Citrus Sinensis ID: 032317

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELCPSAFKDSSSPSSKSRKSAQK
cHHHHHHHHHHccccccccHHHHHccccccHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccHHHHcccccccccccccccccccccccccccccccccHHHHHHccc
cHHHHHHHHHHHcccccccHHHHHHcccccHHHHHHHHHHHcccccEEEEccHHHHHHHccccccccccccccccHHHHHHHHHHHccHHHHHHHcHHEHEcccEEccccccccccccHHHHcHHHccccccccccccccccc
mkkiapicltkydgdipssldellllpgigpkmAHLVMNVGwnnvqgicVDTHVHRIcnrlgwvsqpgrkqktsspeqTREVLQLWlpkeewvpinpllvgfgqtictpirprcgmcsvselcpsafkdssspssksrksaqk
MKKIAPICltkydgdipSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRlgwvsqpgrkqktsspeqTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELCPsafkdssspssksrksaqk
MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELCPsafkdssspssksrksAQK
****APICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWV*****************VLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELC********************
*KKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELC********************
MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWVS**************REVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELCP*******************
MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELCPSAF****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELCPSAFKDSSSPSSKSRKSAQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query143 2.2.26 [Sep-21-2011]
Q2KID2305 Endonuclease III-like pro yes no 0.846 0.396 0.579 7e-39
P78549312 Endonuclease III-like pro yes no 0.846 0.387 0.555 8e-36
P54137298 Probable endonuclease III yes no 0.832 0.399 0.555 1e-35
Q09907 355 Endonuclease III homolog yes no 0.923 0.371 0.510 1e-35
O35980300 Endonuclease III-like pro yes no 0.846 0.403 0.531 2e-35
Q08214380 DNA base excision repair yes no 0.965 0.363 0.405 1e-26
Q8SRB8238 Endonuclease III homolog yes no 0.818 0.491 0.472 9e-25
Q9WYK0213 Endonuclease III OS=Therm yes no 0.790 0.530 0.471 2e-24
P31378399 Mitochondrial DNA base ex no no 0.678 0.243 0.485 2e-22
Q58030 344 Putative endonuclease MJ0 yes no 0.727 0.302 0.478 8e-19
>sp|Q2KID2|NTHL1_BOVIN Endonuclease III-like protein 1 OS=Bos taurus GN=NTHL1 PE=2 SV=1 Back     alignment and function desciption
 Score =  159 bits (401), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 73/126 (57%), Positives = 86/126 (68%), Gaps = 5/126 (3%)

Query: 1   MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNR 60
           +K+ + I   +YDGDIP+S+ EL+ LPG+GPKMAHL M V W  V GI VDTHVHRI NR
Sbjct: 182 IKQTSAILQQRYDGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANR 241

Query: 61  LGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVS 120
           L W      K+ T SPE+TR  L+ WLP+E W  IN LLVGFGQ  C PIRPRC  C   
Sbjct: 242 LRWT-----KKATKSPEETRRALEEWLPRELWSEINGLLVGFGQQTCLPIRPRCQACLNR 296

Query: 121 ELCPSA 126
            LCP+A
Sbjct: 297 ALCPAA 302
Has both an apurinic and/or apyrimidinic endonuclease activity and a DNA N-glycosylase activity. Incises damaged DNA at cytosines, thymines and guanines. Acts on a damaged strand, 5' from the damaged site. Required for the repair of both oxidative DNA damage and spontaneous mutagenic lesions.
Bos taurus (taxid: 9913)
EC: 4EC: .EC: 2EC: .EC: 9EC: 9EC: .EC: 1EC: 8
>sp|P78549|NTHL1_HUMAN Endonuclease III-like protein 1 OS=Homo sapiens GN=NTHL1 PE=1 SV=2 Back     alignment and function description
>sp|P54137|NTH1_CAEEL Probable endonuclease III homolog OS=Caenorhabditis elegans GN=nth-1 PE=1 SV=2 Back     alignment and function description
>sp|Q09907|NTH1_SCHPO Endonuclease III homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nth1 PE=1 SV=1 Back     alignment and function description
>sp|O35980|NTHL1_MOUSE Endonuclease III-like protein 1 OS=Mus musculus GN=Nthl1 PE=2 SV=1 Back     alignment and function description
>sp|Q08214|NTG2_YEAST DNA base excision repair N-glycosylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTG2 PE=1 SV=1 Back     alignment and function description
>sp|Q8SRB8|NTH1_ENCCU Endonuclease III homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=NTH1 PE=1 SV=1 Back     alignment and function description
>sp|Q9WYK0|END3_THEMA Endonuclease III OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=nth PE=3 SV=1 Back     alignment and function description
>sp|P31378|NTG1_YEAST Mitochondrial DNA base excision repair N-glycosylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTG1 PE=1 SV=1 Back     alignment and function description
>sp|Q58030|Y613_METJA Putative endonuclease MJ0613 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0613 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
224093156 362 predicted protein [Populus trichocarpa] 0.986 0.389 0.815 3e-67
255587056 357 endonuclease III, putative [Ricinus comm 0.986 0.394 0.808 5e-66
356541151 354 PREDICTED: endonuclease III-like protein 0.909 0.367 0.861 1e-63
356547306 290 PREDICTED: endonuclease III-like protein 0.972 0.479 0.784 3e-61
449468790 386 PREDICTED: endonuclease III-like protein 0.986 0.365 0.787 3e-60
18402669 379 endonuclease III [Arabidopsis thaliana] 0.909 0.343 0.807 6e-60
145330326 377 endonuclease III [Arabidopsis thaliana] 0.909 0.344 0.807 6e-60
297743769 379 unnamed protein product [Vitis vinifera] 0.972 0.366 0.856 8e-60
359478121 355 PREDICTED: endonuclease III-like protein 0.972 0.391 0.856 8e-60
21537257 379 putative endonuclease [Arabidopsis thali 0.909 0.343 0.8 2e-59
>gi|224093156|ref|XP_002309812.1| predicted protein [Populus trichocarpa] gi|222852715|gb|EEE90262.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 115/141 (81%), Positives = 131/141 (92%)

Query: 1   MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNR 60
           +KKIA ICL KYDGDIPSSL++LL LPGIGPKMAHLVMN+ WNNVQGICVDTHVHRICNR
Sbjct: 217 LKKIAKICLLKYDGDIPSSLEDLLSLPGIGPKMAHLVMNIAWNNVQGICVDTHVHRICNR 276

Query: 61  LGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVS 120
           LGWV++PG KQKTS+PE+TRE LQLWLPK+EWVPINPLLVGFGQTICTP+RPRCGMC +S
Sbjct: 277 LGWVARPGTKQKTSTPEETREALQLWLPKDEWVPINPLLVGFGQTICTPLRPRCGMCCIS 336

Query: 121 ELCPSAFKDSSSPSSKSRKSA 141
           E CPSAFK++SSP+SK ++S 
Sbjct: 337 EFCPSAFKETSSPASKQKRSG 357

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255587056|ref|XP_002534117.1| endonuclease III, putative [Ricinus communis] gi|223525829|gb|EEF28268.1| endonuclease III, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356541151|ref|XP_003539044.1| PREDICTED: endonuclease III-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356547306|ref|XP_003542056.1| PREDICTED: endonuclease III-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449468790|ref|XP_004152104.1| PREDICTED: endonuclease III-like protein 1-like [Cucumis sativus] gi|449521044|ref|XP_004167541.1| PREDICTED: endonuclease III-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18402669|ref|NP_565725.1| endonuclease III [Arabidopsis thaliana] gi|20198157|gb|AAD26474.2| putative endonuclease [Arabidopsis thaliana] gi|330253455|gb|AEC08549.1| endonuclease III [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145330326|ref|NP_001077988.1| endonuclease III [Arabidopsis thaliana] gi|17380754|gb|AAL36207.1| putative endonuclease [Arabidopsis thaliana] gi|20259623|gb|AAM14168.1| putative endonuclease [Arabidopsis thaliana] gi|330253456|gb|AEC08550.1| endonuclease III [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297743769|emb|CBI36652.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359478121|ref|XP_002264475.2| PREDICTED: endonuclease III-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|21537257|gb|AAM61598.1| putative endonuclease [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
TAIR|locus:2061345379 ATNTH1 [Arabidopsis thaliana ( 0.867 0.327 0.822 6.8e-56
TAIR|locus:2198738386 NTH2 "endonuclease III 2" [Ara 0.867 0.321 0.758 1.3e-52
DICTYBASE|DDB_G0277247349 apnB "putative endonuclease II 0.818 0.335 0.548 2.4e-35
UNIPROTKB|Q2KID2305 NTHL1 "Endonuclease III-like p 0.832 0.390 0.580 5.1e-35
UNIPROTKB|E2QX23312 NTHL1 "Uncharacterized protein 0.832 0.381 0.564 2.2e-34
UNIPROTKB|F1NQP6251 NTHL1 "Uncharacterized protein 0.832 0.474 0.548 3.6e-34
FB|FBgn0032907388 CG9272 [Drosophila melanogaste 0.832 0.306 0.524 7.4e-34
WB|WBGene00011201298 nth-1 [Caenorhabditis elegans 0.818 0.392 0.556 7.4e-34
UNIPROTKB|F1RFB3313 NTHL1 "Uncharacterized protein 0.832 0.380 0.556 2e-33
RGD|1309289300 Nthl1 "nth (endonuclease III)- 0.832 0.396 0.556 2e-33
TAIR|locus:2061345 ATNTH1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 576 (207.8 bits), Expect = 6.8e-56, P = 6.8e-56
 Identities = 102/124 (82%), Positives = 112/124 (90%)

Query:     1 MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNR 60
             MKKIA ICL KYDGDIPSSLD+LL LPGIGPKMAHL++++ WN+VQGICVDTHVHRICNR
Sbjct:   234 MKKIARICLVKYDGDIPSSLDDLLSLPGIGPKMAHLILHIAWNDVQGICVDTHVHRICNR 293

Query:    61 LGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVS 120
             LGWVS+PG KQKT+SPE+TR  LQ WLPKEEWV INPLLVGFGQ ICTPIRPRC  CSVS
Sbjct:   294 LGWVSRPGTKQKTTSPEETRVALQQWLPKEEWVAINPLLVGFGQMICTPIRPRCEACSVS 353

Query:   121 ELCP 124
             +LCP
Sbjct:   354 KLCP 357
GO:0003677 "DNA binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004519 "endonuclease activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005739 "mitochondrion" evidence=ISM
GO:0006281 "DNA repair" evidence=IEA
GO:0006284 "base-excision repair" evidence=IEA;ISS;IDA
GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA
GO:0019104 "DNA N-glycosylase activity" evidence=IDA
GO:0042644 "chloroplast nucleoid" evidence=IDA
TAIR|locus:2198738 NTH2 "endonuclease III 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277247 apnB "putative endonuclease III" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KID2 NTHL1 "Endonuclease III-like protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QX23 NTHL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQP6 NTHL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0032907 CG9272 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00011201 nth-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFB3 NTHL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1309289 Nthl1 "nth (endonuclease III)-like 1 (E.coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.2.99LOW CONFIDENCE prediction!
4th Layer4.2.99.18LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_VII000186
hypothetical protein (362 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.X.1153.1
hypothetical protein; Excises uracil residues from the DNA which can arise as a result of misin [...] (216 aa)
•   • • 0.697
eugene3.27440001
Peptide exporter, ABC transporter family protein (648 aa)
      • 0.679
gw1.XVI.1419.1
hypothetical protein (428 aa)
     •• 0.635
gw1.XIII.413.1
annotation not avaliable (325 aa)
    • • 0.574
fgenesh4_pg.C_scaffold_2544000001
Predicted protein (312 aa)
•     • 0.506
fgenesh4_pg.C_LG_X000749
hypothetical protein (352 aa)
    • • 0.460
gw1.VII.3564.1
hypothetical protein (207 aa)
    • • 0.454
gw1.17858.2.1
annotation not avaliable (207 aa)
    • • 0.454
eugene3.00140919
hypothetical protein (817 aa)
•     • 0.447
eugene3.00280090
hypothetical protein (349 aa)
    • • 0.440

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
COG0177211 COG0177, Nth, Predicted EndoIII-related endonuclea 6e-53
smart00478149 smart00478, ENDO3c, endonuclease III 8e-31
cd00056158 cd00056, ENDO3c, endonuclease III; includes endonu 1e-30
TIGR01083191 TIGR01083, nth, endonuclease III 2e-30
COG1194 342 COG1194, MutY, A/G-specific DNA glycosylase [DNA r 2e-17
pfam00730144 pfam00730, HhH-GPD, HhH-GPD superfamily base excis 2e-17
PRK10702211 PRK10702, PRK10702, endonuclease III; Provisional 1e-16
TIGR01084275 TIGR01084, mutY, A/G-specific adenine glycosylase 2e-11
PRK13910 289 PRK13910, PRK13910, DNA glycosylase MutY; Provisio 1e-09
pfam0063330 pfam00633, HHH, Helix-hairpin-helix motif 6e-08
PRK10880 350 PRK10880, PRK10880, adenine DNA glycosylase; Provi 3e-06
TIGR00588310 TIGR00588, ogg, 8-oxoguanine DNA-glycosylase (ogg) 2e-04
smart0052521 smart00525, FES, iron-sulpphur binding domain in D 6e-04
>gnl|CDD|223255 COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  165 bits (421), Expect = 6e-53
 Identities = 52/128 (40%), Positives = 78/128 (60%), Gaps = 8/128 (6%)

Query: 2   KKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRL 61
           K++A I L K+ G++P + +ELL LPG+G K A++V++  +  +  I VDTHVHR+ NRL
Sbjct: 90  KELARILLEKFGGEVPDTREELLSLPGVGRKTANVVLSFAFG-IPAIAVDTHVHRVSNRL 148

Query: 62  GWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSE 121
           G V          +PE+  E L   +PKE W  ++  L+  G+ IC   +PRC  C +++
Sbjct: 149 GLV-------PGKTPEEVEEALMKLIPKELWTDLHHWLILHGRYICKARKPRCEECPLAD 201

Query: 122 LCPSAFKD 129
           LCPSA K 
Sbjct: 202 LCPSAGKT 209

Length = 211
>gnl|CDD|214684 smart00478, ENDO3c, endonuclease III Back     alignment and domain information
>gnl|CDD|238013 cd00056, ENDO3c, endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases Back     alignment and domain information
>gnl|CDD|130155 TIGR01083, nth, endonuclease III Back     alignment and domain information
>gnl|CDD|224115 COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|216088 pfam00730, HhH-GPD, HhH-GPD superfamily base excision DNA repair protein Back     alignment and domain information
>gnl|CDD|182661 PRK10702, PRK10702, endonuclease III; Provisional Back     alignment and domain information
>gnl|CDD|130156 TIGR01084, mutY, A/G-specific adenine glycosylase Back     alignment and domain information
>gnl|CDD|172427 PRK13910, PRK13910, DNA glycosylase MutY; Provisional Back     alignment and domain information
>gnl|CDD|109681 pfam00633, HHH, Helix-hairpin-helix motif Back     alignment and domain information
>gnl|CDD|182805 PRK10880, PRK10880, adenine DNA glycosylase; Provisional Back     alignment and domain information
>gnl|CDD|211589 TIGR00588, ogg, 8-oxoguanine DNA-glycosylase (ogg) Back     alignment and domain information
>gnl|CDD|197771 smart00525, FES, iron-sulpphur binding domain in DNA-(apurinic or apyrimidinic site) lyase (subfamily of ENDO3) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 143
COG0177211 Nth Predicted EndoIII-related endonuclease [DNA re 100.0
PRK10702211 endonuclease III; Provisional 100.0
PRK13910 289 DNA glycosylase MutY; Provisional 100.0
TIGR01084275 mutY A/G-specific adenine glycosylase. This equiva 100.0
PRK10880 350 adenine DNA glycosylase; Provisional 100.0
COG1194 342 MutY A/G-specific DNA glycosylase [DNA replication 100.0
KOG1921286 consensus Endonuclease III [Replication, recombina 100.0
TIGR01083191 nth endonuclease III. This equivalog model identif 99.97
KOG2457 555 consensus A/G-specific adenine DNA glycosylase [Re 99.94
PRK13913218 3-methyladenine DNA glycosylase; Provisional 99.92
COG2231215 Uncharacterized protein related to Endonuclease II 99.9
smart00478149 ENDO3c endonuclease III. includes endonuclease III 99.9
cd00056158 ENDO3c endonuclease III; includes endonuclease III 99.86
PRK01229208 N-glycosylase/DNA lyase; Provisional 99.8
TIGR00588310 ogg 8-oxoguanine DNA-glycosylase (ogg). All protei 99.77
KOG2875323 consensus 8-oxoguanine DNA glycosylase [Replicatio 99.58
PF0063330 HHH: Helix-hairpin-helix motif; InterPro: IPR00044 99.3
PRK10308283 3-methyl-adenine DNA glycosylase II; Provisional 99.28
COG0122285 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine 99.16
TIGR03252177 uncharacterized HhH-GPD family protein. This model 99.07
PF1057617 EndIII_4Fe-2S: Iron-sulfur binding domain of endon 98.24
PF00730108 HhH-GPD: HhH-GPD superfamily base excision DNA rep 98.06
smart0052526 FES FES domain. iron-sulpphur binding domain in DN 97.78
COG1059210 Thermostable 8-oxoguanine DNA glycosylase [DNA rep 97.63
PF09674232 DUF2400: Protein of unknown function (DUF2400); In 97.61
TIGR02757229 conserved hypothetical protein TIGR02757. Members 97.54
KOG1918254 consensus 3-methyladenine DNA glycosidase [Replica 97.32
smart0027826 HhH1 Helix-hairpin-helix DNA-binding motif class 1 97.29
PF1282664 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS 97.22
PRK00116192 ruvA Holliday junction DNA helicase RuvA; Reviewed 95.9
PF1283665 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE 95.77
COG1555149 ComEA DNA uptake protein and related DNA-binding p 95.67
PRK14605194 ruvA Holliday junction DNA helicase RuvA; Provisio 95.57
COG0353198 RecR Recombinational DNA repair protein (RecF path 95.35
PRK00076196 recR recombination protein RecR; Reviewed 95.33
TIGR00615195 recR recombination protein RecR. This family is ba 95.31
PF1471668 HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HU 95.29
TIGR01259120 comE comEA protein. This model describes the ComEA 95.26
PRK14601183 ruvA Holliday junction DNA helicase RuvA; Provisio 95.14
PRK13844200 recombination protein RecR; Provisional 95.11
COG1415373 Uncharacterized conserved protein [Function unknow 95.06
PRK13901196 ruvA Holliday junction DNA helicase RuvA; Provisio 94.88
COG0632201 RuvA Holliday junction resolvasome, DNA-binding su 94.79
PRK14606188 ruvA Holliday junction DNA helicase RuvA; Provisio 94.75
PRK14603197 ruvA Holliday junction DNA helicase RuvA; Provisio 94.7
PRK14602203 ruvA Holliday junction DNA helicase RuvA; Provisio 94.69
PRK14604195 ruvA Holliday junction DNA helicase RuvA; Provisio 94.64
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 94.61
PF0237187 Transposase_20: Transposase IS116/IS110/IS902 fami 94.58
TIGR0042669 competence protein ComEA helix-hairpin-helix repea 94.57
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 94.5
PRK00116192 ruvA Holliday junction DNA helicase RuvA; Reviewed 94.44
PF05559319 DUF763: Protein of unknown function (DUF763); Inte 94.36
PRK02515132 psbU photosystem II complex extrinsic protein prec 94.18
PRK14600186 ruvA Holliday junction DNA helicase RuvA; Provisio 94.11
PF1173193 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd 93.65
TIGR01259120 comE comEA protein. This model describes the ComEA 93.64
TIGR00084191 ruvA Holliday junction DNA helicase, RuvA subunit. 93.56
TIGR00084191 ruvA Holliday junction DNA helicase, RuvA subunit. 93.01
TIGR0042669 competence protein ComEA helix-hairpin-helix repea 93.01
PF1179832 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 92.84
PRK00024224 hypothetical protein; Reviewed 92.7
TIGR00608218 radc DNA repair protein radc. This family is based 92.62
PRK02515132 psbU photosystem II complex extrinsic protein prec 92.33
PRK14605194 ruvA Holliday junction DNA helicase RuvA; Provisio 92.26
PRK13482352 DNA integrity scanning protein DisA; Provisional 91.86
smart0027936 HhH2 Helix-hairpin-helix class 2 (Pol1 family) mot 91.84
cd00141307 NT_POLXc Nucleotidyltransferase (NT) domain of fam 91.11
smart00483 334 POLXc DNA polymerase X family. includes vertebrate 90.48
KOG2534 353 consensus DNA polymerase IV (family X) [Replicatio 89.79
PF1039152 DNA_pol_lambd_f: Fingers domain of DNA polymerase 89.14
cd0008075 HhH2_motif Helix-hairpin-helix class 2 (Pol1 famil 88.94
PRK08609 570 hypothetical protein; Provisional 88.13
COG4277404 Predicted DNA-binding protein with the Helix-hairp 87.46
PF00416107 Ribosomal_S13: Ribosomal protein S13/S18; InterPro 87.45
COG2003224 RadC DNA repair proteins [DNA replication, recombi 87.14
PRK12766 232 50S ribosomal protein L32e; Provisional 87.13
PF1283665 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE 87.0
PRK13901196 ruvA Holliday junction DNA helicase RuvA; Provisio 86.95
PRK14600186 ruvA Holliday junction DNA helicase RuvA; Provisio 86.44
PRK07956665 ligA NAD-dependent DNA ligase LigA; Validated 86.36
cd00141 307 NT_POLXc Nucleotidyltransferase (NT) domain of fam 86.23
PF14229122 DUF4332: Domain of unknown function (DUF4332) 85.9
smart00483 334 POLXc DNA polymerase X family. includes vertebrate 85.81
TIGR00575652 dnlj DNA ligase, NAD-dependent. The member of this 85.74
PRK14601183 ruvA Holliday junction DNA helicase RuvA; Provisio 85.72
PRK14602203 ruvA Holliday junction DNA helicase RuvA; Provisio 85.63
PRK14606188 ruvA Holliday junction DNA helicase RuvA; Provisio 85.29
PF1449094 HHH_4: Helix-hairpin-helix containing domain; PDB: 85.08
PRK14603197 ruvA Holliday junction DNA helicase RuvA; Provisio 84.92
PRK14604195 ruvA Holliday junction DNA helicase RuvA; Provisio 84.18
PRK14350669 ligA NAD-dependent DNA ligase LigA; Provisional 83.7
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 82.64
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 82.61
COG1491202 Predicted RNA-binding protein [Translation, riboso 82.57
PF0311866 RNA_pol_A_CTD: Bacterial RNA polymerase, alpha cha 82.26
COG1796 326 POL4 DNA polymerase IV (family X) [DNA replication 81.72
COG0632201 RuvA Holliday junction resolvasome, DNA-binding su 81.7
PF04919181 DUF655: Protein of unknown function (DUF655); Inte 80.82
COG1948254 MUS81 ERCC4-type nuclease [DNA replication, recomb 80.16
>COG0177 Nth Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] Back     alignment and domain information 
Probab=100.00  E-value=3.4e-43  Score=263.67  Aligned_cols=120  Identities=43%  Similarity=0.828  Sum_probs=115.7

Q ss_pred             CHHHHHHHHHHcCCCCcCcHHHHhcCCCCcHHHHHHHHHHhcCCCccccccchHHHHHHHhcccCCCCCCCCCCCHHHHH
Q 032317            1 MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWVSQPGRKQKTSSPEQTR   80 (143)
Q Consensus         1 l~~~a~~i~~~~~g~~p~~~~~L~~lpGIG~ktA~~Il~~~~~~~~~~pvD~~v~Rv~~Rl~~~~~~~~~~~~~~~~~~~   80 (143)
                      |+++|++|+++|||++|+++++|++|||||+|||++||+++||.+ +|+|||||.||+.||||.+       ..++++++
T Consensus        89 I~~~~~~l~e~~~g~vP~~~~eL~~LPGVGrKTAnvVL~~a~g~p-~i~VDTHV~Rvs~R~gl~~-------~~~p~~ve  160 (211)
T COG0177          89 IKELARILLEKFGGEVPDTREELLSLPGVGRKTANVVLSFAFGIP-AIAVDTHVHRVSNRLGLVP-------GKTPEEVE  160 (211)
T ss_pred             HHHHHHHHHHHcCCCCCchHHHHHhCCCcchHHHHHHHHhhcCCC-cccccchHHHHHHHhCCCC-------CCCHHHHH
Confidence            578999999999999999999999999999999999999999996 9999999999999999986       47899999


Q ss_pred             HHHHHhCCCCChhhHHHHHHHHHHHhccCCCCCCCCCCcCccCccccc
Q 032317           81 EVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELCPSAFK  128 (143)
Q Consensus        81 ~~l~~~~p~~~~~~~~~~l~~~G~~~C~~~~P~C~~CpL~~~C~~~~~  128 (143)
                      +.+.+++|++.|..+|.+|+.|||.+|++++|+|+.|||+++|+++.+
T Consensus       161 ~~L~~~iP~~~~~~~h~~lI~~GR~iC~ar~P~C~~C~l~~~C~~~~~  208 (211)
T COG0177         161 EALMKLIPKELWTDLHHWLILHGRYICKARKPRCEECPLADLCPSAGK  208 (211)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHhhhhhccCCCCCcCcccchhhCchhcc
Confidence            999999999999999999999999999999999999999999998765

>PRK10702 endonuclease III; Provisional Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information
>TIGR01084 mutY A/G-specific adenine glycosylase Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1921 consensus Endonuclease III [Replication, recombination and repair] Back     alignment and domain information
>TIGR01083 nth endonuclease III Back     alignment and domain information
>KOG2457 consensus A/G-specific adenine DNA glycosylase [Replication, recombination and repair] Back     alignment and domain information
>PRK13913 3-methyladenine DNA glycosylase; Provisional Back     alignment and domain information
>COG2231 Uncharacterized protein related to Endonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00478 ENDO3c endonuclease III Back     alignment and domain information
>cd00056 ENDO3c endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases Back     alignment and domain information
>PRK01229 N-glycosylase/DNA lyase; Provisional Back     alignment and domain information
>TIGR00588 ogg 8-oxoguanine DNA-glycosylase (ogg) Back     alignment and domain information
>KOG2875 consensus 8-oxoguanine DNA glycosylase [Replication, recombination and repair] Back     alignment and domain information
>PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] Back     alignment and domain information
>PRK10308 3-methyl-adenine DNA glycosylase II; Provisional Back     alignment and domain information
>COG0122 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03252 uncharacterized HhH-GPD family protein Back     alignment and domain information
>PF10576 EndIII_4Fe-2S: Iron-sulfur binding domain of endonuclease III; InterPro: IPR003651 Endonuclease III (4 Back     alignment and domain information
>PF00730 HhH-GPD: HhH-GPD superfamily base excision DNA repair protein This entry corresponds to Endonuclease III This entry corresponds to Alkylbase DNA glycosidase; InterPro: IPR003265 Endonuclease III (4 Back     alignment and domain information
>smart00525 FES FES domain Back     alignment and domain information
>COG1059 Thermostable 8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF09674 DUF2400: Protein of unknown function (DUF2400); InterPro: IPR014127 Members of this uncharacterised protein family are found sporadically, so far only among spirochetes, epsilon and delta proteobacteria, and Bacteroides Back     alignment and domain information
>TIGR02757 conserved hypothetical protein TIGR02757 Back     alignment and domain information
>KOG1918 consensus 3-methyladenine DNA glycosidase [Replication, recombination and repair] Back     alignment and domain information
>smart00278 HhH1 Helix-hairpin-helix DNA-binding motif class 1 Back     alignment and domain information
>PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B Back     alignment and domain information
>PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed Back     alignment and domain information
>PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A Back     alignment and domain information
>COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00076 recR recombination protein RecR; Reviewed Back     alignment and domain information
>TIGR00615 recR recombination protein RecR Back     alignment and domain information
>PF14716 HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HUZ_A 1HUO_A 2BPG_B 2BPF_A 1DK3_A 1BPE_A 1BNO_A 1BNP_A 1DK2_A Back     alignment and domain information
>TIGR01259 comE comEA protein Back     alignment and domain information
>PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK13844 recombination protein RecR; Provisional Back     alignment and domain information
>COG1415 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>PF02371 Transposase_20: Transposase IS116/IS110/IS902 family; InterPro: IPR003346 Transposases are needed for efficient transposition of the insertion sequence or transposon DNA Back     alignment and domain information
>TIGR00426 competence protein ComEA helix-hairpin-helix repeat region Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed Back     alignment and domain information
>PF05559 DUF763: Protein of unknown function (DUF763); InterPro: IPR008482 This family consists of several uncharacterised bacterial and archaeal proteins of unknown function Back     alignment and domain information
>PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional Back     alignment and domain information
>PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PF11731 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd1 is expressed as part of the pathogenicity locus operon in several different orders of bacteria [] Back     alignment and domain information
>TIGR01259 comE comEA protein Back     alignment and domain information
>TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit Back     alignment and domain information
>TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit Back     alignment and domain information
>TIGR00426 competence protein ComEA helix-hairpin-helix repeat region Back     alignment and domain information
>PF11798 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases [] Back     alignment and domain information
>PRK00024 hypothetical protein; Reviewed Back     alignment and domain information
>TIGR00608 radc DNA repair protein radc Back     alignment and domain information
>PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional Back     alignment and domain information
>PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK13482 DNA integrity scanning protein DisA; Provisional Back     alignment and domain information
>smart00279 HhH2 Helix-hairpin-helix class 2 (Pol1 family) motifs Back     alignment and domain information
>cd00141 NT_POLXc Nucleotidyltransferase (NT) domain of family X DNA Polymerases Back     alignment and domain information
>smart00483 POLXc DNA polymerase X family Back     alignment and domain information
>KOG2534 consensus DNA polymerase IV (family X) [Replication, recombination and repair] Back     alignment and domain information
>PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains Back     alignment and domain information
>cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only] Back     alignment and domain information
>PF00416 Ribosomal_S13: Ribosomal protein S13/S18; InterPro: IPR001892 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG2003 RadC DNA repair proteins [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12766 50S ribosomal protein L32e; Provisional Back     alignment and domain information
>PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A Back     alignment and domain information
>PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated Back     alignment and domain information
>cd00141 NT_POLXc Nucleotidyltransferase (NT) domain of family X DNA Polymerases Back     alignment and domain information
>PF14229 DUF4332: Domain of unknown function (DUF4332) Back     alignment and domain information
>smart00483 POLXc DNA polymerase X family Back     alignment and domain information
>TIGR00575 dnlj DNA ligase, NAD-dependent Back     alignment and domain information
>PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PF14490 HHH_4: Helix-hairpin-helix containing domain; PDB: 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>COG1491 Predicted RNA-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03118 RNA_pol_A_CTD: Bacterial RNA polymerase, alpha chain C terminal domain; InterPro: IPR011260 The core of the bacterial RNA polymerase (RNAP) consists of four subunits, two alpha, a beta and a beta', which are conserved from bacteria to mammals Back     alignment and domain information
>COG1796 POL4 DNA polymerase IV (family X) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04919 DUF655: Protein of unknown function (DUF655); InterPro: IPR007003 This family includes several uncharacterised archaeal proteins Back     alignment and domain information
>COG1948 MUS81 ERCC4-type nuclease [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
1orn_A226 Structure Of A Trapped Endonuclease Iii-Dna Covalen 1e-15
1p59_A226 Structure Of A Non-Covalent Endonuclease Iii-Dna Co 4e-15
2abk_A211 Refinement Of The Native Structure Of Endonuclease 1e-13
3fsp_A 369 Muty Adenine Glycosylase Bound To A Transition Stat 7e-09
3g0q_A 352 Crystal Structure Of Muty Bound To Its Inhibitor Dn 9e-09
1rrs_A 369 Muty Adenine Glycosylase In Complex With Dna Contai 3e-08
1rrq_A 369 Muty Adenine Glycosylase In Complex With Dna Contai 3e-08
1kea_A221 Structure Of A Thermostable Thymine-Dna Glycosylase 1e-07
3n5n_X287 Crystal Structure Analysis Of The Catalytic Domain 4e-06
1kg7_A225 Crystal Structure Of The E161a Mutant Of E.coli Mut 8e-06
1kg5_A225 Crystal Structure Of The K142q Mutant Of E.Coli Mut 9e-06
1kg6_A225 Crystal Structure Of The K142r Mutant Of E.Coli Mut 1e-05
1wef_A225 Catalytic Domain Of Muty From Escherichia Coli K20a 1e-05
1muy_A225 Catalytic Domain Of Muty From Escherichia Coli Leng 1e-05
1kg4_A225 Crystal Structure Of The K142a Mutant Of E. Coli Mu 1e-05
1mud_A225 Catalytic Domain Of Muty From Escherichia Coli, D13 4e-05
1kqj_A225 Crystal Structure Of A Mutant Of Muty Catalytic Dom 2e-04
>pdb|1ORN|A Chain A, Structure Of A Trapped Endonuclease Iii-Dna Covalent Intermediate: Estranged-Guanine Complex Length = 226 Back     alignment and structure 
Iteration: 1

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 69/123 (56%), Gaps = 7/123 (5%)
Query: 1   MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNR 60
           ++K+  + + KY+G++P   DEL+ LPG+G K A++V++V +  V  I VDTHV R+  R
Sbjct: 93  IQKLCAMLIDKYNGEVPRDRDELMKLPGVGRKTANVVVSVAF-GVPAIAVDTHVERVSKR 151
Query: 61  LGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVS 120
           LG+       +   S  +  + L   +PKEEW   +  ++ FG+  C    P+C  C + 
Sbjct: 152 LGFC------RWDDSVLEVEKTLMKIIPKEEWSITHHRMIFFGRYHCKAQSPQCPSCPLL 205
Query: 121 ELC 123
            LC
Sbjct: 206 HLC 208
>pdb|1P59|A Chain A, Structure Of A Non-Covalent Endonuclease Iii-Dna Complex Length = 226 Back     alignment and structure
>pdb|2ABK|A Chain A, Refinement Of The Native Structure Of Endonuclease Iii To A Resolution Of 1.85 Angstrom Length = 211 Back     alignment and structure
>pdb|3FSP|A Chain A, Muty Adenine Glycosylase Bound To A Transition State Analog (1n) Paired With Dg In Duplexed Dna Length = 369 Back     alignment and structure
>pdb|3G0Q|A Chain A, Crystal Structure Of Muty Bound To Its Inhibitor Dna Length = 352 Back     alignment and structure
>pdb|1RRS|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An Abasic Site Length = 369 Back     alignment and structure
>pdb|1RRQ|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An A:oxog Pair Length = 369 Back     alignment and structure
>pdb|1KEA|A Chain A, Structure Of A Thermostable Thymine-Dna Glycosylase Length = 221 Back     alignment and structure
>pdb|3N5N|X Chain X, Crystal Structure Analysis Of The Catalytic Domain And Interdomain Connector Of Human Muty Homologue Length = 287 Back     alignment and structure
>pdb|1KG7|A Chain A, Crystal Structure Of The E161a Mutant Of E.coli Muty (core Fragment) Length = 225 Back     alignment and structure
>pdb|1KG5|A Chain A, Crystal Structure Of The K142q Mutant Of E.Coli Muty (Core Fragment) Length = 225 Back     alignment and structure
>pdb|1KG6|A Chain A, Crystal Structure Of The K142r Mutant Of E.Coli Muty (Core Fragment) Length = 225 Back     alignment and structure
>pdb|1WEF|A Chain A, Catalytic Domain Of Muty From Escherichia Coli K20a Mutant Length = 225 Back     alignment and structure
>pdb|1MUY|A Chain A, Catalytic Domain Of Muty From Escherichia Coli Length = 225 Back     alignment and structure
>pdb|1KG4|A Chain A, Crystal Structure Of The K142a Mutant Of E. Coli Muty (Core Fragment) Length = 225 Back     alignment and structure
>pdb|1MUD|A Chain A, Catalytic Domain Of Muty From Escherichia Coli, D138n Mutant Complexed To Adenine Length = 225 Back     alignment and structure
>pdb|1KQJ|A Chain A, Crystal Structure Of A Mutant Of Muty Catalytic Domain Length = 225 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
1orn_A226 Endonuclease III; DNA repair, DNA glycosylase, [4F 3e-32
2abk_A211 Endonuclease III; DNA-repair, DNA glycosylase; 1.8 6e-31
1pu6_A218 3-methyladenine DNA glycosylase; helix-hairpin-hel 2e-24
3fhg_A207 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 1e-16
1kea_A221 Possible G-T mismatches repair enzyme; DNA repair, 2e-15
3n0u_A219 Probable N-glycosylase/DNA lyase; structural genom 2e-12
1kg2_A225 A/G-specific adenine glycosylase; DNA repair, hydr 3e-12
3fsp_A 369 A/G-specific adenine glycosylase; protein-DNA comp 6e-12
3n5n_X287 A/G-specific adenine DNA glycosylase; alpha-helice 7e-11
2xhi_A360 N-glycosylase/DNA lyase; lyase-DNA complex, lyase/ 6e-08
3fhf_A214 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 7e-08
3i0w_A290 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8- 2e-05
>1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Length = 226 Back     alignment and structure
 Score =  113 bits (284), Expect = 3e-32
 Identities = 45/142 (31%), Positives = 73/142 (51%), Gaps = 9/142 (6%)

Query: 2   KKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRL 61
           +K+  + + KY+G++P   DEL+ LPG+G K A++V++V +  V  I VDTHV R+  RL
Sbjct: 94  QKLCAMLIDKYNGEVPRDRDELMKLPGVGRKTANVVVSVAF-GVPAIAVDTHVERVSKRL 152

Query: 62  GWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSE 121
           G+           S  +  + L   +PKEEW   +  ++ FG+  C    P+C  C +  
Sbjct: 153 GFCRW------DDSVLEVEKTLMKIIPKEEWSITHHRMIFFGRYHCKAQSPQCPSCPLLH 206

Query: 122 LCPSAFKDSSSPSSKSRKSAQK 143
           LC    K       + + + QK
Sbjct: 207 LCREGKK--RMRKREEKAANQK 226
>2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1 Length = 211 Back     alignment and structure
>1pu6_A 3-methyladenine DNA glycosylase; helix-hairpin-helix, base excision repair, hydrolase; HET: KCX; 1.64A {Helicobacter pylori} SCOP: a.96.1.5 PDB: 1pu7_A* 1pu8_A* Length = 218 Back     alignment and structure
>3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} Length = 207 Back     alignment and structure
>1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation; 2.00A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.96.1.2 Length = 221 Back     alignment and structure
>3n0u_A Probable N-glycosylase/DNA lyase; structural genomics, ISFI, DNA repair, 8-oxoguanine, base EX repair, PSI-2, protein structure initiative; 1.50A {Thermotoga maritima} Length = 219 Back     alignment and structure
>1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A Length = 225 Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Length = 369 Back     alignment and structure
>3n5n_X A/G-specific adenine DNA glycosylase; alpha-helices, helix-hairpin-helix motif, iron-sulfur cluste hydrolase; 2.30A {Homo sapiens} Length = 287 Back     alignment and structure
>2xhi_A N-glycosylase/DNA lyase; lyase-DNA complex, lyase/DNA complex, separation-OF-function helix-hairpin-helix, DNA repair; HET: 8OG; 1.55A {Homo sapiens} PDB: 1ko9_A 1lwy_A* 1hu0_A* 1lwv_A* 1lww_A* 2noe_A* 2noh_A* 2nol_A* 1n3c_A* 1fn7_A* 2noz_A* 1yqk_A 1yqr_A* 1yql_A* 1yqm_A* 2noi_A 1ebm_A* 1m3q_A* 1m3h_A* 1n39_A* ... Length = 360 Back     alignment and structure
>3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A* Length = 214 Back     alignment and structure
>3i0w_A 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 8OXOG, glycosylase, cytosine, hydrolase,lyase/DNA complex; HET: 8OG; 1.73A {Clostridium acetobutylicum} PDB: 3i0x_A* 3f10_A* 3f0z_A Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
3fsp_A 369 A/G-specific adenine glycosylase; protein-DNA comp 100.0
1orn_A226 Endonuclease III; DNA repair, DNA glycosylase, [4F 100.0
1kg2_A225 A/G-specific adenine glycosylase; DNA repair, hydr 100.0
2abk_A211 Endonuclease III; DNA-repair, DNA glycosylase; 1.8 100.0
3n5n_X287 A/G-specific adenine DNA glycosylase; alpha-helice 100.0
1kea_A221 Possible G-T mismatches repair enzyme; DNA repair, 100.0
1pu6_A218 3-methyladenine DNA glycosylase; helix-hairpin-hel 99.9
3fhf_A214 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 99.81
3i0w_A290 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8- 99.77
3fhg_A207 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 99.76
3n0u_A219 Probable N-glycosylase/DNA lyase; structural genom 99.76
2h56_A233 DNA-3-methyladenine glycosidase; 10174367, EC 3.2. 99.75
4b21_A232 Probable DNA-3-methyladenine glycosylase 2; hydrol 99.72
2xhi_A360 N-glycosylase/DNA lyase; lyase-DNA complex, lyase/ 99.71
3s6i_A228 DNA-3-methyladenine glycosylase 1; DNA glycosylase 99.65
2yg9_A225 DNA-3-methyladenine glycosidase II, putative; hydr 99.64
4e9f_A161 Methyl-CPG-binding domain protein 4; HHH DNA glyco 99.59
1mpg_A282 ALKA, 3-methyladenine DNA glycosylase II; DNA repa 99.59
2jhn_A295 ALKA, 3-methyladenine DNA-glycosylase; DNA repair, 99.47
1x2i_A75 HEF helicase/nuclease; alpha helix, helix-hairpin- 96.44
1kft_A78 UVRC, excinuclease ABC subunit C; helix-hairpin-he 96.28
1z00_A89 DNA excision repair protein ERCC-1; helix-hairpin- 96.26
2a1j_B91 DNA excision repair protein ERCC-1; XPF, xeroderma 96.18
2ztd_A212 Holliday junction ATP-dependent DNA helicase RUVA; 96.03
1ixr_A191 Holliday junction DNA helicase RUVA; heterooligome 95.99
2duy_A75 Competence protein comea-related protein; helix-ha 95.91
1cuk_A203 RUVA protein; DNA repair, SOS response, DNA-bindin 95.82
3vdp_A212 Recombination protein RECR; zinc finger, DNA repai 95.57
2duy_A75 Competence protein comea-related protein; helix-ha 95.42
2i5h_A205 Hypothetical protein AF1531; PFAM:DUF655, PSI-2, s 95.32
1vdd_A228 Recombination protein RECR; helix-hairpin-helix, z 95.26
2edu_A98 Kinesin-like protein KIF22; kinesin-like DNA bindi 95.25
1s5l_U134 Photosystem II 12 kDa extrinsic protein; photosynt 95.12
3arc_U97 Photosystem II 12 kDa extrinsic protein; PSII, mem 94.92
2a1j_A63 DNA repair endonuclease XPF; XPF, xeroderma pigmen 94.52
2edu_A98 Kinesin-like protein KIF22; kinesin-like DNA bindi 94.28
1z00_B84 DNA repair endonuclease XPF; helix-hairpin-helix, 93.6
2kp7_A87 Crossover junction endonuclease MUS81; helix-hairp 93.04
1ixr_A191 Holliday junction DNA helicase RUVA; heterooligome 93.0
2ztd_A212 Holliday junction ATP-dependent DNA helicase RUVA; 92.76
2bcq_A 335 DNA polymerase lambda; misalignment, extrahelical, 92.51
2fmp_A 335 DNA polymerase beta; nucleotidyl transferase, tran 92.47
3arc_U97 Photosystem II 12 kDa extrinsic protein; PSII, mem 92.36
3c1y_A377 DNA integrity scanning protein DISA; DNA damage, D 92.23
1cuk_A203 RUVA protein; DNA repair, SOS response, DNA-bindin 91.75
1z00_A89 DNA excision repair protein ERCC-1; helix-hairpin- 91.64
2ihm_A 360 POL MU, DNA polymerase MU; helix-turn-helix, trans 91.55
4glx_A586 DNA ligase; inhibitor, ligase-ligase inhibitor-DNA 91.53
1dgs_A667 DNA ligase; AMP complex, NAD+-dependent; HET: DNA 91.32
1kft_A78 UVRC, excinuclease ABC subunit C; helix-hairpin-he 90.73
2a1j_B91 DNA excision repair protein ERCC-1; XPF, xeroderma 90.69
1s5l_U134 Photosystem II 12 kDa extrinsic protein; photosynt 90.42
1x2i_A75 HEF helicase/nuclease; alpha helix, helix-hairpin- 90.3
1jms_A 381 Terminal deoxynucleotidyltransferase; polymerase; 89.91
2w9m_A 578 Polymerase X; SAXS, DNA repair, DNA polymerase, DN 88.94
2owo_A671 DNA ligase; protein-DNA complex, ligase-DNA comple 88.91
2fmp_A 335 DNA polymerase beta; nucleotidyl transferase, tran 88.64
1vq8_Y 241 50S ribosomal protein L32E; ribosome 50S, protein- 88.24
2ihm_A 360 POL MU, DNA polymerase MU; helix-turn-helix, trans 87.58
2bcq_A 335 DNA polymerase lambda; misalignment, extrahelical, 87.09
3b0x_A 575 DNA polymerase beta family (X family); structural 86.72
1jms_A 381 Terminal deoxynucleotidyltransferase; polymerase; 86.07
3sgi_A615 DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tub 83.42
3bqs_A93 Uncharacterized protein; 10114F, NYSGXRC, PSI-2, s 82.15
3r8n_M114 30S ribosomal protein S13; protein biosynthesis, R 81.26
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-38  Score=254.79  Aligned_cols=138  Identities=25%  Similarity=0.443  Sum_probs=123.6

Q ss_pred             CHHHHHHHHHHcCCCCcCcHHHHhcCCCCcHHHHHHHHHHhcCCCccccccchHHHHHHHhcccCCCCCCCCCCCHHHHH
Q 032317            1 MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWVSQPGRKQKTSSPEQTR   80 (143)
Q Consensus         1 l~~~a~~i~~~~~g~~p~~~~~L~~lpGIG~ktA~~Il~~~~~~~~~~pvD~~v~Rv~~Rl~~~~~~~~~~~~~~~~~~~   80 (143)
                      |+++|+.|+++|+|++|+++++|++|||||+|||++|++|+|+++ +++||+||.||+.|+|+++.+...  ..++++++
T Consensus        98 l~~~a~~~~~~~~g~~p~~~~~L~~l~GIG~~tA~~il~~~~~~~-~~~vD~~v~Rv~~rl~~~~~~~~~--~~~~~~~~  174 (369)
T 3fsp_A           98 LHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVP-EPAVDGNVMRVLSRLFLVTDDIAK--PSTRKRFE  174 (369)
T ss_dssp             HHHHHHHHHHHHTTCCCCSHHHHHTSTTCCHHHHHHHHHHHHCCC-CCCCCHHHHHHHHHHTTCCSCTTS--HHHHHHHH
T ss_pred             HHHHHHHHHHHcCCCChhHHHHHhcCCCcCHHHHHHHHHHHCCCC-cccccHHHHHHHHHHcCcccCccc--cchHHHHH
Confidence            578999999999999999999999999999999999999999995 899999999999999988643221  34678899


Q ss_pred             HHHHHhCCCCChhhHHHHHHHHHHHhccCCCCCCCCCCcCccCcccccC--CCCCCCcccccc
Q 032317           81 EVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELCPSAFKD--SSSPSSKSRKSA  141 (143)
Q Consensus        81 ~~l~~~~p~~~~~~~~~~l~~~G~~~C~~~~P~C~~CpL~~~C~~~~~~--~~~~~~~~~~~~  141 (143)
                      +.+++++|.+.|++||++||+||+.+|++++|+|+.|||++.|.++..+  ..+|.+++|++.
T Consensus       175 ~~~~~~~p~~~~~~~~~~l~~~G~~~C~~~~P~C~~Cpl~~~C~~~~~~~~~~~PvK~~kk~~  237 (369)
T 3fsp_A          175 QIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAV  237 (369)
T ss_dssp             HHHHHHCCSSSHHHHHHHHHHHHHHTSCSSSCCTTTCTTGGGCHHHHHTCGGGCSCCCCCCCC
T ss_pred             HHHHHhCChhhHHHHHHHHHHHHHHhcCCCCCCCCCCCChhhhHHHhcCCcccCCccccccCc
Confidence            9999999999999999999999999999999999999999999998765  477887766554
>1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Back     alignment and structure
>1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A Back     alignment and structure
>2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1 Back     alignment and structure
>3n5n_X A/G-specific adenine DNA glycosylase; alpha-helices, helix-hairpin-helix motif, iron-sulfur cluste hydrolase; 2.30A {Homo sapiens} Back     alignment and structure
>1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation; 2.00A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.96.1.2 Back     alignment and structure
>1pu6_A 3-methyladenine DNA glycosylase; helix-hairpin-helix, base excision repair, hydrolase; HET: KCX; 1.64A {Helicobacter pylori} SCOP: a.96.1.5 PDB: 1pu7_A* 1pu8_A* Back     alignment and structure
>3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A* Back     alignment and structure
>3i0w_A 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 8OXOG, glycosylase, cytosine, hydrolase,lyase/DNA complex; HET: 8OG; 1.73A {Clostridium acetobutylicum} PDB: 3i0x_A* 3f10_A* 3f0z_A Back     alignment and structure
>3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3n0u_A Probable N-glycosylase/DNA lyase; structural genomics, ISFI, DNA repair, 8-oxoguanine, base EX repair, PSI-2, protein structure initiative; 1.50A {Thermotoga maritima} Back     alignment and structure
>2h56_A DNA-3-methyladenine glycosidase; 10174367, EC 3.2.2.-, struc genomics, PSI-2, protein structure initiative, joint center structural genomics; 2.55A {Bacillus halodurans} Back     alignment and structure
>4b21_A Probable DNA-3-methyladenine glycosylase 2; hydrolase-DNA complex, helix-hairpin-helix; HET: BGC 3DR; 1.45A {Schizosaccharomyces pombe} PDB: 4b22_A* 4b23_A* 4b24_A* Back     alignment and structure
>2xhi_A N-glycosylase/DNA lyase; lyase-DNA complex, lyase/DNA complex, separation-OF-function helix-hairpin-helix, DNA repair; HET: 8OG; 1.55A {Homo sapiens} PDB: 1ko9_A 1lwy_A* 1hu0_A* 1lwv_A* 1lww_A* 2noe_A* 2noh_A* 2nol_A* 1n3c_A* 1fn7_A* 2noz_A* 1yqk_A 1yqr_A* 1yql_A* 1yqm_A* 2noi_A 1ebm_A* 1m3q_A* 1m3h_A* 1n39_A* ... Back     alignment and structure
>3s6i_A DNA-3-methyladenine glycosylase 1; DNA glycosylase, DNA repair, helix-hairpin-helix (HHH), ABAS tetrahydrofuran (THF); HET: 3DR; 2.28A {Schizosaccharomyces pombe} Back     alignment and structure
>2yg9_A DNA-3-methyladenine glycosidase II, putative; hydrolase, DNA repair; 1.95A {Deinococcus radiodurans} PDB: 2yg8_A Back     alignment and structure
>4e9f_A Methyl-CPG-binding domain protein 4; HHH DNA glycosylase family, hydrolase-DNA complex; HET: DNA 3DR; 1.79A {Homo sapiens} PDB: 4e9e_A* 4e9g_A* 4e9h_A* 4ea5_A* 4dk9_A* 1ngn_A 4ea4_A* 4ew4_A* 4evv_A* 4ew0_A* 3iho_A Back     alignment and structure
>1mpg_A ALKA, 3-methyladenine DNA glycosylase II; DNA repair, base excision, methylation, ALK hydrolase; 1.80A {Escherichia coli} SCOP: a.96.1.3 d.129.1.2 PDB: 1diz_A 1pvs_A* 3cvs_A* 3cvt_A* 3cw7_A* 3cwa_A* 3cws_A* 3cwt_A* 3cwu_A* 3d4v_A* 3ogd_A* 3oh9_A* 3oh6_A* Back     alignment and structure
>2jhn_A ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-methyladenine, N3-methylcytosine, hyperthermophiles, hydrolase; HET: MBO MES; 1.8A {Archaeoglobus fulgidus} PDB: 2jhj_A Back     alignment and structure
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Back     alignment and structure
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Back     alignment and structure
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A Back     alignment and structure
>1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 Back     alignment and structure
>2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 Back     alignment and structure
>1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A Back     alignment and structure
>3vdp_A Recombination protein RECR; zinc finger, DNA repair, DNA binding; 2.45A {Thermoanaerobacter tengcongensis} PDB: 3vdu_A 3ve5_D Back     alignment and structure
>2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 Back     alignment and structure
>2i5h_A Hypothetical protein AF1531; PFAM:DUF655, PSI-2, structural genomics, protein structure initiative; 1.74A {Archaeoglobus fulgidus} SCOP: e.71.1.1 Back     alignment and structure
>1vdd_A Recombination protein RECR; helix-hairpin-helix, zinc finger, toprim, walker B ATP binding motif; 2.50A {Deinococcus radiodurans} SCOP: e.49.1.1 PDB: 2v1c_A Back     alignment and structure
>2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 Back     alignment and structure
>1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* Back     alignment and structure
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* Back     alignment and structure
>2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 Back     alignment and structure
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* Back     alignment and structure
>2kp7_A Crossover junction endonuclease MUS81; helix-hairpin-helix, tumour suppressor, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium; NMR {Mus musculus} Back     alignment and structure
>1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 Back     alignment and structure
>2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A Back     alignment and structure
>2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... Back     alignment and structure
>2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... Back     alignment and structure
>3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* Back     alignment and structure
>3c1y_A DNA integrity scanning protein DISA; DNA damage, DNA repair, DNA-binding, DNA binding protein; HET: DNA 2BA; 2.10A {Thermotoga maritima} PDB: 3c1z_A* 3c21_A* 3c23_A* Back     alignment and structure
>1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A Back     alignment and structure
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} Back     alignment and structure
>4glx_A DNA ligase; inhibitor, ligase-ligase inhibitor-DNA complex; HET: DNA 0XS; 1.90A {Escherichia coli} Back     alignment and structure
>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* Back     alignment and structure
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Back     alignment and structure
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Back     alignment and structure
>1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* Back     alignment and structure
>2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} Back     alignment and structure
>2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} Back     alignment and structure
>2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... Back     alignment and structure
>1vq8_Y 50S ribosomal protein L32E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.9.2.1 PDB: 1vq4_Y* 1vq5_Y* 1vq6_Y* 1vq7_Y* 1s72_Y* 1vq9_Y* 1vqk_Y* 1vql_Y* 1vqm_Y* 1vqn_Y* 1vqo_Y* 1vqp_Y* 1yhq_Y* 1yi2_Y* 1yij_Y* 1yit_Y* 1yj9_Y* 1yjn_Y* 1yjw_Y* 2otj_Y* ... Back     alignment and structure
>2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} Back     alignment and structure
>2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... Back     alignment and structure
>3b0x_A DNA polymerase beta family (X family); structural genomics, riken structural genomics/proteomics in RSGI, polxc, PHP, DRP lyase; HET: DNA DGT; 1.36A {Thermus thermophilus} PDB: 3au2_A* 3au6_A* 3auo_A* 3b0y_A* Back     alignment and structure
>1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* Back     alignment and structure
>3sgi_A DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 143
d1orna_214 a.96.1.1 (A:) Endonuclease III {Escherichia coli [ 3e-18
d2noha1190 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Hum 2e-15
d2abka_211 a.96.1.1 (A:) Endonuclease III {Escherichia coli [ 2e-14
d1keaa_217 a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Me 4e-13
d1pu6a_217 a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III 1e-12
d1rrqa1221 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacil 3e-12
d1kg2a_224 a.96.1.2 (A:) Catalytic domain of MutY {Escherichi 4e-12
>d1orna_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Length = 214 Back     information, alignment and structure

class: All alpha proteins
fold: DNA-glycosylase
superfamily: DNA-glycosylase
family: Endonuclease III
domain: Endonuclease III
species: Escherichia coli [TaxId: 562]

 Score = 75.0 bits (183), Expect = 3e-18
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 7/128 (5%)

Query: 1   MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNR 60
           ++K+  + + KY+G++P   DEL+ LPG+G K A++V++V +     I VDTHV R+  R
Sbjct: 90  IQKLCAMLIDKYNGEVPRDRDELMKLPGVGRKTANVVVSVAFGV-PAIAVDTHVERVSKR 148

Query: 61  LGWVSQPGRKQKTSSPEQTREVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVS 120
           LG+       +   S  +  + L   +PKEEW   +  ++ FG+  C    P+C  C + 
Sbjct: 149 LGF------CRWDDSVLEVEKTLMKIIPKEEWSITHHRMIFFGRYHCKAQSPQCPSCPLL 202

Query: 121 ELCPSAFK 128
            LC    K
Sbjct: 203 HLCREGKK 210
>d2noha1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} Length = 190 Back     information, alignment and structure
>d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure
>d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Methanobacterium thermoformicicum [TaxId: 145262]} Length = 217 Back     information, alignment and structure
>d1pu6a_ a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]} Length = 217 Back     information, alignment and structure
>d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]} Length = 221 Back     information, alignment and structure
>d1kg2a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]} Length = 224 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
d1orna_214 Endonuclease III {Escherichia coli [TaxId: 562]} 100.0
d2abka_211 Endonuclease III {Escherichia coli [TaxId: 562]} 100.0
d1keaa_217 Thymine-DNA glycosylase {Archaeon Methanobacterium 100.0
d1rrqa1221 Catalytic domain of MutY {Bacillus stearothermophi 100.0
d1kg2a_224 Catalytic domain of MutY {Escherichia coli [TaxId: 100.0
d1pu6a_217 3-Methyladenine DNA glycosylase III (MagIII) {Heli 99.94
d2noha1190 8-oxoguanine glycosylase {Human (Homo sapiens) [Ta 99.75
d1mpga1183 3-Methyladenine DNA glycosylase II (gene alkA or a 99.45
d1ngna_144 Mismatch-specific thymine glycosylase domain of th 99.21
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 97.15
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furi 97.09
d1bvsa271 DNA helicase RuvA subunit, middle domain {Mycobact 97.03
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [Tax 96.92
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 96.64
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 96.6
d2duya165 Uncharacterized protein TTHA1967 {Thermus thermoph 96.29
d2a1jb178 DNA excision repair protein ERCC-1 {Human (Homo sa 96.05
d3bzka190 Transcriptional accessory factor Tex {Pseudomonas 95.84
d2bcqa176 DNA polymerase lambda {Human (Homo sapiens) [TaxId 95.81
d1dgsa1181 NAD+-dependent DNA ligase, domain 3 {Thermus filif 95.81
d1vdda_199 Recombination protein RecR {Deinococcus radioduran 95.71
d2fmpa182 DNA polymerase beta, N-terminal (8 kD)-domain {Hum 95.69
d1pzna161 DNA repair protein Rad51, N-terminal domain {Archa 95.62
d1pzna161 DNA repair protein Rad51, N-terminal domain {Archa 95.56
d2edua191 KIF22, C-terminal domain {Human (Homo sapiens) [Ta 95.55
d2i1qa160 DNA repair protein Rad51, N-terminal domain {Archa 95.44
d2axtu198 Photosystem II 12 kDa extrinsic protein PsbU {Ther 95.35
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) 95.34
d2i1qa160 DNA repair protein Rad51, N-terminal domain {Archa 95.07
d1bvsa271 DNA helicase RuvA subunit, middle domain {Mycobact 95.05
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 94.61
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 94.5
d1jmsa195 Terminal deoxynucleotidyl transferase {Mouse (Mus 94.46
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [Tax 94.27
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 94.01
d2fmpa257 DNA polymerase beta {Human (Homo sapiens) [TaxId: 92.27
d2axtu198 Photosystem II 12 kDa extrinsic protein PsbU {Ther 92.15
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furi 91.95
d1jmsa360 Terminal deoxynucleotidyl transferase {Mouse (Mus 91.87
d2edua191 KIF22, C-terminal domain {Human (Homo sapiens) [Ta 91.42
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) 90.75
d2bcqa257 DNA polymerase lambda {Human (Homo sapiens) [TaxId 90.59
d1wuda177 HRDC domain from RecQ helicase {Escherichia coli [ 90.37
d1rxwa1105 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc 88.75
d2e1fa194 Werner syndrome ATP-dependent helicase, WRN {Human 88.61
d2a1jb178 DNA excision repair protein ERCC-1 {Human (Homo sa 88.36
d2duya165 Uncharacterized protein TTHA1967 {Thermus thermoph 88.36
d1szpa164 DNA repair protein Rad51, N-terminal domain {Baker 87.57
d1doqa_69 C-terminal domain of RNA polymerase alpha subunit 87.47
d1a77a1108 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met 87.21
d1xo1a1105 T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] 86.5
d2i5ha1180 Hypothetical protein AF1531 {Archaeoglobus fulgidu 85.28
d2gy9m1114 Ribosomal protein S13 {Escherichia coli [TaxId: 56 85.06
d2uubm1125 Ribosomal protein S13 {Thermus thermophilus [TaxId 84.82
d1ul1x1140 Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo 84.42
d1b43a1120 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr 82.86
d1b22a_70 DNA repair protein Rad51, N-terminal domain {Human 82.1
d3bzka190 Transcriptional accessory factor Tex {Pseudomonas 81.77
d2p6ra2198 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 80.05
>d1orna_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA-glycosylase
superfamily: DNA-glycosylase
family: Endonuclease III
domain: Endonuclease III
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=7.2e-42  Score=256.21  Aligned_cols=121  Identities=35%  Similarity=0.691  Sum_probs=113.5

Q ss_pred             CHHHHHHHHHHcCCCCcCcHHHHhcCCCCcHHHHHHHHHHhcCCCccccccchHHHHHHHhcccCCCCCCCCCCCHHHHH
Q 032317            1 MKKIAPICLTKYDGDIPSSLDELLLLPGIGPKMAHLVMNVGWNNVQGICVDTHVHRICNRLGWVSQPGRKQKTSSPEQTR   80 (143)
Q Consensus         1 l~~~a~~i~~~~~g~~p~~~~~L~~lpGIG~ktA~~Il~~~~~~~~~~pvD~~v~Rv~~Rl~~~~~~~~~~~~~~~~~~~   80 (143)
                      |+++|++|+++|+|++|.++++|++|||||+|||++||+|+|++ ++|+|||||.||+.|+|+++.      ..++..++
T Consensus        90 l~~~a~~i~~~~~g~vp~~~~~L~~LpGVG~kTA~~il~~a~~~-~~~~VDtnv~RV~~Rlg~~~~------~~~~~~~~  162 (214)
T d1orna_          90 IQKLCAMLIDKYNGEVPRDRDELMKLPGVGRKTANVVVSVAFGV-PAIAVDTHVERVSKRLGFCRW------DDSVLEVE  162 (214)
T ss_dssp             HHHHHHHHHHHSTTSCCSCHHHHTTSTTCCHHHHHHHHHHHHCC-CCCCCCHHHHHHHHHHTSSCT------TCCHHHHH
T ss_pred             HHHHhhhHHHHhCCCCCCCHHHHHhCcCcccchHHHHHHHHhcC-CcccccchHHHHHHHHHHhhc------ccchhhhh
Confidence            57899999999999999999999999999999999999999998 589999999999999999864      35678899


Q ss_pred             HHHHHhCCCCChhhHHHHHHHHHHHhccCCCCCCCCCCcCccCccccc
Q 032317           81 EVLQLWLPKEEWVPINPLLVGFGQTICTPIRPRCGMCSVSELCPSAFK  128 (143)
Q Consensus        81 ~~l~~~~p~~~~~~~~~~l~~~G~~~C~~~~P~C~~CpL~~~C~~~~~  128 (143)
                      +.+++++|.+.|++||++||+||+.+|++++|+|+.|||++.|.++++
T Consensus       163 ~~l~~~~p~~~~~~~~~~l~~~G~~iC~~~~P~C~~Cpl~~~C~~~~k  210 (214)
T d1orna_         163 KTLMKIIPKEEWSITHHRMIFFGRYHCKAQSPQCPSCPLLHLCREGKK  210 (214)
T ss_dssp             HHHHHHSCGGGHHHHHHHHHHHHHHTSCSSCCCGGGCTTGGGCHHHHH
T ss_pred             hhhhhcCccccHHHHHHHHHHHHHHHCcCCCCCCCCCCCcccChhhcc
Confidence            999999999999999999999999999999999999999999998764
>d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Methanobacterium thermoformicicum [TaxId: 145262]} Back     information, alignment and structure
>d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kg2a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pu6a_ a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2noha1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mpga1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bcqa1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dgsa1 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} Back     information, alignment and structure
>d1vdda_ e.49.1.1 (A:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fmpa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmsa1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1doqa_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Back     information, alignment and structure
>d2i5ha1 e.71.1.1 (A:16-195) Hypothetical protein AF1531 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gy9m1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2uubm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2p6ra2 a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure