Citrus Sinensis ID: 033160
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 126 | ||||||
| 224057709 | 200 | predicted protein [Populus trichocarpa] | 0.936 | 0.59 | 0.634 | 2e-41 | |
| 224072604 | 200 | predicted protein [Populus trichocarpa] | 0.936 | 0.59 | 0.630 | 7e-41 | |
| 388503852 | 212 | unknown [Medicago truncatula] | 0.888 | 0.528 | 0.642 | 3e-39 | |
| 225451445 | 201 | PREDICTED: mitochondrial import receptor | 0.944 | 0.592 | 0.668 | 1e-38 | |
| 255536895 | 205 | Mitochondrial import receptor subunit TO | 0.960 | 0.590 | 0.64 | 3e-38 | |
| 359806671 | 210 | uncharacterized protein LOC100819858 [Gl | 0.928 | 0.557 | 0.613 | 2e-37 | |
| 356566216 | 201 | PREDICTED: mitochondrial import receptor | 0.936 | 0.587 | 0.567 | 2e-36 | |
| 255547728 | 206 | Mitochondrial import receptor subunit TO | 0.968 | 0.592 | 0.563 | 2e-36 | |
| 449455850 | 201 | PREDICTED: mitochondrial import receptor | 0.912 | 0.572 | 0.582 | 6e-35 | |
| 116784454 | 205 | unknown [Picea sitchensis] | 0.936 | 0.575 | 0.537 | 1e-33 |
| >gi|224057709|ref|XP_002299299.1| predicted protein [Populus trichocarpa] gi|118481274|gb|ABK92583.1| unknown [Populus trichocarpa] gi|222846557|gb|EEE84104.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 173 bits (438), Expect = 2e-41, Method: Compositional matrix adjust.
Identities = 92/145 (63%), Positives = 101/145 (69%), Gaps = 27/145 (18%)
Query: 1 MILDAISKLEEALM-------------------------DEAKEYFNKATLYFQQAVDEE 35
MI DAISKLEEALM DEAK YF+KA YFQQAVDE+
Sbjct: 57 MINDAISKLEEALMLNPTSNAMWSIGNANTSYAFLTPDLDEAKSYFDKAANYFQQAVDED 116
Query: 36 PSNELYQKSLEVAAKAPELHMEIHKHGLGQQTMGASTGPSSTSSGAKTSKKKKSSDLKYD 95
P+NELY+KSLEV AKAPELH EIHKH QQ MG G S+ SS AK SKKK +SDLKYD
Sbjct: 117 PNNELYRKSLEVCAKAPELHTEIHKHSSSQQIMGG--GGSTASSNAKGSKKKTNSDLKYD 174
Query: 96 IFGWVILAVGIVAWVGFAKSHMPPP 120
IFGW+ILAVGIVAWVG AKS++PPP
Sbjct: 175 IFGWIILAVGIVAWVGMAKSNVPPP 199
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224072604|ref|XP_002303802.1| predicted protein [Populus trichocarpa] gi|222841234|gb|EEE78781.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388503852|gb|AFK39992.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225451445|ref|XP_002269795.1| PREDICTED: mitochondrial import receptor subunit TOM20 [Vitis vinifera] gi|296082346|emb|CBI21351.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255536895|ref|XP_002509514.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] gi|223549413|gb|EEF50901.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359806671|ref|NP_001241027.1| uncharacterized protein LOC100819858 [Glycine max] gi|255647408|gb|ACU24169.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356566216|ref|XP_003551330.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255547728|ref|XP_002514921.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] gi|223545972|gb|EEF47475.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449455850|ref|XP_004145663.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Cucumis sativus] gi|449502020|ref|XP_004161521.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|116784454|gb|ABK23348.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 126 | ||||||
| TAIR|locus:2092045 | 202 | TOM20-3 "AT3G27080" [Arabidops | 0.793 | 0.495 | 0.490 | 2.4e-24 | |
| TAIR|locus:2015904 | 210 | TOM20-2 "AT1G27390" [Arabidops | 0.801 | 0.480 | 0.443 | 1.2e-19 | |
| TAIR|locus:2167737 | 187 | TOM20-4 "AT5G40930" [Arabidops | 0.682 | 0.459 | 0.4 | 1.3e-13 |
| TAIR|locus:2092045 TOM20-3 "AT3G27080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 246 (91.7 bits), Expect = 2.4e-24, Sum P(2) = 2.4e-24
Identities = 50/102 (49%), Positives = 62/102 (60%)
Query: 16 EAKEYFNKATLYFQQAVDEEPSNELYQKSLEVAAKAPELHMEIHKHGLGQQTMXXXXXXX 75
EAK F+ AT +FQQAVDE+P N Y KSLE+ AKAP+LH E +K GLG Q M
Sbjct: 97 EAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGLGSQPMGRVEAPA 156
Query: 76 XXXXXXXXXXXXXXXDLKYDIFGWVILAVGIVAWVGFAKSHM 117
D KYD GWVILA+G+VAW+ FAK+++
Sbjct: 157 PPSSKAVKNKKSS--DAKYDAMGWVILAIGVVAWISFAKANV 196
|
|
| TAIR|locus:2015904 TOM20-2 "AT1G27390" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167737 TOM20-4 "AT5G40930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 126 | |||
| pfam06552 | 186 | pfam06552, TOM20_plant, Plant specific mitochondri | 5e-48 |
| >gnl|CDD|191555 pfam06552, TOM20_plant, Plant specific mitochondrial import receptor subunit TOM20 | Back alignment and domain information |
|---|
Score = 152 bits (384), Expect = 5e-48
Identities = 80/140 (57%), Positives = 90/140 (64%), Gaps = 29/140 (20%)
Query: 1 MILDAISKLEEAL--------------------------MDEAKEYFNKATLYFQQAVDE 34
MI DAISKLEEAL EAKE F+KAT +FQQAVDE
Sbjct: 50 MINDAISKLEEALVINPKKHDALWCIGNAYTSFAFLTPDPTEAKENFDKATQFFQQAVDE 109
Query: 35 EPSNELYQKSLEVAAKAPELHMEIHKHGLGQQTMGASTGPSSTSSGAKTSKKKKSSDLKY 94
+P N+LY+KSLE+AAKAPELH E HK GLG Q MG PSS S KT K KKSSD KY
Sbjct: 110 QPDNDLYRKSLEMAAKAPELHTEFHKQGLGSQIMGG-EAPSSPSQ--KTVKNKKSSDFKY 166
Query: 95 DIFGWVILAVGIVAWVGFAK 114
D+ GWVILA+G+VAW+ FAK
Sbjct: 167 DVMGWVILAIGVVAWISFAK 186
|
This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins. Most mitochondrial proteins are encoded by the nuclear genome, and are synthesised in the cytosol. TOM20 is a general import receptor that binds to mitochondrial pre-sequences in the early step of protein import into the mitochondria. Length = 186 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 100.0 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.49 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.37 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.19 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.94 | |
| cd02678 | 75 | MIT_VPS4 MIT: domain contained within Microtubule | 96.85 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 96.76 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 96.75 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.73 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 96.69 | |
| smart00745 | 77 | MIT Microtubule Interacting and Trafficking molecu | 96.65 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.48 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.42 | |
| cd02656 | 75 | MIT MIT: domain contained within Microtubule Inter | 96.32 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 96.18 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.1 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 96.1 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 96.04 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 96.01 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 95.94 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 95.92 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 95.88 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.75 | |
| cd02684 | 75 | MIT_2 MIT: domain contained within Microtubule Int | 95.64 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 95.49 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 95.49 | |
| cd02683 | 77 | MIT_1 MIT: domain contained within Microtubule Int | 95.44 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 95.41 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 95.33 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 95.02 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 94.96 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 94.95 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 94.76 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 94.61 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 94.38 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 94.3 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 94.24 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 94.18 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 93.93 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 93.88 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 93.68 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 93.66 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 93.49 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 93.34 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 93.33 | |
| cd02680 | 75 | MIT_calpain7_2 MIT: domain contained within Microt | 93.29 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 93.22 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 93.15 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 93.01 | |
| cd02677 | 75 | MIT_SNX15 MIT: domain contained within Microtubule | 92.93 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 92.66 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 92.5 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 92.42 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 92.36 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 92.26 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 92.09 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 91.9 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 91.62 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 91.56 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 91.55 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 91.52 | |
| PTZ00441 | 576 | sporozoite surface protein 2 (SSP2); Provisional | 91.29 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 91.17 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 91.13 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 91.03 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 90.9 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 90.83 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 90.7 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 90.53 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 90.49 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 90.37 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 89.94 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 89.65 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 89.36 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 89.28 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 88.9 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 88.89 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 88.69 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 88.24 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 87.45 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 87.4 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 87.27 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 87.26 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 87.25 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 87.03 | |
| PF02609 | 53 | Exonuc_VII_S: Exonuclease VII small subunit; Inter | 86.87 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 86.63 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 86.4 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 86.02 | |
| cd02679 | 79 | MIT_spastin MIT: domain contained within Microtubu | 85.99 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 85.89 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 85.16 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 84.84 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 84.37 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 83.45 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 83.41 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 83.06 | |
| TIGR01280 | 67 | xseB exodeoxyribonuclease VII, small subunit. This | 82.88 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 82.81 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 82.45 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 82.41 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 82.29 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 81.89 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 81.49 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 80.94 | |
| PRK00977 | 80 | exodeoxyribonuclease VII small subunit; Provisiona | 80.83 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 80.42 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 80.11 |
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.7e-56 Score=350.67 Aligned_cols=111 Identities=80% Similarity=1.175 Sum_probs=60.2
Q ss_pred ChHHHHHHHHHHHH--------------------------HHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHhhcCchh
Q 033160 1 MILDAISKLEEALM--------------------------DEAKEYFNKATLYFQQAVDEEPSNELYQKSLEVAAKAPEL 54 (126)
Q Consensus 1 Mi~dAisKleeAL~--------------------------~~A~~~f~kA~~~FqkAvd~dP~Ne~YkKsLe~a~KAPel 54 (126)
||+|||+||||||. .+|+++|++|.+|||||+++||+|++|||||||++|||||
T Consensus 50 miedAisK~eeAL~I~P~~hdAlw~lGnA~ts~A~l~~d~~~A~~~F~kA~~~FqkAv~~~P~ne~Y~ksLe~~~kap~l 129 (186)
T PF06552_consen 50 MIEDAISKFEEALKINPNKHDALWCLGNAYTSLAFLTPDTAEAEEYFEKATEYFQKAVDEDPNNELYRKSLEMAAKAPEL 129 (186)
T ss_dssp HHHHHHHHHHHHHHH-TT-HHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHH-TT-HHHHHHHHHHHTHHHH
T ss_pred HHHHHHHHHHHHHhcCCchHHHHHHHHHHHHHHHhhcCChHHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHhhHHH
Confidence 79999999999999 7999999999999999999999999999999999999999
Q ss_pred HHHHHHhcccccccCCCCCCCCCCCCccccccccCCCcchhhhhHHHHHHHHHHHHHhhh
Q 033160 55 HMEIHKHGLGQQTMGASTGPSSTSSGAKTSKKKKSSDLKYDIFGWVILAVGIVAWVGFAK 114 (126)
Q Consensus 55 H~ei~kq~~~qq~~~~~~~g~~~~s~~k~~kkkk~sDf~YDv~GWviLa~givaWvg~Ak 114 (126)
|+|||||+++||.+|+ +++++++.+++||||+|||||||+|||||++||||||||||
T Consensus 130 h~e~~~~~~~~q~~~~---~~~~~~~~~~~k~kk~sd~~ydv~gwvil~~givawv~~ak 186 (186)
T PF06552_consen 130 HMEIHKQGLGQQAMGG---ASSSSSSAKSSKKKKSSDFKYDVFGWVILAVGIVAWVGMAK 186 (186)
T ss_dssp HHHHHHSSS---------------------------------------------------
T ss_pred HHHHHHHHhhhhhccC---CCCCCCCccccccccccchhhhhcchHHHHHHHHHHHhhcC
Confidence 9999999999998655 46666778999999999999999999999999999999997
|
Most mitochondrial proteins are encoded by the nuclear genome, and are synthesised in the cytosol. TOM20 is a general import receptor that binds to mitochondrial pre-sequences in the early step of protein import into the mitochondria [].; GO: 0045040 protein import into mitochondrial outer membrane, 0005742 mitochondrial outer membrane translocase complex; PDB: 1ZU2_A. |
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >smart00745 MIT Microtubule Interacting and Trafficking molecule domain | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PTZ00441 sporozoite surface protein 2 (SSP2); Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF02609 Exonuc_VII_S: Exonuclease VII small subunit; InterPro: IPR003761 Exonuclease VII is composed of two non-identical subunits; one large subunit and 4 small ones [] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR01280 xseB exodeoxyribonuclease VII, small subunit | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK00977 exodeoxyribonuclease VII small subunit; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 126 | ||||
| 1zu2_A | 158 | Solution Nmr Structure Of The Plant Tom20 Mitochond | 4e-12 |
| >pdb|1ZU2|A Chain A, Solution Nmr Structure Of The Plant Tom20 Mitochondrial Import Receptor From Arabidopsis Thaliana Length = 158 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 126 | |||
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 4e-20 |
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 | Back alignment and structure |
|---|
Score = 79.4 bits (195), Expect = 4e-20
Identities = 40/92 (43%), Positives = 48/92 (52%), Gaps = 26/92 (28%)
Query: 1 MILDAISKLEEAL--------------------------MDEAKEYFNKATLYFQQAVDE 34
MI +AI+K EEAL EAK F+ AT +FQQAVDE
Sbjct: 61 MIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDE 120
Query: 35 EPSNELYQKSLEVAAKAPELHMEIHKHGLGQQ 66
+P N Y KSLE+ AKAP+LH E +K GLG
Sbjct: 121 QPDNTHYLKSLEMTAKAPQLHAEAYKQGLGGS 152
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.72 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.81 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.8 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.71 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.66 | |
| 2cpt_A | 117 | SKD1 protein, vacuolar sorting protein 4B; MIT, he | 97.6 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.47 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 97.41 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 97.4 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 97.39 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.33 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 97.31 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.31 | |
| 1wfd_A | 93 | Hypothetical protein 1500032H18; MIT domain, struc | 97.21 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.19 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.16 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 97.16 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.09 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.08 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.03 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.03 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.01 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.98 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.94 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.92 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.91 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.91 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.89 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.87 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.84 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 96.83 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 96.81 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.73 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.72 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.7 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 96.69 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.69 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.68 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.68 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.67 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.67 | |
| 2v6y_A | 83 | AAA family ATPase, P60 katanin; MIT, VPS4, archaea | 96.66 | |
| 2v6x_A | 85 | Vacuolar protein sorting-associated protein 4; pro | 96.65 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 96.64 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 96.59 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 96.59 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.49 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.46 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 96.44 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 96.42 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 96.42 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.37 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 96.34 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.32 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.31 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 96.3 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.29 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.27 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.27 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 96.24 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.22 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 96.19 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.19 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 96.07 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 96.04 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 96.0 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 95.96 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 95.91 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 95.89 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 95.88 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 95.88 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 95.86 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.8 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 95.78 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 95.75 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.75 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 95.7 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 95.7 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.69 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 95.68 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 95.65 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 95.65 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.64 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 95.63 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 95.58 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 95.58 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 95.56 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 95.55 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 95.55 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 95.52 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 95.49 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.45 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 95.43 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 95.42 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 95.4 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 95.38 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 95.38 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 95.35 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 95.3 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 95.3 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 95.27 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 95.24 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.19 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 95.11 | |
| 4a5x_A | 86 | MITD1, MIT domain-containing protein 1; protein tr | 95.02 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 95.01 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 94.96 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 94.96 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 94.94 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 94.93 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 94.91 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 94.9 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 94.82 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 94.8 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.74 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 94.72 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 94.56 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 94.46 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 94.45 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 94.44 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 94.43 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.33 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.25 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 94.2 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 94.15 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 94.14 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 94.13 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 93.99 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 93.99 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 93.97 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 93.95 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 93.87 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 93.77 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 93.62 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.49 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 93.46 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 93.44 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 93.41 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 93.39 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 93.33 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 93.3 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 93.21 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.06 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 92.89 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 92.85 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 92.47 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 92.41 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 92.15 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 92.0 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 91.97 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 91.86 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 91.15 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 91.1 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 90.96 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 90.13 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 89.48 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 89.3 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 89.03 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 88.99 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 88.89 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 88.51 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 88.49 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 88.45 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 88.43 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 88.05 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 88.05 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 86.76 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 86.49 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 86.46 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 86.39 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 86.09 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 85.56 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 85.41 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 85.1 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 85.07 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 84.95 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 84.92 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 84.86 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 83.96 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 83.73 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 83.57 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 83.32 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 82.77 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 82.07 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 81.22 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 81.13 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 81.06 | |
| 2dl1_A | 116 | Spartin; SPG20, MIT, structural genomics, NPPSFA, | 80.07 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 80.02 |
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
Probab=99.72 E-value=9.2e-18 Score=126.46 Aligned_cols=63 Identities=62% Similarity=0.869 Sum_probs=58.4
Q ss_pred ChHHHHHHHHHHHH--------------------------HHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHhhcCchh
Q 033160 1 MILDAISKLEEALM--------------------------DEAKEYFNKATLYFQQAVDEEPSNELYQKSLEVAAKAPEL 54 (126)
Q Consensus 1 Mi~dAisKleeAL~--------------------------~~A~~~f~kA~~~FqkAvd~dP~Ne~YkKsLe~a~KAPel 54 (126)
|+++||+.||+||. .+|.+.|++|.+||+|||++||+|+.|+++|+++.|||||
T Consensus 61 ~~~eAi~~le~AL~ldP~~~~A~~~LG~ay~~lg~l~P~~~~a~g~~~eA~~~~~kAl~l~P~~~~y~~al~~~~ka~el 140 (158)
T 1zu2_A 61 MIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQL 140 (158)
T ss_dssp HHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHTHHHH
T ss_pred HHHHHHHHHHHHHHhCcCcHHHHHHHHHHHHHhcccCcchhhhhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHhCHhc
Confidence 46899999999999 1356799999999999999999999999999999999999
Q ss_pred HHHHHHhcc
Q 033160 55 HMEIHKHGL 63 (126)
Q Consensus 55 H~ei~kq~~ 63 (126)
|.+||+|++
T Consensus 141 ~~~~~~~~~ 149 (158)
T 1zu2_A 141 HAEAYKQGL 149 (158)
T ss_dssp HHHHHHSSS
T ss_pred cCccccccc
Confidence 999999976
|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* | Back alignment and structure |
|---|
| >2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2dl1_A Spartin; SPG20, MIT, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 126 | ||||
| d1zu2a1 | 145 | a.118.8.1 (A:1-145) Mitochondrial import receptor | 6e-09 |
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Mitochondrial import receptor subunit tom20-3 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 48.7 bits (114), Expect = 6e-09
Identities = 31/51 (60%), Positives = 37/51 (72%)
Query: 14 MDEAKEYFNKATLYFQQAVDEEPSNELYQKSLEVAAKAPELHMEIHKHGLG 64
EAK F+ AT +FQQAVDE+P N Y KSLE+ AKAP+LH E +K GLG
Sbjct: 95 ETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGLG 145
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.63 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.84 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.69 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.61 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.55 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.54 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.44 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.43 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.35 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.23 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 97.22 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.21 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.14 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.13 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.1 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.97 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 96.92 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.91 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.84 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.79 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.78 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 96.76 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.63 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.62 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.62 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.58 | |
| d1wr0a1 | 77 | Vacuolar sorting protein 4b (VPS4B, SKD1 protein) | 96.52 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 96.51 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.51 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.08 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 95.7 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 95.52 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 95.48 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 95.25 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 94.97 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 94.76 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 94.22 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 94.17 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 94.15 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 93.93 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 93.26 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 92.82 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 92.64 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 91.84 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 91.77 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 90.0 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 86.97 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 86.04 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 84.3 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 83.13 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 80.78 |
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Mitochondrial import receptor subunit tom20-3 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.63 E-value=2.7e-16 Score=109.61 Aligned_cols=63 Identities=62% Similarity=0.881 Sum_probs=58.6
Q ss_pred hHHHHHHHHHHHH--------------------------HHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHhhcCchhH
Q 033160 2 ILDAISKLEEALM--------------------------DEAKEYFNKATLYFQQAVDEEPSNELYQKSLEVAAKAPELH 55 (126)
Q Consensus 2 i~dAisKleeAL~--------------------------~~A~~~f~kA~~~FqkAvd~dP~Ne~YkKsLe~a~KAPelH 55 (126)
+++||..++.||. .++.++|++|.+||++|+++||+|+.|+++|+++.|||++|
T Consensus 57 ~~~Ai~~~~kAl~l~P~~~~a~~~lG~~y~~~g~~~~~~~~~~~~~~~A~~~~~kal~l~P~~~~~~~~L~~~~ka~~~~ 136 (145)
T d1zu2a1 57 IQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLH 136 (145)
T ss_dssp HHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHTHHHHH
T ss_pred HHHHHHHHHHHHHhcchhhHHHhhHHHHHHHcccchhhHHHHHHhHHHhhhhhhcccccCCCHHHHHHHHHHHHHHHHHH
Confidence 5789999999998 36778999999999999999999999999999999999999
Q ss_pred HHHHHhccc
Q 033160 56 MEIHKHGLG 64 (126)
Q Consensus 56 ~ei~kq~~~ 64 (126)
.|++||++|
T Consensus 137 ~e~~k~~~~ 145 (145)
T d1zu2a1 137 AEAYKQGLG 145 (145)
T ss_dssp HHHHHSSSC
T ss_pred HHHHHHhcC
Confidence 999999975
|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|