 1e-13
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-12
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 5e-11
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-09
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-09
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 4e-09
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 6e-09
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-08
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 2e-08
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 4e-08
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 8e-08
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-07
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 1e-07
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-07
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 2e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 2e-07
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 2e-07
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 3e-07
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 3e-07
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 4e-07
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 5e-07
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 1e-06
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-06
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 2e-06
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 4e-06
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 4e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 5e-06
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 5e-06
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 6e-06
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 8e-06
cd1246778 cd12467, RRM_Srp1p_like, RNA recognition motif 1 i 8e-06
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 8e-06
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-05
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 1e-05
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 1e-05
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 1e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 1e-05
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 1e-05
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 2e-05
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 2e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 3e-05
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-05
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 3e-05
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 3e-05
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 5e-05
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 5e-05
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 6e-05
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 7e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 7e-05
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 8e-05
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 1e-04
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 1e-04
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 2e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 2e-04
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 2e-04
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 2e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 2e-04
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 3e-04
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 3e-04
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-04
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 3e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 4e-04
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 4e-04
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 5e-04
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 5e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 7e-04
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 8e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 0.001
cd12540105 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 0.001
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 0.001
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 0.001
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 0.002
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.002
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 0.002
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 0.002
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 0.002
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 0.003
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 0.003
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 0.003
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 0.003
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 0.003
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 0.004
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 0.004
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
 Score = 80.0 bits (198), Expect = 7e-21
 Identities = 31/61 (50%), Positives = 42/61 (68%)

Query: 2  FSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLA 61
          FS YGKI   DFL+H  GP +G PRG+ F+ + TKEEA+ A + ++G+ A G+ LVVR A
Sbjct: 20 FSKYGKIKKFDFLFHKSGPLKGQPRGYCFVTFETKEEAEKALKSLNGKTALGKKLVVRWA 79

Query: 62 S 62
           
Sbjct: 80 H 80


This subfamily corresponds to the RRM of RBM18, a putative RNA-binding protein containing a well-conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). The biological role of RBM18 remains unclear. . Length = 80

>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240984 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (U2AFBPL) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.52
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.47
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.39
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.39
KOG0122270 consensus Translation initiation factor 3, subunit 99.36
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.36
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.36
smart0036170 RRM_1 RNA recognition motif. 99.34
KOG4207256 consensus Predicted splicing factor, SR protein su 99.32
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.27
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 99.25
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.25
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.23
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.22
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.19
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.18
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.17
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.15
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.15
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.14
smart0036071 RRM RNA recognition motif. 99.11
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.11
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.1
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.1
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.09
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.07
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 99.06
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.06
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.05
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.04
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.03
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.0
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.99
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 98.99
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 98.99
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.99
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 98.98
KOG0121153 consensus Nuclear cap-binding protein complex, sub 98.98
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.98
PLN03120260 nucleic acid binding protein; Provisional 98.96
smart0036272 RRM_2 RNA recognition motif. 98.95
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.92
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.9
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.9
PLN03213 759 repressor of silencing 3; Provisional 98.89
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.88
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.88
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.87
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.87
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 98.85
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.83
KOG0114124 consensus Predicted RNA-binding protein (RRM super 98.8
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.79
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.74
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.73
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 98.71
PLN03121243 nucleic acid binding protein; Provisional 98.7
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.69
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.65
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 98.64
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.62
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 98.59
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 98.58
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 98.54
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.53
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 98.53
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.51
KOG0226290 consensus RNA-binding proteins [General function p 98.4
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 98.3
KOG0151 877 consensus Predicted splicing regulator, contains R 98.2
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 98.11
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 98.1
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.1
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.07
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 97.99
KOG2314 698 consensus Translation initiation factor 3, subunit 97.9
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.86
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 97.66
KOG1548382 consensus Transcription elongation factor TAT-SF1 97.63
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 97.61
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 97.6
KOG0533243 consensus RRM motif-containing protein [RNA proces 97.59
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.55
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 97.47
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 97.47
KOG4660 549 consensus Protein Mei2, essential for commitment t 97.16
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.15
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.12
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.0
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 96.87
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.85
KOG1996378 consensus mRNA splicing factor [RNA processing and 96.68
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.68
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 96.68
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 96.39
KOG1548382 consensus Transcription elongation factor TAT-SF1 96.36
KOG4210285 consensus Nuclear localization sequence binding pr 96.29
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.16
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 96.06
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 95.92
KOG2068327 consensus MOT2 transcription factor [Transcription 95.78
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 95.48
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 95.3
KOG1855484 consensus Predicted RNA-binding protein [General f 94.81
KOG1995 351 consensus Conserved Zn-finger protein [General fun 94.81
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 94.28
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 94.18
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 93.69
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.61
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 92.39
KOG2135526 consensus Proteins containing the RNA recognition 92.28
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 92.11
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 91.59
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 91.01
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 90.97
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 90.14
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 90.01
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 87.15
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 84.89
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 84.46
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 83.57
KOG4660549 consensus Protein Mei2, essential for commitment t 83.56
KOG1457284 consensus RNA binding protein (contains RRM repeat 83.2
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 80.64
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 80.55
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
Probab=99.52  E-value=9.8e-14  Score=99.62  Aligned_cols=65  Identities=25%  Similarity=0.484  Sum_probs=59.5

Q ss_pred             CCCCCcceeEEEEeeccCCCCCCCCccEEEEEEccHHHHHHHHHHhcCCeeCCeeeEEEEccccchhh
Q 032211            1 MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLASEKYLED   68 (145)
Q Consensus         1 lFs~~G~I~~~~i~~~~rd~~tg~skG~~FV~f~~~e~A~~Ai~~lng~~i~gr~l~V~~a~~~~~~~   68 (145)
                      +|++||.|.++.|+.   |+.+++++|||||+|.+.++|+.||+.||+..|.|+.|.|+++.++....
T Consensus        54 ~F~~~G~I~~v~i~~---d~~tg~~kGfaFV~F~~~e~A~~Al~~lng~~i~Gr~l~V~~a~~~~~~~  118 (144)
T PLN03134         54 AFAHFGDVVDAKVIV---DRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSAP  118 (144)
T ss_pred             HHhcCCCeEEEEEEe---cCCCCCcceEEEEEECCHHHHHHHHHHcCCCEECCEEEEEEeCCcCCCCC
Confidence            589999999999986   78899999999999999999999999999999999999999998765443



>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 1e-05
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 1e-05
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-05
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 3e-05
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 3e-05
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 6e-05
1sxl_A97 Resonance Assignments And Solution Structure Of The 6e-05
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 8e-05
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-04
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 7e-04
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 7e-04
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 8e-04
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 5/73 (6%) Query: 1 MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRL 60 MF +GKI+ + +++ RG K GF F+ + +A A+EK+HG + GR + V Sbjct: 35 MFGQFGKILDVEIIFNERGSK-----GFGFVTFENSADADRAREKLHGTVVEGRKIEVNN 89 Query: 61 ASEKYLEDAAQNS 73 A+ + + ++ +S Sbjct: 90 ATARVMTNSGPSS 102
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 5e-15
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-14
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-14
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-13
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-08
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 7e-14
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-05
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 8e-08
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-13
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-13
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-06
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 5e-13
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-13
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 6e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-06
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 7e-13
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-07
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 7e-13
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 8e-13
1x5p_A97 Negative elongation factor E; structure genomics, 8e-13
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-13
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-06
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-13
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-12
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-12
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-12
3q2s_C229 Cleavage and polyadenylation specificity factor S; 3e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-11
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-06
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-12
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-12
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 5e-12
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-10
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 9e-06
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 6e-12
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-12
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 8e-12
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 9e-12
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 9e-12
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-11
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-11
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-11
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-11
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-07
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-11
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-11
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-11
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-11
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-11
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-11
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-11
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-04
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-11
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-11
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-11
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-11
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-11
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 4e-11
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 5e-11
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 5e-11
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-11
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 7e-11
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 7e-11
2dis_A109 Unnamed protein product; structural genomics, RRM 8e-11
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 8e-11
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 9e-11
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-10
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-10
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-10
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-10
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-10
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-10
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-10
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-10
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-10
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-10
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-10
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-10
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 5e-08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-10
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-10
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-10
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-10
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-10
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-10
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-10
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-10
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-10
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 4e-10
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-10
3p5t_L90 Cleavage and polyadenylation specificity factor S; 4e-10
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 4e-10
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-10
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 7e-10
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 7e-10
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 9e-10
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-09
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-09
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-09
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-09
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-09
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-09
2krb_A81 Eukaryotic translation initiation factor 3 subunit 4e-09
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 5e-09
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 5e-09
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-09
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 7e-09
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 9e-09
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-07
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-08
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-08
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-08
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-08
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 3e-08
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-08
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-07
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 7e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-05
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-07
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-07
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-07
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-07
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-07
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-07
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-07
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-07
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 4e-07
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-07
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 7e-07
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 7e-07
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 8e-07
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-06
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-06
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-06
2div_A99 TRNA selenocysteine associated protein; structural 4e-06
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 5e-06
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 5e-06
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 5e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 7e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 9e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 9e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 9e-06
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 1e-05
2dit_A112 HIV TAT specific factor 1 variant; structural geno 1e-05
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-05
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 1e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-05
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-05
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 2e-05
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 2e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-05
2cqd_A116 RNA-binding region containing protein 1; RNA recog 3e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-05
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-05
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 5e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 5e-05
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-05
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 7e-05
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 9e-05
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-04
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 2e-04
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-04
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-04
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 4e-04
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 6e-04
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 9e-04
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 9e-04
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
 Score = 65.4 bits (160), Expect = 5e-15
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 1  MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRL---ACGRPLV 57
          +F P+G I     L   RGP  G  +G AF+++S+  EA+ A   +HG          LV
Sbjct: 35 LFQPFGVIDECTVL---RGPD-GSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLV 90

Query: 58 VRLASEK 64
          V+ A   
Sbjct: 91 VKFADTD 97


>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.69
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.66
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.62
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.61
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.61
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.6
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.59
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.59
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.58
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.58
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.58
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.58
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.57
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.57
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.57
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.56
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.56
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.56
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.56
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.55
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.55
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.55
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.55
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.55
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.55
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.55
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.55
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.54
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.54
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.54
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.54
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.53
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.53
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.53
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.53
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.53
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.53
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.53
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.53
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.53
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.52
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.52
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.52
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.52
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.52
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.51
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.51
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.51
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.51
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.51
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.51
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.51
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.51
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.5
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.5
2div_A99 TRNA selenocysteine associated protein; structural 99.5
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.49
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.49
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.49
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.49
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.49
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.49
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.49
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.49
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.48
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.48
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.48
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.48
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.48
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.48
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.47
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.47
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.47
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.47
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.47
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.46
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.46
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.46
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.46
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.46
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.46
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.45
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.45
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.45
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.45
2dis_A109 Unnamed protein product; structural genomics, RRM 99.45
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.44
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.44
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.44
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.44
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.44
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.43
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.43
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.43
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.43
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.43
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.14
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.42
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.42
1x5p_A97 Negative elongation factor E; structure genomics, 99.41
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.41
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.41
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.41
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.41
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.4
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.4
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.39
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.39
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.38
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.38
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.38
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.38
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.37
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.37
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.37
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.37
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.37
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.37
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.36
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.36
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.36
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.36
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.36
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.36
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.36
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.36
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.36
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.36
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.36
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.35
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.35
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.35
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.35
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.35
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.35
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.35
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.35
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.35
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.35
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.34
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.34
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.34
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.34
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.34
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.33
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.33
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.33
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.32
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.32
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.32
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.32
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.32
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.32
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.32
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.31
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.31
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.3
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.3
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.3
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.29
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.29
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.27
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.27
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.27
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.26
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.26
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.26
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.26
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.26
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.26
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.26
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.25
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.25
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.24
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.24
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.24
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.23
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.21
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.19
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.18
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.18
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.17
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.15
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.15
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.14
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.12
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.12
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.12
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.09
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.06
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.04
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.02
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.01
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.0
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.99
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.97
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 98.95
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.93
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.92
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.89
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.82
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.72
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.67
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.66
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.05
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 96.84
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 96.62
2i2y_A150 Fusion protein consists of immunoglobin G- binding 96.56
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.37
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.21
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 94.89
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 87.94
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 81.69
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 81.34
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.69  E-value=5.1e-17  Score=108.30  Aligned_cols=60  Identities=23%  Similarity=0.429  Sum_probs=57.0

Q ss_pred             CCCCCcceeEEEEeeccCCCCCCCCccEEEEEEccHHHHHHHHHHhcCCeeCCeeeEEEEccc
Q 032211            1 MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLASE   63 (145)
Q Consensus         1 lFs~~G~I~~~~i~~~~rd~~tg~skG~~FV~f~~~e~A~~Ai~~lng~~i~gr~l~V~~a~~   63 (145)
                      +|++||.|.+++++.   |+.+|+++|||||+|.+.++|.+|++.|||..|.|++|.|+||+|
T Consensus        39 ~F~~~G~I~~v~i~~---d~~tg~~kG~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~AkP   98 (99)
T 4fxv_A           39 LFSSIGEVESAKLIR---DKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARP   98 (99)
T ss_dssp             HHHTTSCEEEEEEEE---CSSSCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCB
T ss_pred             HHHhcCCEEEeEeee---cCCCCcccccEEEEECCHHHHHHHHHHhCCCEECCEEEEEEEeeC
Confidence            589999999999986   788999999999999999999999999999999999999999976



>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 145
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 7e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 9e-10
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-09
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 4e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 6e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-08
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-08
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-08
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 9e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-07
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-07
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-07
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-07
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 3e-07
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 5e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 9e-07
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-06
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-06
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-06
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-06
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-06
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-06
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 3e-06
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 4e-06
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 4e-06
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 4e-06
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 5e-06
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 5e-06
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 6e-06
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 7e-06
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 9e-06
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 9e-06
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-05
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-05
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-05
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-05
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-05
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-05
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-05
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-05
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-05
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 4e-05
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 7e-05
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 7e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 7e-05
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 9e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 5e-04
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 5e-04
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 5e-04
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 6e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 7e-04
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 8e-04
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 0.001
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 0.001
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 0.001
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.001
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 0.001
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 0.003
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 0.003
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 0.004
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Probable RNA-binding protein 19, Rbm19
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 55.8 bits (134), Expect = 7e-12
 Identities = 18/64 (28%), Positives = 28/64 (43%)

Query: 1  MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRL 60
          +FS  G I S             +  GF F+EY   E+A+ A +++ G    G  L VR+
Sbjct: 18 VFSKVGAIKSCTISKKKNKAGVLLSMGFGFVEYKKPEQAQKALKQLQGHTVDGHKLEVRI 77

Query: 61 ASEK 64
          +   
Sbjct: 78 SERA 81


>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.69
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.67
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.66
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.66
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.65
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.65
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.65
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.64
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.63
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.63
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.62
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.62
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.61
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.61
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.61
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.6
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.6
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.59
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.59
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.57
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.57
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.57
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.56
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.56
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.56
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.55
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.55
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.55
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.54
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.53
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.53
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.53
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.52
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.51
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.51
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.51
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.49
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.48
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.48
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.48
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.48
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.47
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.47
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.47
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.46
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.46
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.45
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.44
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.43
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.43
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.42
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.42
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.41
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.4
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.39
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.38
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.38
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.37
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.37
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.36
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.36
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.36
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.35
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.34
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.33
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.33
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.3
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.29
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.29
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.29
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.28
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.27
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.26
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.26
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.25
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.25
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.24
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.22
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.21
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.12
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.07
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.99
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.95
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.9
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.71
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.93
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.5
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Eukaryotic translation initiation factor 3 subunit 4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=3.7e-17  Score=105.67  Aligned_cols=62  Identities=27%  Similarity=0.351  Sum_probs=58.4

Q ss_pred             CCCCCcceeEEEEeeccCCCCCCCCccEEEEEEccHHHHHHHHHHhcCCeeCCeeeEEEEccccc
Q 032211            1 MFSPYGKIVSEDFLWHTRGPKRGVPRGFAFIEYSTKEEAKLAKEKMHGRLACGRPLVVRLASEKY   65 (145)
Q Consensus         1 lFs~~G~I~~~~i~~~~rd~~tg~skG~~FV~f~~~e~A~~Ai~~lng~~i~gr~l~V~~a~~~~   65 (145)
                      +|++||.|.++.|+.   |+.+|.++|||||+|.+.++|..||+.|||..|+|+.|.|+||+|+.
T Consensus        28 ~f~~~G~v~~v~i~~---d~~t~~~rg~afV~f~~~~~A~~Ai~~l~g~~~~g~~i~v~~akp~~   89 (90)
T d2cq0a1          28 LFRPFGSISRIYLAK---DKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPST   89 (90)
T ss_dssp             TSTTTCCEEEEEEEE---CSSSCSEEEEEEEEESSHHHHHHHHHHTTTCEETTEECEEEESSCCC
T ss_pred             HHHHhcccccccccc---cccccccccceeEEECCHHHHHHHHHHhCCCEECCEEEEEEeeeCCC
Confidence            699999999999986   67899999999999999999999999999999999999999998864



>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure