Citrus Sinensis ID: 032271

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
ccccccccccccEEEEEEEEEcccccccHHHHHcHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHcc
ccccEEEEcccEEEEEEEEEEccccccccHcHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHcccccccccHHHHHHcccEEccccEEEEcccccHHcccccccccHHHHHHHcccccccccHHHHHHcc
MICFWFCVIETKLFVNVQVYvdgmpalsskERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrKRVEERRKLsdkdldrndecgicmenctkmvtrkhfsleripdkyfshnglimnyrnarsQSCLFAVAAYRE
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrkrveerrklsdkdldrndecgicMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
*ICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLR******************************************ECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAY**
*ICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFS********************************RNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYR*
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESE********************************LDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
*ICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKR***RRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSxxxxxxxxxxxxxxxxxxxxxEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
359473694 255 PREDICTED: uncharacterized protein LOC10 0.770 0.435 0.608 1e-32
297738323 247 unnamed protein product [Vitis vinifera] 0.770 0.449 0.608 1e-32
255547924 253 protein binding protein, putative [Ricin 0.770 0.438 0.6 5e-29
224110810 250 predicted protein [Populus trichocarpa] 0.763 0.44 0.575 2e-27
38175465209 zinc finger (C3HC4-type RING finger) pro 0.756 0.521 0.495 1e-20
115471529 253 Os07g0275300 [Oryza sativa Japonica Grou 0.75 0.426 0.5 1e-20
413950626 440 putative RING zinc finger domain superfa 0.840 0.275 0.444 5e-20
413950625 283 putative RING zinc finger domain superfa 0.840 0.427 0.444 6e-20
218199426184 hypothetical protein OsI_25623 [Oryza sa 0.590 0.461 0.581 7e-20
226505928 253 RNA-binding protein [Zea mays] gi|195652 0.75 0.426 0.483 7e-20
>gi|359473694|ref|XP_002272517.2| PREDICTED: uncharacterized protein LOC100245965 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/120 (60%), Positives = 90/120 (75%), Gaps = 9/120 (7%)

Query: 18  QVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEE 77
           +VYVDGMP +SS+ERKATLREFYA+IYPSLRQL  +F ELED +KR +C+E+ SRKRVE+
Sbjct: 86  KVYVDGMPTMSSQERKATLREFYAVIYPSLRQLGGQFIELEDTNKRSRCTEVLSRKRVED 145

Query: 78  RRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLF 137
           RRK+SDK++DR+DECGICME CTKMV         +P+   S      +  N RSQSC F
Sbjct: 146 RRKVSDKEIDRDDECGICMETCTKMV---------LPNCGHSMCICCFHDWNVRSQSCPF 196

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297738323|emb|CBI27524.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547924|ref|XP_002515019.1| protein binding protein, putative [Ricinus communis] gi|223546070|gb|EEF47573.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224110810|ref|XP_002315643.1| predicted protein [Populus trichocarpa] gi|222864683|gb|EEF01814.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|38175465|dbj|BAC84396.2| zinc finger (C3HC4-type RING finger) protein-like [Oryza sativa Japonica Group] gi|50509639|dbj|BAD31482.1| zinc finger (C3HC4-type RING finger) protein-like [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115471529|ref|NP_001059363.1| Os07g0275300 [Oryza sativa Japonica Group] gi|113610899|dbj|BAF21277.1| Os07g0275300 [Oryza sativa Japonica Group] gi|222636824|gb|EEE66956.1| hypothetical protein OsJ_23829 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|413950626|gb|AFW83275.1| putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information
>gi|413950625|gb|AFW83274.1| putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information
>gi|218199426|gb|EEC81853.1| hypothetical protein OsI_25623 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|226505928|ref|NP_001152052.1| RNA-binding protein [Zea mays] gi|195652155|gb|ACG45545.1| RNA-binding protein [Zea mays] gi|238014126|gb|ACR38098.1| unknown [Zea mays] gi|414884234|tpg|DAA60248.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
TAIR|locus:2149750242 AIRP2 "ABA Insensitive RING Pr 0.756 0.450 0.377 3.7e-16
TAIR|locus:505006120260 AT1G13195 [Arabidopsis thalian 0.833 0.461 0.391 5.4e-15
TAIR|locus:505006703242 AT5G58787 "AT5G58787" [Arabido 0.722 0.429 0.366 2.3e-14
TAIR|locus:2024026251 AT1G24440 [Arabidopsis thalian 0.784 0.450 0.381 6.2e-14
TAIR|locus:2149750 AIRP2 "ABA Insensitive RING Protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 201 (75.8 bits), Expect = 3.7e-16, P = 3.7e-16
 Identities = 46/122 (37%), Positives = 73/122 (59%)

Query:    18 QVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEE 77
             + YVDG   +S  ERK ++REFY +++PSL QL    +++E+  +++ C +   +K   +
Sbjct:    72 KAYVDGKTTMSLHERKTSIREFYDVLFPSLLQLHGGITDVEERKQKEICDKRYRKKDRTD 131

Query:    78 RRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRN--ARSQSC 135
             + K+S+ DL+R +ECGIC+E   K+V         +P    +H+  I  YRN  ARSQSC
Sbjct:   132 KGKMSEIDLEREEECGICLEIRNKVV---------LPT--CNHSMCINCYRNWRARSQSC 180

Query:   136 LF 137
              F
Sbjct:   181 PF 182
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
TAIR|locus:505006120 AT1G13195 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006703 AT5G58787 "AT5G58787" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024026 AT1G24440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 99.86
PHA02926242 zinc finger-like protein; Provisional 99.6
PHA03096284 p28-like protein; Provisional 99.13
PHA02929238 N1R/p28-like protein; Provisional 99.0
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.8
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.7
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.67
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.44
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.19
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.18
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.15
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.13
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.12
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.1
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.1
PF1463444 zf-RING_5: zinc-RING finger domain 98.08
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.97
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.85
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.8
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.79
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.73
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.63
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.5
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.49
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.45
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.42
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.2
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.07
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.05
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.97
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.51
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.34
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.34
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.1
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 95.85
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 95.61
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.54
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.46
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.19
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 95.15
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 94.53
KOG0297 391 consensus TNF receptor-associated factor [Signal t 94.23
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 94.15
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.77
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.61
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.17
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 93.04
KOG4739 233 consensus Uncharacterized protein involved in syna 91.93
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 91.75
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 91.75
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 91.61
KOG1941 518 consensus Acetylcholine receptor-associated protei 91.29
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 91.25
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 90.49
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 89.73
COG52191525 Uncharacterized conserved protein, contains RING Z 88.9
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 88.67
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 86.99
KOG0825 1134 consensus PHD Zn-finger protein [General function 86.51
KOG3002 299 consensus Zn finger protein [General function pred 86.38
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 85.3
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 85.25
PLN02400 1085 cellulose synthase 85.18
COG5152259 Uncharacterized conserved protein, contains RING a 84.66
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 84.25
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 84.04
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 83.92
PLN02436 1094 cellulose synthase A 83.89
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 83.72
KOG2660 331 consensus Locus-specific chromosome binding protei 83.49
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 83.35
PLN02189 1040 cellulose synthase 80.96
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 80.83
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 80.22
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.86  E-value=9.1e-23  Score=176.27  Aligned_cols=126  Identities=21%  Similarity=0.259  Sum_probs=98.0

Q ss_pred             eeeEEEEEe-eCCCCcCchhhh--hchHhhhHHhhhch---------Hhhhhhcccchhhh----------hhhchhhhh
Q 032271           12 KLFVNVQVY-VDGMPALSSKER--KATLREFYAIIYPS---------LRQLESEFSELEDN----------SKRDQCSEI   69 (144)
Q Consensus        12 ~~iliykvy-~dG~~~~s~~eR--kAtireFY~vI~Ps---------L~qL~~~~~d~e~~----------~q~~~c~e~   69 (144)
                      -.+++|.++ .|+..+||..+|  +.++++|+++.+|+         +-+.+.+..++...          .+...|...
T Consensus        54 ~~~~~~~~~~~~~s~~~s~~~~~~~~~~~~s~~~~~~s~~~~~~~~~~~~~~~g~~~~~~~~~~~~~c~l~~~~pi~~~~  133 (344)
T KOG1039|consen   54 SQSLIWANAVADASATMSVSSRPVLTAIRASSSISEPSSTQENPYSNHGQCRFGNGDVTLNGNNPESCGLGTQHPICKRQ  133 (344)
T ss_pred             chhhcccchhhccccccchhcccchhhhhhhhccccccccccCccccccccccCCcccccccccccccccccccchhHHH
Confidence            456888888 899999999998  89999999999999         54445444444333          122222222


Q ss_pred             hhh-----------hHHHHhhcccccccCCCccccccccccccceecccCccCCCCCCCCCchhhhhHHhccc-------
Q 032271           70 SSR-----------KRVEERRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNAR-------  131 (144)
Q Consensus        70 ~~r-----------kd~E~~~k~s~id~~~e~eCgICME~~~k~V~~k~~~~~~Lpn~~C~H~fCl~Cir~~r-------  131 (144)
                      ++.           .++|   ++++++.+++++||||||++.+++ ....+++||||  |+|+||++|||+||       
T Consensus       134 ~~~~~~~~~~~~~~~~~e---~~~a~~~s~~k~CGICme~i~ek~-~~~~rfgilpn--C~H~~Cl~Cir~wr~~~q~~~  207 (344)
T KOG1039|consen  134 YKNSMKRGSSCALSSAME---RSFALQKSSEKECGICMETINEKA-ASERRFGILPN--CNHSFCLNCIRKWRQATQFES  207 (344)
T ss_pred             HhhhhcccccccchHhhh---hccCcCccccccceehhhhccccc-hhhhhcccCCC--cchhhhhcHhHhhhhhhcccc
Confidence            111           1444   667888899999999999998888 77788899999  99999999999998       


Q ss_pred             --cCCChhhhcccc
Q 032271          132 --SQSCLFAVAAYR  143 (144)
Q Consensus       132 --SkSCP~CR~~l~  143 (144)
                        +++|||||++.+
T Consensus       208 ~~sksCP~CRv~s~  221 (344)
T KOG1039|consen  208 KTSKSCPFCRVPSS  221 (344)
T ss_pred             ccccCCCcccCccc
Confidence              789999999865

>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-05
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 41.2 bits (96), Expect = 2e-05
 Identities = 18/75 (24%), Positives = 29/75 (38%), Gaps = 11/75 (14%)

Query: 30  KERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRN 89
           +E   + ++F AII    ++LE    E E    +            EE     +  L+  
Sbjct: 16  EELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQK-----------EEVLSHMNDVLENE 64

Query: 90  DECGICMENCTKMVT 104
            +C IC E   + VT
Sbjct: 65  LQCIICSEYFIEAVT 79

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.11
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.04
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.02
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.94
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.93
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.9
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.9
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.89
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.89
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.89
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.88
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.88
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.87
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.87
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.86
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.85
2ect_A78 Ring finger protein 126; metal binding protein, st 98.84
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.84
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.83
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.82
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.82
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.81
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.8
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.8
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.8
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.79
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.78
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.78
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.78
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.77
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.76
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.75
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.74
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.74
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.68
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.68
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.67
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.67
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.66
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.63
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.63
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.61
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.6
2ea5_A68 Cell growth regulator with ring finger domain prot 98.59
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.58
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.56
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.54
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.52
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.51
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.49
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.49
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.44
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.44
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.28
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 98.26
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.23
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.2
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.16
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.01
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.0
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.99
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.77
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.65
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.44
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.03
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 96.9
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.84
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.55
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.53
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 95.84
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 91.73
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 89.62
3nw0_A238 Non-structural maintenance of chromosomes element 89.56
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 83.35
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
Probab=99.11  E-value=3.5e-11  Score=87.67  Aligned_cols=46  Identities=20%  Similarity=0.266  Sum_probs=38.0

Q ss_pred             CCCccccccccccccceecccCccCCCCCCCCCchhhhhHHhcc--ccCCChhhhcccc
Q 032271           87 DRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNA--RSQSCLFAVAAYR  143 (144)
Q Consensus        87 ~~e~eCgICME~~~k~V~~k~~~~~~Lpn~~C~H~fCl~Cir~~--rSkSCP~CR~~l~  143 (144)
                      +.+..|.||++.....|+         .+  |+|+||..|+..|  ++.+||.||.++.
T Consensus        51 ~~~~~C~iC~~~~~~~~~---------~~--CgH~fc~~Ci~~~~~~~~~CP~Cr~~~~   98 (138)
T 4ayc_A           51 ENELQCIICSEYFIEAVT---------LN--CAHSFCSYCINEWMKRKIECPICRKDIK   98 (138)
T ss_dssp             HHHSBCTTTCSBCSSEEE---------ET--TSCEEEHHHHHHHTTTCSBCTTTCCBCC
T ss_pred             cccCCCcccCcccCCceE---------CC--CCCCccHHHHHHHHHcCCcCCCCCCcCC
Confidence            345689999999877666         45  9999999999977  4578999999874
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.08
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.03
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.98
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.93
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.87
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.82
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.82
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.78
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.67
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.66
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.53
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.5
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.38
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.17
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.85
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.74
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 93.03
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.08  E-value=1.3e-11  Score=78.47  Aligned_cols=48  Identities=15%  Similarity=0.270  Sum_probs=37.1

Q ss_pred             cCCCcccccccccccc--ceecccCccCCCCCCCCCchhhhhHHhcc--ccCCChhhhccc
Q 032271           86 LDRNDECGICMENCTK--MVTRKHFSLERIPDKYFSHNGLIMNYRNA--RSQSCLFAVAAY  142 (144)
Q Consensus        86 ~~~e~eCgICME~~~k--~V~~k~~~~~~Lpn~~C~H~fCl~Cir~~--rSkSCP~CR~~l  142 (144)
                      ++.+.+|+|||+....  .+.       .||.  |+|.||..|+.+|  ++.+||.||.++
T Consensus         2 ~ed~~~C~ICl~~~~~~~~~~-------~l~~--C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i   53 (55)
T d1iyma_           2 MDDGVECAVCLAELEDGEEAR-------FLPR--CGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CCCSCCCTTTCCCCCTTSCCE-------ECSS--SCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCCCCeEECccccCCCEEE-------EeCC--CCCcccHHHHHHHHHhCCcCCCCCCEe
Confidence            3557789999987532  222       2577  9999999999988  457899999876
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure