Citrus Sinensis ID: 033665

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MKILSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKETFPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHSELLDAIRI
cHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHcccccEEccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcc
cccccHHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHccc
MKILSVLKYCVIWRAVEralgpgfcrdkcdvkfvgtplthqrflrrnrgtygpaiqagketfpghstpipqlyccgdstfpgigvpavAASGAIVANSLVSVSQHSELLDAIRI
MKILSVLKYCVIWRAVERALGPGFCRDKCDVKFVgtplthqrflrrnrgtYGPAIQAGKETFPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSLVSvsqhselldairi
MKILSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKETFPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHSELLDAIRI
**ILSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKETFPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSLVSV************
***LSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKETFPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHSELLDAIRI
MKILSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKETFPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHSELLDAIRI
*KILSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKETFPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHSELLDAIRI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKILSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKETFPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHSELLDAIRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q52QW3587 Prolycopene isomerase 1, N/A no 0.833 0.161 0.441 1e-13
Q2VEX9615 Prolycopene isomerase, ch N/A no 0.833 0.154 0.450 3e-13
Q52QW2587 Prolycopene isomerase 2, N/A no 0.833 0.161 0.441 3e-13
Q9M9Y8595 Prolycopene isomerase, ch no no 0.780 0.149 0.451 3e-12
Q8S4R4615 Prolycopene isomerase, ch N/A no 0.833 0.154 0.421 5e-12
>sp|Q52QW3|CRTS1_ONCHC Prolycopene isomerase 1, chloroplastic OS=Oncidium hybrid cultivar GN=CRTISO1 PE=2 SV=1 Back     alignment and function desciption
 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 62/102 (60%), Gaps = 7/102 (6%)

Query: 16  VERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGP---AIQAGKETFPGHSTPIPQL 72
           +E+ L PG  +D   +K VGTP TH+RFL R+ GTYGP    +  G    P ++T I  L
Sbjct: 474 LEKKLFPGL-KDSVVLKEVGTPKTHRRFLARDSGTYGPMPRKVPKGLLGMPFNTTAINGL 532

Query: 73  YCCGDSTFPGIGVPAVAASGAIVANSLVS---VSQHSELLDA 111
           YC GDS FPG GV AVA SG + A+ + +   + + + +LDA
Sbjct: 533 YCVGDSCFPGQGVIAVAFSGVMCAHRVAADLGIEKKAPVLDA 574
Carotene cis-trans-isomerase that converts 7,9,9'-tri-cis-neurosporene to 9'-cis-neurosporene and 7,9,9',7'-tetra-cis-lycopene (also known as prolycopene) into all-trans-lycopene. Isomerization requires redox-active components, suggesting that isomerization is achieved by a reversible redox reaction acting at specific double bonds. Isomerizes adjacent cis-double bonds at C7 and C9 pairwise into the trans-configuration, but is incapable of isomerizing single cis-double bonds at C9 and C9'.
Oncidium hybrid cultivar (taxid: 141207)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 3
>sp|Q2VEX9|CRTSO_DAUCA Prolycopene isomerase, chloroplastic OS=Daucus carota GN=CRTISO PE=2 SV=1 Back     alignment and function description
>sp|Q52QW2|CRTS2_ONCHC Prolycopene isomerase 2, chloroplastic OS=Oncidium hybrid cultivar GN=CRTISO2 PE=2 SV=1 Back     alignment and function description
>sp|Q9M9Y8|CRTSO_ARATH Prolycopene isomerase, chloroplastic OS=Arabidopsis thaliana GN=CRTISO PE=2 SV=2 Back     alignment and function description
>sp|Q8S4R4|CRTSO_SOLLC Prolycopene isomerase, chloroplastic OS=Solanum lycopersicum GN=CRTISO PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
224119928 579 predicted protein [Populus trichocarpa] 0.991 0.195 0.840 4e-49
147777848 586 hypothetical protein VITISV_023401 [Viti 0.912 0.177 0.884 1e-48
359486245 551 PREDICTED: prolycopene isomerase, chloro 0.912 0.188 0.875 6e-48
297739513 570 unnamed protein product [Vitis vinifera] 0.912 0.182 0.875 6e-48
255570972 585 All-trans-retinol 13,14-reductase precur 0.991 0.193 0.814 7e-48
356564426 530 PREDICTED: LOW QUALITY PROTEIN: prolycop 0.912 0.196 0.846 2e-47
449511591 582 PREDICTED: prolycopene isomerase, chloro 0.991 0.194 0.805 8e-47
449431858 582 PREDICTED: prolycopene isomerase, chloro 0.991 0.194 0.805 8e-47
297848272 578 hypothetical protein ARALYDRAFT_314966 [ 0.973 0.192 0.819 3e-46
356522129 558 PREDICTED: prolycopene isomerase, chloro 0.912 0.186 0.836 3e-46
>gi|224119928|ref|XP_002331097.1| predicted protein [Populus trichocarpa] gi|222872825|gb|EEF09956.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 102/113 (90%)

Query: 2   KILSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKET 61
           K L   +  V+WRAVERALGPGF R+KC+VK VGTPLTH+RFLRRNRGTYGPAI+AGK T
Sbjct: 467 KQLKAERSEVMWRAVERALGPGFSREKCEVKLVGTPLTHKRFLRRNRGTYGPAIEAGKNT 526

Query: 62  FPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHSELLDAIRI 114
           FPGHSTPI QLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHS+LLDAI I
Sbjct: 527 FPGHSTPISQLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHSQLLDAIGI 579

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147777848|emb|CAN60294.1| hypothetical protein VITISV_023401 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486245|ref|XP_002264237.2| PREDICTED: prolycopene isomerase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739513|emb|CBI29695.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255570972|ref|XP_002526437.1| All-trans-retinol 13,14-reductase precursor, putative [Ricinus communis] gi|223534217|gb|EEF35932.1| All-trans-retinol 13,14-reductase precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356564426|ref|XP_003550455.1| PREDICTED: LOW QUALITY PROTEIN: prolycopene isomerase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449511591|ref|XP_004163999.1| PREDICTED: prolycopene isomerase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449431858|ref|XP_004133717.1| PREDICTED: prolycopene isomerase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297848272|ref|XP_002892017.1| hypothetical protein ARALYDRAFT_314966 [Arabidopsis lyrata subsp. lyrata] gi|297337859|gb|EFH68276.1| hypothetical protein ARALYDRAFT_314966 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356522129|ref|XP_003529702.1| PREDICTED: prolycopene isomerase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
TAIR|locus:2009395574 AT1G57770 [Arabidopsis thalian 0.894 0.177 0.872 1.2e-44
UNIPROTKB|Q10AT7597 Os03g0841900 "Os03g0841900 pro 0.912 0.174 0.826 5e-44
UNIPROTKB|A8J3K3558 CHLREDRAFT_130438 "Predicted p 0.877 0.179 0.627 1.6e-28
UNIPROTKB|A8J7T2566 CHLREDRAFT_176572 "Predicted p 0.754 0.151 0.595 3.8e-22
UNIPROTKB|Q0IS25602 Os11g0572700 "Os11g0572700 pro 0.868 0.164 0.452 1.6e-14
TAIR|locus:2033055595 CRTISO "carotenoid isomerase" 0.859 0.164 0.428 6.5e-13
UNIPROTKB|A8J9E9568 CHLREDRAFT_196597 "Carotenoid 0.640 0.128 0.493 4.1e-11
TAIR|locus:2009395 AT1G57770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 470 (170.5 bits), Expect = 1.2e-44, P = 1.2e-44
 Identities = 89/102 (87%), Positives = 95/102 (93%)

Query:    11 VIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKETFPGHSTPIP 70
             V+WRAVERALG GF R+KC+V  VGTPLTHQRFLRRNRGTYGPAI+AGK TFPGHSTPIP
Sbjct:   471 VMWRAVERALGLGFKREKCEVSLVGTPLTHQRFLRRNRGTYGPAIEAGKGTFPGHSTPIP 530

Query:    71 QLYCCGDSTFPGIGVPAVAASGAIVANSLVSVSQHSELLDAI 112
             QL CCGDSTFPGIGVPAVAASGAIVANSLV VS+HS+LLDAI
Sbjct:   531 QLLCCGDSTFPGIGVPAVAASGAIVANSLVPVSKHSQLLDAI 572
GO:0005739 "mitochondrion" evidence=ISM
GO:0016117 "carotenoid biosynthetic process" evidence=IBA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0046608 "carotenoid isomerase activity" evidence=IBA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
UNIPROTKB|Q10AT7 Os03g0841900 "Os03g0841900 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8J3K3 CHLREDRAFT_130438 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|A8J7T2 CHLREDRAFT_176572 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IS25 Os11g0572700 "Os11g0572700 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2033055 CRTISO "carotenoid isomerase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A8J9E9 CHLREDRAFT_196597 "Carotenoid isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
TIGR02730493 TIGR02730, carot_isom, carotene isomerase 3e-18
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 5e-16
TIGR02733492 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD 4e-05
>gnl|CDD|131777 TIGR02730, carot_isom, carotene isomerase Back     alignment and domain information 
 Score = 78.3 bits (193), Expect = 3e-18
 Identities = 43/98 (43%), Positives = 52/98 (53%), Gaps = 8/98 (8%)

Query: 8   KYCVIWRAVER--ALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGTYGPAIQAGKE----T 61
           K     R ++R   + PG      D K VGTP TH+RFL R+ GTYGP I          
Sbjct: 393 KEADAERIIDRLEKIFPGLDS-AIDYKEVGTPRTHRRFLGRDSGTYGP-IPRRTLPGLLP 450

Query: 62  FPGHSTPIPQLYCCGDSTFPGIGVPAVAASGAIVANSL 99
            P + T IP LYC GDS FPG G+ AVA SG   A+ +
Sbjct: 451 MPFNRTAIPGLYCVGDSCFPGQGLNAVAFSGFACAHRV 488

Members of this family, including sll0033 (crtH) of Synechocystis sp. PCC 6803, catalyze a cis-trans isomerization of carotenes to the all-trans lycopene, a reaction that can also occur non-enzymatically in light through photoisomerization [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]. Length = 493
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.94
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.93
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.92
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 99.86
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.76
PLN02612567 phytoene desaturase 98.82
PLN02487569 zeta-carotene desaturase 98.42
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 98.41
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.34
PRK07233434 hypothetical protein; Provisional 98.23
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.16
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 98.16
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.46
PLN02676487 polyamine oxidase 96.73
PRK12416463 protoporphyrinogen oxidase; Provisional 96.58
PLN02268435 probable polyamine oxidase 96.54
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.25
COG3349485 Uncharacterized conserved protein [Function unknow 96.11
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 95.46
PLN02576496 protoporphyrinogen oxidase 95.03
PLN02568539 polyamine oxidase 93.96
PLN02976 1713 amine oxidase 93.92
PLN02328 808 lysine-specific histone demethylase 1 homolog 93.36
PLN02529 738 lysine-specific histone demethylase 1 93.11
PRK12842574 putative succinate dehydrogenase; Reviewed 92.83
PRK11259376 solA N-methyltryptophan oxidase; Provisional 92.7
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 91.55
PLN03000 881 amine oxidase 91.15
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 90.1
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 89.9
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 89.76
PRK12839572 hypothetical protein; Provisional 89.51
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 88.79
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 88.18
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 88.04
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 88.02
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 87.95
PRK07121492 hypothetical protein; Validated 87.77
PRK08274466 tricarballylate dehydrogenase; Validated 87.34
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 86.92
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 86.61
PRK12831464 putative oxidoreductase; Provisional 86.55
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 86.53
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 86.48
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 86.21
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 86.12
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 85.92
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 85.6
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 85.52
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 85.04
PRK06116 450 glutathione reductase; Validated 85.03
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 85.02
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 84.97
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 84.97
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 84.79
PLN02507 499 glutathione reductase 84.71
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 84.69
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 84.0
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 83.99
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 83.85
PRK13984604 putative oxidoreductase; Provisional 83.83
PRK08275 554 putative oxidoreductase; Provisional 83.61
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 83.59
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 83.46
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 83.29
PRK06175433 L-aspartate oxidase; Provisional 83.02
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 83.01
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 82.61
PRK09077 536 L-aspartate oxidase; Provisional 82.56
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 82.54
PRK07395 553 L-aspartate oxidase; Provisional 82.46
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 82.31
PRK10157428 putative oxidoreductase FixC; Provisional 82.28
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 82.13
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 82.06
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 82.01
PRK13748 561 putative mercuric reductase; Provisional 81.59
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 81.51
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 81.15
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 81.05
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 80.85
PRK14694 468 putative mercuric reductase; Provisional 80.82
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 80.64
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 80.6
PLN02546 558 glutathione reductase 80.59
PRK10262321 thioredoxin reductase; Provisional 80.55
PRK07845 466 flavoprotein disulfide reductase; Reviewed 80.55
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 80.52
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 80.47
PRK14727 479 putative mercuric reductase; Provisional 80.14
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information 
Probab=99.94  E-value=1.9e-26  Score=182.84  Aligned_cols=99  Identities=22%  Similarity=0.302  Sum_probs=92.0

Q ss_pred             hhHHHHHHHHHHHHHHHHhCCCCCCCceeEEEeCCHHHHHHHhCCCCCC-CCCCCCCCCcC-C-CCCCCCCCcEEEcCCC
Q 033665            2 KILSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGT-YGPAIQAGKET-F-PGHSTPIPQLYCCGDS   78 (114)
Q Consensus         2 ~~~K~~~~~~il~~l~~~~gP~i~~~~I~~~~~~TP~t~~~~~~~~~G~-~G~~~~~~q~~-~-p~~~t~v~nLyl~G~~   78 (114)
                      ++.|++++++||+.+++++ |+| +++|++.++.||.||++|+++++|+ ||..+++.|.. + ++.+|+++|||+||+|
T Consensus       390 ~~~k~~~~~~il~~le~~~-p~l-~~~i~~~~v~TP~t~~~~~~~~~G~~~G~~~~~~q~~~~~~~~~t~i~gLyl~G~~  467 (492)
T TIGR02733       390 TAKKKQYTQTIIERLGHYF-DLL-EENWVHVELATPRTFERWTGRPQGIVGGLGQRPSTFGPFGLSSRTPVKGLWLCGDS  467 (492)
T ss_pred             HHHHHHHHHHHHHHHHHHC-CCc-cccEEEEEccCCchHHHHhCCCCcEECCCCcCccccCCcCCCCCCCCCCeEEecCc
Confidence            3678999999999999998 999 9999999999999999999999999 99999888864 3 5568999999999999


Q ss_pred             CCCCCChhHHHHHHHHHHHHHhcc
Q 033665           79 TFPGIGVPAVAASGAIVANSLVSV  102 (114)
Q Consensus        79 ~~PG~Gv~ga~~sg~~~a~~i~~~  102 (114)
                      +|||+|++||++||+++|+.|+++
T Consensus       468 ~~pG~Gv~g~~~sg~~~a~~i~~~  491 (492)
T TIGR02733       468 IHPGEGTAGVSYSALMVVRQILAS  491 (492)
T ss_pred             cCCCCcHHHHHHHHHHHHHHHhhc
Confidence            999999999999999999999875

Members of this family are slr1293, a carotenoid biosynthesis protein which was shown to be the C-3',4' desaturase (CrtD) of myxoxanthophyll biosynthesis in Synechocystis sp. strain PCC 6803, and close homologs (presumed to be functionally equivalent) from other cyanobacteria, where myxoxanthophyll biosynthesis is either known or expected. This enzyme can act on neurosporene and so presumably catalyzes the first step that is committed to myxoxanthophyll.
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 1e-21
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 4e-13
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
 Score = 87.0 bits (216), Expect = 1e-21
 Identities = 18/69 (26%), Positives = 27/69 (39%), Gaps = 2/69 (2%)

Query: 34  VGTPLTHQRFLRRNRGTYGPAIQAGKETFPGHSTPIPQLYCCGDSTFP--GIGVPAVAAS 91
           +     ++  L ++     P  +A   T PG+ TP   LY  GD      GI V  VA  
Sbjct: 356 IFPGKRYEVLLIQSYHDEWPVNRAASGTDPGNETPFSGLYVVGDGAKGKGGIEVEGVALG 415

Query: 92  GAIVANSLV 100
              V   ++
Sbjct: 416 VMSVMEKVL 424
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.91
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.82
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 98.58
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.4
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.35
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.29
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.15
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.77
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.51
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.22
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.0
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 96.73
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 96.62
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 96.56
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 96.51
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 95.83
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 95.56
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.21
4gut_A776 Lysine-specific histone demethylase 1B; histone de 95.14
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 94.84
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 94.72
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 94.7
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 92.14
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 92.03
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 91.8
4fk1_A304 Putative thioredoxin reductase; structural genomic 90.34
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 90.27
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 90.08
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 89.9
2cul_A232 Glucose-inhibited division protein A-related PROT 89.82
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 89.77
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 89.73
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 89.23
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 89.22
3r9u_A315 Thioredoxin reductase; structural genomics, center 89.07
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 88.35
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 88.19
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 87.58
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 87.3
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 86.81
2ywl_A180 Thioredoxin reductase related protein; uncharacter 85.88
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 85.57
4dna_A 463 Probable glutathione reductase; structural genomic 85.36
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 85.32
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 85.13
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 84.97
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 84.52
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 84.42
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 84.08
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 83.7
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 83.34
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 83.33
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 83.3
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 82.85
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 82.77
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 82.66
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 82.29
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 82.11
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 82.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 81.98
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 81.58
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 81.56
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 81.41
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 81.26
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 81.16
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 80.87
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 80.78
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 80.64
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 80.63
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 80.32
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 80.19
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 80.12
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
Probab=99.91  E-value=5.5e-26  Score=177.09  Aligned_cols=100  Identities=22%  Similarity=0.345  Sum_probs=63.1

Q ss_pred             hhHHHHHHHHHHHHHHHHhCCCCCCCceeEEEeCCHHHHHHHhCCCCCC-CCCCCCCCCcCC--CCC-CCCCCcEEEcCC
Q 033665            2 KILSVLKYCVIWRAVERALGPGFCRDKCDVKFVGTPLTHQRFLRRNRGT-YGPAIQAGKETF--PGH-STPIPQLYCCGD   77 (114)
Q Consensus         2 ~~~K~~~~~~il~~l~~~~gP~i~~~~I~~~~~~TP~t~~~~~~~~~G~-~G~~~~~~q~~~--p~~-~t~v~nLyl~G~   77 (114)
                      ++.|+++++++++.+++++.|+| +++|+++++.||.||++|++.++|+ ||..+++.|..+  |.+ .|||+|||+||+
T Consensus       387 ~~~~~~~~~~vl~~l~~~~~P~~-~~~i~~~~~~tP~~~~~~~~~~~G~~~g~~~~~~q~~~~RP~~~~t~i~gLyl~G~  465 (501)
T 4dgk_A          387 TVEGPKLRDRIFAYLEQHYMPGL-RSQLVTHRMFTPFDFRDQLNAYHGSAFSVEPVLTQSAWFRPHNRDKTITNLYLVGA  465 (501)
T ss_dssp             HHHHHHHHHHHHHHHHHHTCTTH-HHHEEEEEEECTTTTC------------------------------CCTTEEECCC
T ss_pred             HHHHHHHHHHHHHHHHHhhCCCh-HHceEEEEECCHHHHHHHcCCCCccccChhcchhhccccCCCCCCCCCCCEEEECC
Confidence            35789999999999997544999 9999999999999999999999999 999999888754  654 588999999999


Q ss_pred             CCCCCCChhHHHHHHHHHHHHHhcc
Q 033665           78 STFPGIGVPAVAASGAIVANSLVSV  102 (114)
Q Consensus        78 ~~~PG~Gv~ga~~sg~~~a~~i~~~  102 (114)
                      |+|||+||+||++||++||+.|+++
T Consensus       466 ~t~pG~Gv~ga~~SG~~aA~~il~d  490 (501)
T 4dgk_A          466 GTHPGAGIPGVIGSAKATAGLMLED  490 (501)
T ss_dssp             H------HHHHHHHHHHHHHHHHHH
T ss_pred             CCCCcccHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999975
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.32
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.96
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 96.82
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 94.92
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.67
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.48
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 94.46
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.04
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.99
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 93.36
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 92.47
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 92.46
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.46
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.32
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 90.55
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 88.1
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 88.06
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 86.93
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 82.97
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 80.34
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.32  E-value=1.5e-07  Score=64.64  Aligned_cols=40  Identities=30%  Similarity=0.516  Sum_probs=31.5

Q ss_pred             CCCCCCCCcEEEcCCCCCCC--CChhHHHHHHHHHHHHHhcc
Q 033665           63 PGHSTPIPQLYCCGDSTFPG--IGVPAVAASGAIVANSLVSV  102 (114)
Q Consensus        63 p~~~t~v~nLyl~G~~~~PG--~Gv~ga~~sg~~~a~~i~~~  102 (114)
                      |..++|++|||+||++++|+  +++.||+.||+.||++|++.
T Consensus       405 ~~~~~~~~~l~fAGe~t~~~~~g~~~GA~~SG~~aA~~Il~~  446 (449)
T d2dw4a2         405 PGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQ  446 (449)
T ss_dssp             -----CCCCEEECSGGGCTTSCSSHHHHHHHHHHHHHHHHHH
T ss_pred             hhhcCCCCCEEEEcCCcCCCCceehHHHHHHHHHHHHHHHHH
Confidence            67788999999999998876  46899999999999999864
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure