Citrus Sinensis ID: 032810

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MEAASIFSPSIATPISNTPSVNRTTKYCKSKVEFACCNRRRCCYNLIGNRRWAAPSAASNDVSSVAGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCGGSGLVLREKDYFKCPECGMSYGLI
ccccccccccEEEccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEccccEEEEEEEHHHHHHHHHcccccccccEEEEcccEEcccccccccccc
ccEEEEccccccccccccccccccccccccEEEEccccccccccEEccccccccccccHccHHHHccccccEEEEEEEEEHHHcccHEEEEEEHHcHHEEEEHHcHHcccccEEEccccEEEccccccccccc
meaasifspsiatpisntpsvnrttkyckskvefaccnrrrCCYNlignrrwaapsaasndvssvagpvtAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEvcggsglvlrekdyfkcpecgmsygli
meaasifspsiatpisntpsvnrttKYCKSkvefaccnrRRCCYNLIGNRRWAAPSAASNDVSSVAGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCggsglvlrekdyfkcpecgmsygli
MEAASIFSPSIATPISNTPSVNRTTKYCKSKVEFACCNRRRCCYNLIGNRRWAAPSAASNDVSSVAGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCGGSGLVLREKDYFKCPECGMSYGLI
**********************RTTKYCKSKVEFACCNRRRCCYNLIGNRRWAAPSAASNDVSSVAGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCGGSGLVLREKDYFKCPECGMSY***
***************************************************WAAPSAASNDVSSVAGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCGGSGLVLREKDYFKCPECGMSYGLI
********PSIATPISNTPSVNRTTKYCKSKVEFACCNRRRCCYNLIGNRRWAA***********AGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCGGSGLVLREKDYFKCPECGMSYGLI
********PSIATPISNTPSVNRTTKYCKSKVEFACCNRRRCCYNLIGNRRW**PSAASND*SSVAGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCGGSGLVLREKDYFKCPECGMSYGLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAASIFSPSIATPISNTPSVNRTTKYCKSKVEFACCNRRRCCYNLIGNRRWAAPSAASNDVSSVAGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCGGSGLVLREKDYFKCPECGMSYGLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
255576318150 conserved hypothetical protein [Ricinus 0.872 0.773 0.569 1e-28
225460765136 PREDICTED: uncharacterized protein LOC10 0.593 0.580 0.708 2e-25
356552689141 PREDICTED: uncharacterized protein LOC10 0.676 0.638 0.652 2e-25
297796439141 hypothetical protein ARALYDRAFT_331885 [ 0.812 0.765 0.549 3e-24
224120148101 predicted protein [Populus trichocarpa] 0.533 0.702 0.780 9e-24
42568556143 uncharacterized protein [Arabidopsis tha 0.609 0.566 0.641 1e-22
297788179124 predicted protein [Arabidopsis lyrata su 0.676 0.725 0.597 1e-22
357494841138 hypothetical protein MTR_5g094600 [Medic 0.451 0.434 0.783 9e-22
449518513129 PREDICTED: uncharacterized protein LOC10 0.616 0.635 0.647 1e-21
449463713125 PREDICTED: uncharacterized protein LOC10 0.789 0.84 0.478 1e-21
>gi|255576318|ref|XP_002529052.1| conserved hypothetical protein [Ricinus communis] gi|223531532|gb|EEF33363.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/130 (56%), Positives = 88/130 (67%), Gaps = 14/130 (10%)

Query: 1   MEAASIFSPSIATPISNTPSVNRT---TKYCKSKVEFACCNRRRCCYNLIGNRRWAAPSA 57
           MEAA   S  + +P+ NT +++R    T Y KS   F           LI NR+     A
Sbjct: 1   MEAAVSSSLILTSPL-NTKTLSRNRVITGYPKSTRTF----------RLIKNRKLTTTIA 49

Query: 58  ASNDVSSVAGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCGGSGLVLRE 117
           A N+VS+ A     EVTWQIIVGA+AGVTPFVVAGIEFSKRIIAQRRCE+CGG+GLV+RE
Sbjct: 50  AVNEVSAAADSGQVEVTWQIIVGAVAGVTPFVVAGIEFSKRIIAQRRCEICGGAGLVMRE 109

Query: 118 KDYFKCPECG 127
           KDYF+CP CG
Sbjct: 110 KDYFRCPGCG 119

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225460765|ref|XP_002274080.1| PREDICTED: uncharacterized protein LOC100250451 [Vitis vinifera] gi|297737538|emb|CBI26739.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356552689|ref|XP_003544695.1| PREDICTED: uncharacterized protein LOC100777123 [Glycine max] Back     alignment and taxonomy information
>gi|297796439|ref|XP_002866104.1| hypothetical protein ARALYDRAFT_331885 [Arabidopsis lyrata subsp. lyrata] gi|297311939|gb|EFH42363.1| hypothetical protein ARALYDRAFT_331885 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224120148|ref|XP_002331071.1| predicted protein [Populus trichocarpa] gi|222873035|gb|EEF10166.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|42568556|ref|NP_200368.2| uncharacterized protein [Arabidopsis thaliana] gi|332009268|gb|AED96651.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297788179|ref|XP_002862240.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297307541|gb|EFH38498.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357494841|ref|XP_003617709.1| hypothetical protein MTR_5g094600 [Medicago truncatula] gi|355519044|gb|AET00668.1| hypothetical protein MTR_5g094600 [Medicago truncatula] gi|388506926|gb|AFK41529.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449518513|ref|XP_004166286.1| PREDICTED: uncharacterized protein LOC101225021 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449463713|ref|XP_004149576.1| PREDICTED: uncharacterized protein LOC101220311 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
TAIR|locus:2162087143 AT5G55570 [Arabidopsis thalian 0.902 0.839 0.496 1.6e-24
TAIR|locus:2162087 AT5G55570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 280 (103.6 bits), Expect = 1.6e-24, P = 1.6e-24
 Identities = 66/133 (49%), Positives = 82/133 (61%)

Query:     1 MEAASIFS-PSIATPISNTPSVNRTTKYCKSKVEFACCNRRRCCYN-----LIGNRRWAA 54
             MEA+S+   PS+ T + + P      +  KS   F    RRR          + NRR   
Sbjct:     4 MEASSLCRVPSLWT-VRSRP------RQIKSTAGFVSPGRRRSRGGGGGMMTMSNRRLKT 56

Query:    55 PSAASNDVSSVAGPVTAEVTWQIIVGAIAGVTPFVVAGIEFSKRIIAQRRCEVCGGSGLV 114
              SA S    +VA    +E+TWQIIVG IAG+ PFVVAG+EFSKRIIAQ+RCE CGG+GLV
Sbjct:    57 TSALSELADTVAETGKSEITWQIIVGTIAGIIPFVVAGVEFSKRIIAQKRCEECGGTGLV 116

Query:   115 LREKDYFKCPECG 127
              R+K YF+CPECG
Sbjct:   117 SRDKKYFRCPECG 129


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.323   0.134   0.426    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      133       133   0.00091  102 3  11 22  0.37    31
                                                     30  0.43    33


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  584 (62 KB)
  Total size of DFA:  142 KB (2087 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  13.37u 0.10s 13.47t   Elapsed:  00:00:01
  Total cpu time:  13.37u 0.10s 13.47t   Elapsed:  00:00:01
  Start:  Fri May 10 04:40:14 2013   End:  Fri May 10 04:40:15 2013
GO:0005739 "mitochondrion" evidence=ISM

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
pfam0879233 pfam08792, A2L_zn_ribbon, A2L zinc ribbon domain 7e-04
>gnl|CDD|117362 pfam08792, A2L_zn_ribbon, A2L zinc ribbon domain Back     alignment and domain information 
 Score = 35.0 bits (81), Expect = 7e-04
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 102 QRRCEVCGGSGLVLREKDYFKCPECGMSY 130
            ++C+ CGG+G+V +E DY  C  CG S+
Sbjct: 3   LKKCKYCGGNGIVNKEDDYEVCIFCGASF 31

This zinc ribbon domain is found associated with some viral A2L transcription factors. Length = 33

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 133
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 97.22
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 95.49
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 93.88
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 93.37
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 93.02
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 91.37
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 91.13
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 90.53
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 90.53
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 90.5
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 89.62
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 89.52
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 89.35
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 89.16
PRK00635 1809 excinuclease ABC subunit A; Provisional 87.89
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 87.24
PRK14296 372 chaperone protein DnaJ; Provisional 87.05
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 87.02
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 86.67
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 86.01
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 86.0
PRK14295 389 chaperone protein DnaJ; Provisional 85.84
PRK14281 397 chaperone protein DnaJ; Provisional 85.77
PLN03165111 chaperone protein dnaJ-related; Provisional 85.67
PRK00762124 hypA hydrogenase nickel incorporation protein; Pro 85.52
PRK10767 371 chaperone protein DnaJ; Provisional 84.89
PRK14285 365 chaperone protein DnaJ; Provisional 84.72
COG0675364 Transposase and inactivated derivatives [DNA repli 84.59
PRK14284 391 chaperone protein DnaJ; Provisional 84.44
PRK14279 392 chaperone protein DnaJ; Provisional 84.37
PRK14297 380 chaperone protein DnaJ; Provisional 84.34
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 84.33
PRK14282 369 chaperone protein DnaJ; Provisional 84.32
PF10080102 DUF2318: Predicted membrane protein (DUF2318); Int 84.14
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 83.72
PRK14286 372 chaperone protein DnaJ; Provisional 83.67
PRK14298 377 chaperone protein DnaJ; Provisional 83.57
PF01927147 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 T 83.5
PRK14280 376 chaperone protein DnaJ; Provisional 83.4
PF0130269 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytos 83.03
PRK14298 377 chaperone protein DnaJ; Provisional 82.96
PRK14289 386 chaperone protein DnaJ; Provisional 82.86
PRK14277 386 chaperone protein DnaJ; Provisional 82.81
PRK0043250 30S ribosomal protein S27ae; Validated 82.81
PRK14282 369 chaperone protein DnaJ; Provisional 82.67
PRK14288 369 chaperone protein DnaJ; Provisional 82.47
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 82.37
PF1435461 Lar_restr_allev: Restriction alleviation protein L 82.36
PRK14287 371 chaperone protein DnaJ; Provisional 82.35
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 82.25
PLN03165111 chaperone protein dnaJ-related; Provisional 82.24
PRK14278 378 chaperone protein DnaJ; Provisional 82.21
PRK14280 376 chaperone protein DnaJ; Provisional 82.2
PRK14290 365 chaperone protein DnaJ; Provisional 82.09
PRK14296 372 chaperone protein DnaJ; Provisional 82.03
PRK14276 380 chaperone protein DnaJ; Provisional 82.02
PRK14276 380 chaperone protein DnaJ; Provisional 81.97
PRK14289 386 chaperone protein DnaJ; Provisional 81.75
PRK14284 391 chaperone protein DnaJ; Provisional 81.56
PRK14287 371 chaperone protein DnaJ; Provisional 81.46
PRK14277 386 chaperone protein DnaJ; Provisional 81.44
PRK14297 380 chaperone protein DnaJ; Provisional 81.32
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 81.14
PRK14301 373 chaperone protein DnaJ; Provisional 80.93
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 80.42
PRK14285 365 chaperone protein DnaJ; Provisional 80.37
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 80.34
PRK14294 366 chaperone protein DnaJ; Provisional 80.33
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 80.24
PRK14279 392 chaperone protein DnaJ; Provisional 80.14
PRK14290 365 chaperone protein DnaJ; Provisional 80.05
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information 
Probab=97.22  E-value=0.00026  Score=42.84  Aligned_cols=31  Identities=42%  Similarity=0.967  Sum_probs=27.3

Q ss_pred             eeeeccccccceeEeecCeeecCCCCCCCcc
Q 032810          101 AQRRCEVCGGSGLVLREKDYFKCPECGMSYG  131 (133)
Q Consensus       101 ~Q~rCe~C~GsGLV~r~~~~~kC~~CGGFl~  131 (133)
                      .+++|+.|++.||+.+++.+.-|+.||--.|
T Consensus         2 ~~~~C~~C~~~~i~~~~~~~~~C~~Cg~~~~   32 (33)
T PF08792_consen    2 NLKKCSKCGGNGIVNKEDDYEVCIFCGSSFP   32 (33)
T ss_pred             CceEcCCCCCCeEEEecCCeEEcccCCcEee
Confidence            4689999999999999999999999996554

>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF10080 DUF2318: Predicted membrane protein (DUF2318); InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF01927 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 This prokaryotic family of proteins have no known function Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF01302 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytoskeleton-associated proteins (CAP) are made of three distinct parts, an N-terminal section that is most probably globular and contains the CAP-Gly domain, a large central region predicted to be in an alpha-helical coiled-coil conformation and, finally, a short C-terminal globular domain Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 95.02
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 94.59
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 93.05
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 91.66
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 91.61
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 91.39
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 86.7
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 85.86
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 85.53
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 84.04
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 83.21
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 82.93
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 82.66
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
Probab=95.02  E-value=0.0093  Score=38.06  Aligned_cols=23  Identities=35%  Similarity=0.710  Sum_probs=19.2

Q ss_pred             eeeccccccceeEeecCeeecCCCCCC
Q 032810          102 QRRCEVCGGSGLVLREKDYFKCPECGM  128 (133)
Q Consensus       102 Q~rCe~C~GsGLV~r~~~~~kC~~CGG  128 (133)
                      |..|+.|+|+|-+..    .+|+.|+|
T Consensus         9 ~~~C~~C~GsG~~i~----~~C~~C~G   31 (53)
T 3lcz_A            9 ETTCPNCNGSGREEP----EPCPKCLG   31 (53)
T ss_dssp             EEECTTTTTSCEETT----EECTTTTT
T ss_pred             eccCcCCcccccCCC----CcCCCCCC
Confidence            678999999998764    67999987
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 91.44
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 91.43
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 91.18
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 87.34
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: DnaJ/Hsp40 cysteine-rich domain
superfamily: DnaJ/Hsp40 cysteine-rich domain
family: DnaJ/Hsp40 cysteine-rich domain
domain: Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=91.44  E-value=0.036  Score=34.63  Aligned_cols=26  Identities=38%  Similarity=0.981  Sum_probs=17.6

Q ss_pred             eeeccccccceeEeecCeeecCCCCCCC
Q 032810          102 QRRCEVCGGSGLVLREKDYFKCPECGMS  129 (133)
Q Consensus       102 Q~rCe~C~GsGLV~r~~~~~kC~~CGGF  129 (133)
                      +..|+.|+|+|-+...+.  +|+.|.|.
T Consensus        44 ~~~C~~C~G~G~~i~~~~--~C~~C~G~   69 (74)
T d1nlta3          44 QTECDVCHGTGDIIDPKD--RCKSCNGK   69 (74)
T ss_dssp             ECSCTTCSSSSSCCCTTS--BCSSSTTS
T ss_pred             EEECccCccceEEeCCCC--CCCCCCCe
Confidence            456888888886654332  68888774
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure