Citrus Sinensis ID: 033141


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MASASCSAAMLPFAETLKPRAHVDSSSDSKDHLINDTPKTTKVNRLHSIRVKAAANNGNTKRNSVVCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHFSLIQYQPHSSCVYV
ccccccccccccccccccccccccccccccccEEcccccccccccEEEEEEEEcccccccccccEEEEcccccccEEcccccccccccccccccEEccccEEEEccccccccEEEEEcccccEEEc
cccccccccccccccccccccEEcccccccEEEEEcccccccccccEEEEEEEccccccccccEEEEccccccccEEccccccccccccccccccEccccEEEEccccccEEEEEEEcccccEEEc
masascsaamlpfaetlkprahvdsssdskdhlindtpkttkvnrLHSIRVKAAanngntkrnsvvcadcdgngavlcsqckgsgvnavdffggqfkagdscwlcgqssqhfsliqyqphsscvyv
MASASCSAAMLPFAETLKPRAHVdsssdskdhlindtpkttkvnrlhsirvkaaanngntkrnsVVCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQhfsliqyqphsscvyv
MASASCSAAMLPFAETLKPRAHVDSSSDSKDHLINDTPKTTKVNRLHSIRVKAAANNGNTKRNSVVCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHFSLIQYQPHSSCVYV
************************************************IRV*********KRNSVVCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHFSLIQYQP*******
****SCS*************************LINDTPKTTKV**********************VCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHFSLIQYQPHSSCVYV
********AMLPFAETLK*************HLINDTPKTTKVNRLHSIRVKAAANNGNTKRNSVVCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHFSLIQYQPHSSCVYV
*****CSAAMLPFAETLKPRAHVDSSSDSKDHLINDTPKTTKVNRLHSIRVKAAANNGNTKRNSVVCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHFSLIQYQPHSSCVYV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASASCSAAMLPFAETLKPRAHVDSSSDSKDHLINDTPKTTKVNRLHSIRVKAAANNGNTKRNSVVCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHFSLIQYQPHSSCVYV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
449437394132 PREDICTED: uncharacterized protein LOC10 0.841 0.803 0.551 3e-21
359476132139 PREDICTED: uncharacterized protein LOC10 0.722 0.654 0.551 1e-20
296082027117 unnamed protein product [Vitis vinifera] 0.722 0.777 0.551 2e-20
224141891132 predicted protein [Populus trichocarpa] 0.849 0.810 0.518 4e-20
13430174131 putative chaperon P13.9 [Castanea sativa 0.833 0.801 0.476 1e-19
255548936131 conserved hypothetical protein [Ricinus 0.817 0.786 0.495 4e-18
351727561132 uncharacterized protein LOC100306315 [Gl 0.769 0.734 0.504 6e-18
388502670131 unknown [Lotus japonicus] 0.579 0.557 0.621 1e-17
356517012133 PREDICTED: uncharacterized protein LOC10 0.571 0.541 0.583 3e-17
351721605133 uncharacterized protein LOC100500330 [Gl 0.833 0.789 0.439 1e-16
>gi|449437394|ref|XP_004136477.1| PREDICTED: uncharacterized protein LOC101218754 [Cucumis sativus] gi|449517804|ref|XP_004165934.1| PREDICTED: uncharacterized LOC101218754 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 1   MASASCSAAMLPFAETLKPRAHVDSSSDSKDHLI-NDTPKTTKVNRLHSIRVKAAANNGN 59
           MAS+S S +   F+ T    A +   S+ K +LI N     +   R   + +KAA N+ N
Sbjct: 1   MASSSFSPSANCFSSTTTLSAIIRDCSNQKLNLIHNGFHDYSSPARFPHLILKAAKNDRN 60

Query: 60  TKRNSVVCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCG 106
           TK NSV+C DCDGNGAV+CSQCKG GVNAVDFF GQFKAG+SCWLCG
Sbjct: 61  TKPNSVICGDCDGNGAVVCSQCKGKGVNAVDFFNGQFKAGESCWLCG 107




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359476132|ref|XP_003631795.1| PREDICTED: uncharacterized protein LOC100854903 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082027|emb|CBI21032.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224141891|ref|XP_002324294.1| predicted protein [Populus trichocarpa] gi|118487830|gb|ABK95738.1| unknown [Populus trichocarpa] gi|222865728|gb|EEF02859.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|13430174|gb|AAK25754.1|AF334834_1 putative chaperon P13.9 [Castanea sativa] Back     alignment and taxonomy information
>gi|255548936|ref|XP_002515524.1| conserved hypothetical protein [Ricinus communis] gi|223545468|gb|EEF46973.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|351727561|ref|NP_001236909.1| uncharacterized protein LOC100306315 [Glycine max] gi|255628181|gb|ACU14435.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388502670|gb|AFK39401.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356517012|ref|XP_003527184.1| PREDICTED: uncharacterized protein LOC100808293 [Glycine max] Back     alignment and taxonomy information
>gi|351721605|ref|NP_001236447.1| uncharacterized protein LOC100500330 [Glycine max] gi|255630057|gb|ACU15382.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
TAIR|locus:2079132136 AT3G47650 [Arabidopsis thalian 0.682 0.632 0.516 3.1e-19
TAIR|locus:2079132 AT3G47650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 230 (86.0 bits), Expect = 3.1e-19, P = 3.1e-19
 Identities = 46/89 (51%), Positives = 58/89 (65%)

Query:    18 KPRAHVDSSSDSKDHLINDTPKTTKVNRLHSIRVKAAANNGN-TKRNSVVCADCDGNGAV 76
             KP +H  S++D+   L+    +  + +R  S  VKAA NN   TK NS+VCA+C+G G V
Sbjct:    24 KP-SHFFSTNDNTSSLVQKR-ELLQTSRSQSFEVKAANNNPQGTKPNSLVCANCEGEGCV 81

Query:    77 LCSQCKGSGVNAVDFFGGQFKAGDSCWLC 105
              CSQCKG GVN +D F GQFKAG  CWLC
Sbjct:    82 ACSQCKGGGVNLIDHFNGQFKAGALCWLC 110


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.128   0.398    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      126       126   0.00091  102 3  11 22  0.38    31
                                                     29  0.40    33


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  589 (63 KB)
  Total size of DFA:  141 KB (2086 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  13.25u 0.11s 13.36t   Elapsed:  00:00:00
  Total cpu time:  13.25u 0.11s 13.36t   Elapsed:  00:00:00
  Start:  Fri May 10 15:35:35 2013   End:  Fri May 10 15:35:35 2013


GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 97.13
PLN03165111 chaperone protein dnaJ-related; Provisional 96.34
PRK10767 371 chaperone protein DnaJ; Provisional 96.15
PRK14286 372 chaperone protein DnaJ; Provisional 95.62
PRK14290 365 chaperone protein DnaJ; Provisional 95.6
PRK14279 392 chaperone protein DnaJ; Provisional 95.47
PRK14300 372 chaperone protein DnaJ; Provisional 95.37
PRK14294 366 chaperone protein DnaJ; Provisional 95.34
PRK14289 386 chaperone protein DnaJ; Provisional 95.28
PRK14284 391 chaperone protein DnaJ; Provisional 95.24
PRK14278 378 chaperone protein DnaJ; Provisional 95.09
PRK14283 378 chaperone protein DnaJ; Provisional 95.04
PRK14301 373 chaperone protein DnaJ; Provisional 95.03
PRK14288 369 chaperone protein DnaJ; Provisional 94.99
PRK14282 369 chaperone protein DnaJ; Provisional 94.94
PRK14276 380 chaperone protein DnaJ; Provisional 94.9
PRK14298 377 chaperone protein DnaJ; Provisional 94.82
PRK14295 389 chaperone protein DnaJ; Provisional 94.79
PRK14285 365 chaperone protein DnaJ; Provisional 94.73
PRK14280 376 chaperone protein DnaJ; Provisional 94.7
PRK14296 372 chaperone protein DnaJ; Provisional 94.62
PRK14277 386 chaperone protein DnaJ; Provisional 94.6
PRK14287 371 chaperone protein DnaJ; Provisional 94.56
PRK14297 380 chaperone protein DnaJ; Provisional 94.55
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 94.5
PLN03165111 chaperone protein dnaJ-related; Provisional 94.33
PRK14281 397 chaperone protein DnaJ; Provisional 94.21
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 94.11
PRK14292 371 chaperone protein DnaJ; Provisional 93.92
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 93.47
PRK14291 382 chaperone protein DnaJ; Provisional 92.84
PRK14293 374 chaperone protein DnaJ; Provisional 92.84
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 92.77
PTZ00037 421 DnaJ_C chaperone protein; Provisional 91.43
PRK10767 371 chaperone protein DnaJ; Provisional 90.77
PRK14298 377 chaperone protein DnaJ; Provisional 87.74
PRK14283 378 chaperone protein DnaJ; Provisional 87.46
PRK14291 382 chaperone protein DnaJ; Provisional 87.02
PRK14286 372 chaperone protein DnaJ; Provisional 86.79
PRK14287 371 chaperone protein DnaJ; Provisional 86.46
PRK14284 391 chaperone protein DnaJ; Provisional 85.8
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 85.74
PRK14288 369 chaperone protein DnaJ; Provisional 84.61
PRK14277 386 chaperone protein DnaJ; Provisional 84.24
PRK14282 369 chaperone protein DnaJ; Provisional 83.59
PRK14285 365 chaperone protein DnaJ; Provisional 82.99
PRK14296 372 chaperone protein DnaJ; Provisional 82.93
PRK14300 372 chaperone protein DnaJ; Provisional 82.37
PRK14292 371 chaperone protein DnaJ; Provisional 82.36
PRK14293 374 chaperone protein DnaJ; Provisional 82.14
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 82.13
PRK14279 392 chaperone protein DnaJ; Provisional 82.06
PRK14289 386 chaperone protein DnaJ; Provisional 81.35
PTZ00037 421 DnaJ_C chaperone protein; Provisional 81.18
PRK14290 365 chaperone protein DnaJ; Provisional 80.83
PRK14278 378 chaperone protein DnaJ; Provisional 80.8
PRK14280 376 chaperone protein DnaJ; Provisional 80.39
PRK14297 380 chaperone protein DnaJ; Provisional 80.29
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
Probab=97.13  E-value=0.0002  Score=46.68  Aligned_cols=46  Identities=37%  Similarity=0.827  Sum_probs=35.9

Q ss_pred             eccCCCCCc------EecccccCCccCcccc--cCceeccCCeEeecccccccc
Q 033141           67 CADCDGNGA------VLCSQCKGSGVNAVDF--FGGQFKAGDSCWLCGQSSQHF  112 (126)
Q Consensus        67 C~dCdGnGa------i~C~QCkG~GvN~~D~--FnG~fKaG~~CWLCrGkk~il  112 (126)
                      |+.|+|+|+      ..|..|+|+|+-..-+  +.|.|+.-..|-.|.|+-++.
T Consensus         1 C~~C~G~G~~~~~~~~~C~~C~G~G~~~~~~~~~~~~~~~~~~C~~C~G~G~~i   54 (66)
T PF00684_consen    1 CPKCNGTGAKPGKKPKTCPQCNGSGQVTRRQQTPGGVFQMQQTCPKCGGTGKII   54 (66)
T ss_dssp             -CCCTTTSB-STTT-EE-TTSSSSSEEEEEEESSSTTEEEEEE-TTTSSSSEE-
T ss_pred             CCcCCCcccCCCCCCcCCcCCCCeeEEEEEEeCCCeEEEEEEECCCCcceeeEE
Confidence            789999998      7899999999876654  677788888999999998875



DnaJ is a member of the hsp40 family of molecular chaperones, which is also called the J-protein family, the members of which regulate the activity of hsp70s. DnaJ (hsp40) binds to DnaK (hsp70) and stimulates its ATPase activity, generating the ADP-bound state of DnaK, which interacts stably with the polypeptide substrate []. Besides stimulating the ATPase activity of DnaK through its J-domain, DnaJ also associates with unfolded polypeptide chains and prevents their aggregation []. DnaJ consists of an N-terminal conserved domain (called 'J' domain) of about 70 amino acid residues, a glycine and phenylalanine-rich domain ('G/F' domain), a central cysteine rich domain (CR-type zinc finger) containing four repeats of a CXXCXGXG motif which can coordinate two zinc atom and a C-terminal domain (CTD) []. This entry represents the central cysteine-rich (CR) domain of DnaJ proteins. This central cysteine rich domain (CR-type zinc finger) has an overall V-shaped extended beta-hairpin topology and contains four repeats of the motif CXXCXGXG where X is any amino acid. The isolated cysteine rich domain folds in zinc dependent fashion. Each set of two repeats binds one unit of zinc. Although this domain has been implicated in substrate binding, no evidence of specific interaction between the isolated DnaJ cysteine rich domain and various hydrophobic peptides has been found [].; GO: 0031072 heat shock protein binding, 0051082 unfolded protein binding; PDB: 1NLT_A 2CTT_A 1EXK_A.

>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 38.3 bits (88), Expect = 3e-04
 Identities = 19/111 (17%), Positives = 36/111 (32%), Gaps = 14/111 (12%)

Query: 14  AETLKPRAHVDSSSDSKDHLINDTPKTTK--VNRLHSI-RVKAAANNGNTKRNSVVCADC 70
            E  +P        + +D L ND     K  V+RL    +++ A       +N ++    
Sbjct: 100 TEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGV- 158

Query: 71  DGNG-AVLCSQ-CKGSGVNAVDFFGGQFKAGDSCWL-CGQSSQHFSLIQYQ 118
            G+G   +    C    V         F      WL     +   ++++  
Sbjct: 159 LGSGKTWVALDVCLSYKVQCK-MDFKIF------WLNLKNCNSPETVLEML 202


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 97.24
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.17
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 94.93
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 94.68
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 94.38
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 92.28
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 90.7
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 84.97
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=97.24  E-value=0.0001  Score=49.72  Aligned_cols=49  Identities=29%  Similarity=0.721  Sum_probs=37.1

Q ss_pred             cCceeeccCCCCCc------EecccccCCccCcccccCceeccCCeEeecccccccc
Q 033141           62 RNSVVCADCDGNGA------VLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHF  112 (126)
Q Consensus        62 p~s~~C~dCdGnGa------i~C~QCkG~GvN~~D~FnG~fKaG~~CWLCrGkk~il  112 (126)
                      +....|+.|+|.|+      ..|..|.|+|.-....  |.|.--..|..|.|.-++.
T Consensus        26 ~~~~~C~~C~G~G~~~g~~~~~C~~C~G~G~~~~~~--G~~~~~~~C~~C~G~G~~i   80 (104)
T 2ctt_A           26 NIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINT--GPFVMRSTCRRCGGRGSII   80 (104)
T ss_dssp             SCCEECSSSSSSSSCTTCCCEECSSSSSSCEEEEEE--TTEEEEEECSSSSSSSEEC
T ss_pred             eeeeECCCCcCCccCCCCCCccCCCCCCCEEEEEEe--CCEEEEEECCcCCCcceEC
Confidence            45689999999985      6899999999754443  5555556788888877665



>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 97.04
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 96.74
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 93.57
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 93.05
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Small proteins
fold: DnaJ/Hsp40 cysteine-rich domain
superfamily: DnaJ/Hsp40 cysteine-rich domain
family: DnaJ/Hsp40 cysteine-rich domain
domain: Cysteine-rich domain of the chaperone protein DnaJ
species: Escherichia coli [TaxId: 562]
Probab=97.04  E-value=7.7e-05  Score=47.41  Aligned_cols=48  Identities=29%  Similarity=0.612  Sum_probs=36.2

Q ss_pred             CceeeccCCCCCc------EecccccCCccCcccccCceeccCCeEeecccccccc
Q 033141           63 NSVVCADCDGNGA------VLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHF  112 (126)
Q Consensus        63 ~s~~C~dCdGnGa------i~C~QCkG~GvN~~D~FnG~fKaG~~CWLCrGkk~il  112 (126)
                      ....|+.|+|+|+      ..|..|.|+|.-  ....|.|.--..|-.|.|+-+|.
T Consensus        10 ~~~~C~~C~G~G~~~g~~~~~C~~C~G~G~v--~~~~g~~~~~~~C~~C~G~G~~i   63 (79)
T d1exka_          10 TLEECDVCHGSGAKPGTQPQTCPTCHGSGQV--QMRQGFFAVQQTCPHCQGRGTLI   63 (79)
T ss_dssp             CEEECGGGTTTSBCSSSCCEECTTTTTSSEE--EEEETTEEEEEECTTTTTSSEEC
T ss_pred             eeccCCCCcCcccCCCccceeCCCccceeEE--EEecccceeeEECcccCcceeEC
Confidence            4578999999985      669999999953  33444444445899999988875



>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure