Citrus Sinensis ID: 033696

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
Protein Sequence
MASSLSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIAFKVPRPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGKNTGSA
Secondary Structure (PSIPRED)
ccccccccEEEcEEEEEEcccccccEEEccccccccccccccccEEEccccccccccccccccccccEEEEcccccccccccccccccccccccccHHEEEcccccccccccc
Secondary Structure Prediction (SSPRO)
ccHHHHHHHHHHHHHccccccccHHHHHcccccccccHHHHHccccccccccccHHHcccccccccccEEcccccccccccccccHccccccccccEEEEEEEcccccccccc
Coil and Loop (DISEMBL)
MASSLSTEMATTFLSftarpqnpfakirttvlpvlfkprarnlsyktmpssthsefiafkvprpyrrftasasaaattasedsdlltkippdnripatiitgflgsgkntgsa
Flexible Loop (DISEMBL)
MASSLSTEMATTFLsftarpqnpfakIRTTVLPVLFKPRARnlsyktmpssthsefiafkvprPYRRFTASASAaattasedsdlltkippdnriPATIitgflgsgkntgsa
Low Complexity Region (SEG)
MASSLSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIAFKVPRPYRRFtasasaaattasEDSDLLTKIPPDNRIPATIITGFLGSGKNTGSA
Disordered region (IsUnstruct)
***********TFLSFTARPQNPFAKIRTTVLPVLFKPRARNLSY*********EFIAFKVPRPYRRF**************************IPATIITGFL*********
Disordered Region (DISOPRED)
********MATTFLSFTARPQNPFAKIRTTVLPVLFKPRARNLSY******************************************KIPPDNRIPATIITGFLG*G******
Disordered Region (DISEMBL)
*********ATTFLSFTARPQNPFAKIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIAFKVPRPYRRF***************DLLTKIPPDNRIPATIITGFLGSGKNTGSA
Disordered Region (DISPRO)
****LSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRARNLSYKTMPSST****IA****************************TKIPPDNRIPATIITGFLG********
Transmembrane Helix (TMHMM)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (MEMSAT)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
TM Helix, Signal Peptide (MEMSAT_SVM)
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
TM Helix, Signal Peptide (Phobius)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MASSLSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIAFKVPRPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGKNTGSA
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Length	Definition	Q cover	H cover	Identity	E-value
Query	113
255553313	426	prli-interacting factor l, putative [Ric	0.946	0.251	0.620	2e-24
359482402	437	PREDICTED: COBW domain-containing protei	0.893	0.231	0.495	1e-20
359482400	455	PREDICTED: COBW domain-containing protei	0.893	0.221	0.495	2e-20
359482404	426	PREDICTED: COBW domain-containing protei	0.893	0.237	0.495	2e-20
147823223	125	hypothetical protein VITISV_012922 [Viti	0.911	0.824	0.491	5e-18
15220146	444	plastid transcriptionally active 17 prot	0.902	0.229	0.5	2e-15
224128480	449	predicted protein [Populus trichocarpa]	0.778	0.195	0.471	3e-14
356576845	445	PREDICTED: COBW domain-containing protei	0.849	0.215	0.444	1e-13
356536502	437	PREDICTED: COBW domain-containing protei	0.831	0.215	0.453	2e-13
356536500	446	PREDICTED: COBW domain-containing protei	0.831	0.210	0.453	2e-13

>gi|255553313|ref|XP_002517699.1| prli-interacting factor l, putative [Ricinus communis] gi|223543331|gb|EEF44863.1| prli-interacting factor l, putative [Ricinus communis]

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 72/116 (62%), Positives = 88/116 (75%), Gaps = 9/116 (7%)

Query: 1   MASSLSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIAFK 60
           MASSLS ++ATTF SFT+R Q P ++IRT VLP+L KP+ ++LS +T P S HS  I  K
Sbjct: 1   MASSLSVDIATTFFSFTSRHQTPISRIRTAVLPLLLKPK-QSLSLRTTPFS-HSPRILSK 58

Query: 61  VPRPY---RRFTASASAAATTA---SEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
            P  +   RRF+ SA++++TTA   SEDSDL TKIPPDNRIPATIITGFLGSGK T
Sbjct: 59  -PNTFNLHRRFSVSAASSSTTAAPQSEDSDLTTKIPPDNRIPATIITGFLGSGKTT 113

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482402|ref|XP_003632769.1| PREDICTED: COBW domain-containing protein 2-like isoform 2 [Vitis vinifera]

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 80/115 (69%), Gaps = 14/115 (12%)

Query: 3   SSLSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRA---RNLSYKTMPSSTHS----E 55
           +++S ++ATTFL+F +RP     ++RT+VLP+L++P+A    +L++ + P  +       
Sbjct: 2   AAVSLDLATTFLTFASRP-----RVRTSVLPLLWRPKAYGSHSLNFHSFPVPSRRIVAVA 56

Query: 56  FIAFKVPRPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
            ++ K  R  RRF  SA AA TT SE SD+LTKIPPD+RIPATIITGFLGSGK T
Sbjct: 57  GVSSKPQRDRRRF--SAVAAQTTQSEGSDVLTKIPPDDRIPATIITGFLGSGKTT 109

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482400|ref|XP_002268800.2| PREDICTED: COBW domain-containing protein 2-like isoform 1 [Vitis vinifera] gi|297743555|emb|CBI36422.3| unnamed protein product [Vitis vinifera]

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 80/115 (69%), Gaps = 14/115 (12%)

Query: 3   SSLSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRA---RNLSYKTMPSSTHS----E 55
           +++S ++ATTFL+F +RP     ++RT+VLP+L++P+A    +L++ + P  +       
Sbjct: 2   AAVSLDLATTFLTFASRP-----RVRTSVLPLLWRPKAYGSHSLNFHSFPVPSRRIVAVA 56

Query: 56  FIAFKVPRPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
            ++ K  R  RRF  SA AA TT SE SD+LTKIPPD+RIPATIITGFLGSGK T
Sbjct: 57  GVSSKPQRDRRRF--SAVAAQTTQSEGSDVLTKIPPDDRIPATIITGFLGSGKTT 109

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482404|ref|XP_003632770.1| PREDICTED: COBW domain-containing protein 2-like isoform 3 [Vitis vinifera]

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 80/115 (69%), Gaps = 14/115 (12%)

Query: 3   SSLSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRA---RNLSYKTMPSSTHS----E 55
           +++S ++ATTFL+F +RP     ++RT+VLP+L++P+A    +L++ + P  +       
Sbjct: 2   AAVSLDLATTFLTFASRP-----RVRTSVLPLLWRPKAYGSHSLNFHSFPVPSRRIVAVA 56

Query: 56  FIAFKVPRPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
            ++ K  R  RRF  SA AA TT SE SD+LTKIPPD+RIPATIITGFLGSGK T
Sbjct: 57  GVSSKPQRDRRRF--SAVAAQTTQSEGSDVLTKIPPDDRIPATIITGFLGSGKTT 109

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147823223|emb|CAN68607.1| hypothetical protein VITISV_012922 [Vitis vinifera]

 Score = 94.7 bits (234), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 82/118 (69%), Gaps = 15/118 (12%)

Query: 3   SSLSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRA---RNLSYKTMPSSTHSEF--- 56
           +++S ++ATTFL+F +RP     ++RT+VLP+L++P+A    +L++ + P  +       
Sbjct: 2   AAVSLDLATTFLTFASRP-----RVRTSVLPLLWRPKAYGSHSLNFHSFPVPSRRIVAVA 56

Query: 57  -IAFKVPRPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGK-NTGS 112
            ++ K  R  RRF  SA AA TT SE SD+LTKIPPD+RIPATIITGFLGSGK N G+
Sbjct: 57  GVSSKPQRDRRRF--SAVAAQTTQSEGSDVLTKIPPDDRIPATIITGFLGSGKENLGA 112

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|15220146|ref|NP_178163.1| plastid transcriptionally active 17 protein [Arabidopsis thaliana] gi|6730739|gb|AAF27129.1|AC018849_17 hypothetical protein; 58060-60358 [Arabidopsis thaliana] gi|48958493|gb|AAT47799.1| At1g80480 [Arabidopsis thaliana] gi|51536562|gb|AAU05519.1| At1g80480 [Arabidopsis thaliana] gi|332198289|gb|AEE36410.1| plastid transcriptionally active 17 protein [Arabidopsis thaliana]

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 10/112 (8%)

Query: 1   MASSLSTEMATTFLSFTA-RPQNPFA-KIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIA 58
           MA+  + E+ATTFLSFTA R    F  +  +  + VL +PRA  +S +T PS  +S  + 
Sbjct: 1   MATLSTLEIATTFLSFTAPRSSAAFNYRFSSAAVSVLSRPRATTVSVRTTPSFFYSPVV- 59

Query: 59  FKVPRPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
                  RR   S+ +A+ T +EDSD+ TKIPPDNRIPATIITGFLGSGK T
Sbjct: 60  -------RRQRFSSVSASATQTEDSDVTTKIPPDNRIPATIITGFLGSGKTT 104

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224128480|ref|XP_002329014.1| predicted protein [Populus trichocarpa] gi|222839685|gb|EEE78008.1| predicted protein [Populus trichocarpa]

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 18/106 (16%)

Query: 9   MATTFLSFTARPQNPFAKIRTTVLPVLFKPRA--RNLSYKTMPSSTHSEFIAFKVPRPYR 66
           MATTF+S T+   +P   +R+T+LP L KP+   ++L  KT PS               R
Sbjct: 1   MATTFVSLTS--HHPTRILRSTLLPFLLKPQKTHQSLLLKTTPSLQR------------R 46

Query: 67  RFTASASAAATTA--SEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
           RF+ S+    ++A  ++DS L TKIPPDNRI ATIITGFLGSGK T
Sbjct: 47  RFSVSSIDTTSSAPQTDDSGLTTKIPPDNRISATIITGFLGSGKTT 92

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356576845|ref|XP_003556540.1| PREDICTED: COBW domain-containing protein 1-like [Glycine max]

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 12/108 (11%)

Query: 4   SLSTEMATTFLSFTARPQNPFA-KIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIAFKVP 62
           + + E+A +F     R + PF   ++TT+LP+L          +   + +HS+ + F + 
Sbjct: 2   TFTAEVACSFFGLAYRNRKPFTLSLQTTLLPLL----------RRTTTHSHSQSLTFPL- 50

Query: 63  RPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
           RP RRF+  A+  A   SEDSD+ T IPPDNRIPATIITGFLGSGK T
Sbjct: 51  RPSRRFSVPATTTAPPQSEDSDVSTLIPPDNRIPATIITGFLGSGKTT 98

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356536502|ref|XP_003536776.1| PREDICTED: COBW domain-containing protein 2-like isoform 2 [Glycine max]

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 14/108 (12%)

Query: 4   SLSTEMATTFLSFTARPQNPFA-KIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIAFKVP 62
           + +TE+A++FL        PF   ++TT+LP+L +            ++THS  + F + 
Sbjct: 5   TFTTEVASSFLGLAYHNPKPFTLSLQTTLLPLLRR------------TTTHSRSLTFPL- 51

Query: 63  RPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
           RP RRF  +++  A   SEDSD+ T IPPDNRIPATIITGFLGSGK T
Sbjct: 52  RPSRRFFVTSATTAPPQSEDSDVSTVIPPDNRIPATIITGFLGSGKTT 99

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356536500|ref|XP_003536775.1| PREDICTED: COBW domain-containing protein 2-like isoform 1 [Glycine max]

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 14/108 (12%)

Query: 4   SLSTEMATTFLSFTARPQNPFA-KIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIAFKVP 62
           + +TE+A++FL        PF   ++TT+LP+L +            ++THS  + F + 
Sbjct: 5   TFTTEVASSFLGLAYHNPKPFTLSLQTTLLPLLRR------------TTTHSRSLTFPL- 51

Query: 63  RPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
           RP RRF  +++  A   SEDSD+ T IPPDNRIPATIITGFLGSGK T
Sbjct: 52  RPSRRFFVTSATTAPPQSEDSDVSTVIPPDNRIPATIITGFLGSGKTT 99

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Phylum: Streptophyta

Superkingdom: Eukaryota

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	113
TAIR|locus:2198993	444	PTAC17 "plastid transcriptiona	0.876	0.222	0.482	9.2e-17
TAIR|locus:2036189	448	AT1G15730 [Arabidopsis thalian	0.938	0.236	0.360	2.9e-08

TAIR|locus:2198993 PTAC17 "plastid transcriptionally active 17" [Arabidopsis thaliana (taxid:3702)]

 Score = 213 (80.0 bits), Expect = 9.2e-17, P = 9.2e-17
 Identities = 54/112 (48%), Positives = 68/112 (60%)

Query:     3 SSLST-EMATTFLSFTARPQNPFA---KIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIA 58
             ++LST E+ATTFLSFTA P++  A   +  +  + VL +PRA  +S +T PS  +S  + 
Sbjct:     2 ATLSTLEIATTFLSFTA-PRSSAAFNYRFSSAAVSVLSRPRATTVSVRTTPSFFYSPVV- 59

Query:    59 FKVPRPYRRFXXXXXXXXXXXXEDSDLLTKIPPDNRIPATIITGFLGSGKNT 110
                    RR             EDSD+ TKIPPDNRIPATIITGFLGSGK T
Sbjct:    60 -------RRQRFSSVSASATQTEDSDVTTKIPPDNRIPATIITGFLGSGKTT 104

GO:0009295 "nucleoid" evidence=IDA

GO:0009508 "plastid chromosome" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

GO:0009570 "chloroplast stroma" evidence=IDA

TAIR|locus:2036189 AT1G15730 [Arabidopsis thaliana (taxid:3702)]

 Score = 135 (52.6 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 40/111 (36%), Positives = 53/111 (47%)

Query:     1 MASSLSTEMATTFLSFTARPQNPFAKIRTTVLPVLFKPRARNLSYKTMPSSTHSEFIAFK 60
             MA+ L  ++ATTFL+F     N     R     +        +S +T  SS +S  +   
Sbjct:     1 MATLLKLDIATTFLAFIVPRANTSLNHRFASARL----STATVSLRTKSSSFYSAALYSD 56

Query:    61 VPRPYRRFXXXXXXXXXXXXEDS-DLLTKIPPDNRIPATIITGFLGSGKNT 110
               R +               ED  D+ ++I PDNRIPATIITGFLGSGK T
Sbjct:    57 SRRRFHSAVASDSSLAVVDDEDIFDVASEILPDNRIPATIITGFLGSGKTT 107


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.132   0.380    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      113       101   0.00091  102 3  11 22  0.38    30
                                                     29  0.47    31


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  2
  No. of states in DFA:  452 (48 KB)
  Total size of DFA:  86 KB (2067 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  9.02u 0.14s 9.16t   Elapsed:  00:00:00
  Total cpu time:  9.02u 0.14s 9.16t   Elapsed:  00:00:00
  Start:  Fri May 10 00:14:47 2013   End:  Fri May 10 00:14:47 2013

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	PTAC17	PTAC17 (PLASTID TRANSCRIPTIONALLY ACTIVE17); PLASTID TRANSCRIPTIONALLY ACTIVE17 (PTAC17); LOCATED IN- plastid chromosome, chloroplast stroma, chloroplast, nucleoid; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Cobalamin (vitamin B12) biosynthesis CobW-like (InterPro-IPR003495), Cobalamin (vitamin B12) biosynthesis CobW-like, C-terminal (InterPro-IPR011629); BEST Arabidopsis thaliana protein match is- PRLI-interacting factor L, putative (TAIR-AT1G15730.1); Has 18597 Blast hits to 10859 proteins in 1179 species- Archae - 146; Bacteria [...] (444 aa)
		(Arabidopsis thaliana)
Predicted Functional Partners:
	PTAC6	PTAC6 (PLASTID TRANSCRIPTIONALLY ACTIVE6); Present in transcriptionally active plastid chromoso [...] (328 aa)				•			•		0.890
	PTAC5	PTAC5 (PLASTID TRANSCRIPTIONALLY ACTIVE5); heat shock protein binding / unfolded protein bindin [...] (387 aa)				•			•		0.794
	AT1G32310	unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (100 aa)					•				0.788
	PDE312	RNA binding; PIGMENT DEFECTIVE 312 (PDE312); FUNCTIONS IN- RNA binding; LOCATED IN- plastid chr [...] (697 aa)				•			•		0.783
	AT4G02990	mitochondrial transcription termination factor family protein / mTERF family protein; mitochond [...] (541 aa)				•			•		0.761
	MAP1C	MAP1C (METHIONINE AMINOPEPTIDASE 1B); aminopeptidase/ metalloexopeptidase; Encodes a methionine [...] (369 aa)				•			•		0.735
	PTAC14	PTAC14 (PLASTID TRANSCRIPTIONALLY ACTIVE14); PLASTID TRANSCRIPTIONALLY ACTIVE14 (PTAC14); LOCAT [...] (483 aa)				•			•		0.731
	PTAC3	PTAC3 (PLASTID TRANSCRIPTIONALLY ACTIVE3); DNA binding / nucleic acid binding; PLASTID TRANSCRI [...] (913 aa)				•			•		0.720
	AT1G67660	DNA binding / nuclease; DNA binding / nuclease; FUNCTIONS IN- DNA binding, nuclease activity; I [...] (355 aa)				•					0.710
	emb2746	emb2746 (embryo defective 2746); DNA binding / catalytic/ hydrolase; embryo defective 2746 (emb [...] (911 aa)				•					0.704

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Length	Definition	E-value
Query	113
COG0523	323	COG0523, COG0523, Putative GTPases (G3E family) [G	6e-05
TIGR02475	341	TIGR02475, CobW, cobalamin biosynthesis protein Co	2e-04
pfam02492	178	pfam02492, cobW, CobW/HypB/UreG, nucleotide-bindin	0.002
cd03112	158	cd03112, CobW_like, The function of this protein f	0.002

>gnl|CDD|223597 COG0523, COG0523, Putative GTPases (G3E family) [General function prediction only]

 Score = 40.4 bits (95), Expect = 6e-05
 Identities = 13/16 (81%), Positives = 14/16 (87%)

Query: 95  IPATIITGFLGSGKNT 110
           IP T+ITGFLGSGK T
Sbjct: 1   IPVTVITGFLGSGKTT 16

Length = 323

>gnl|CDD|233883 TIGR02475, CobW, cobalamin biosynthesis protein CobW

 Score = 39.0 bits (91), Expect = 2e-04
 Identities = 12/17 (70%), Positives = 15/17 (88%)

Query: 94  RIPATIITGFLGSGKNT 110
           +IP TI+TGFLG+GK T
Sbjct: 3   KIPVTIVTGFLGAGKTT 19

The family of proteins identified by this model is generally found proximal to the trimeric cobaltochelatase subunit CobN which is essential for vitamin B12 (cobalamin) biosynthesis. The protein contains an P-loop nucleotide-binding loop in the N-terminal domain and a histidine-rich region in the C-terminal portion suggesting a role in metal binding, possibly as an intermediary between the cobalt transport and chelation systems. A broader CobW family is delineated by two PFAM models which identify the N- and C-terminal domains (pfam02492 and pfam07683) [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]. Length = 341

>gnl|CDD|217066 pfam02492, cobW, CobW/HypB/UreG, nucleotide-binding domain

 Score = 35.7 bits (83), Expect = 0.002
 Identities = 11/15 (73%), Positives = 13/15 (86%)

Query: 96  PATIITGFLGSGKNT 110
           P T++TGFLGSGK T
Sbjct: 1   PVTVLTGFLGSGKTT 15

This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans. Length = 178

>gnl|CDD|239386 cd03112, CobW_like, The function of this protein family is unkown

 Score = 35.3 bits (82), Expect = 0.002
 Identities = 10/15 (66%), Positives = 13/15 (86%)

Query: 96  PATIITGFLGSGKNT 110
           P T++TGFLG+GK T
Sbjct: 1   PVTVLTGFLGAGKTT 15

The amino acid sequence of YjiA protein in E. coli contains several conserved motifs that characterizes it as a P-loop GTPase. YijA gene is among the genes significantly induced in response to DNA-damage caused by mitomycin. YijA gene is a homologue of the CobW gene which encodes the cobalamin synthesis protein/P47K. Length = 158

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	113
KOG2743	391	consensus Cobalamin synthesis protein [Coenzyme tr	99.0
TIGR00073	207	hypB hydrogenase accessory protein HypB. HypB is i	97.79
COG3910	233	Predicted ATPase [General function prediction only	96.77
PF13555	62	AAA_29: P-loop containing region of AAA domain	96.73
cd01878	204	HflX HflX subfamily. A distinct conserved domain w	96.58
cd03238	176	ABC_UvrA The excision repair protein UvrA; Nucleot	96.56
PF07693	325	KAP_NTPase: KAP family P-loop domain; InterPro: IP	96.54
cd03283	199	ABC_MutS-like MutS-like homolog in eukaryotes. The	96.5
cd03280	200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	96.44
cd03243	202	ABC_MutS_homologs The MutS protein initiates DNA m	96.37
cd03225	211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	96.14
cd03226	205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	96.11
PRK10463	290	hydrogenase nickel incorporation protein HypB; Pro	96.11
cd03268	208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	96.11
cd03255	218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	96.09
TIGR00960	216	3a0501s02 Type II (General) Secretory Pathway (IIS	96.06
cd03269	210	ABC_putative_ATPase This subfamily is involved in	96.03
cd03293	220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	96.03
cd03258	233	ABC_MetN_methionine_transporter MetN (also known a	96.03
cd03265	220	ABC_DrrA DrrA is the ATP-binding protein component	96.01
cd03261	235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	96.0
COG1136	226	SalX ABC-type antimicrobial peptide transport syst	95.97
cd03256	241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	95.96
cd03259	213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	95.95
TIGR03608	206	L_ocin_972_ABC putative bacteriocin export ABC tra	95.95
TIGR02211	221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	95.93
TIGR01978	243	sufC FeS assembly ATPase SufC. SufC is part of the	95.91
cd03292	214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	95.91
TIGR02673	214	FtsE cell division ATP-binding protein FtsE. This	95.9
cd03257	228	ABC_NikE_OppD_transporters The ABC transporter sub	95.9
cd03266	218	ABC_NatA_sodium_exporter NatA is the ATPase compon	95.89
cd03224	222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	95.89
cd03227	162	ABC_Class2 ABC-type Class 2 contains systems invol	95.87
cd03235	213	ABC_Metallic_Cations ABC component of the metal-ty	95.85
PRK10584	228	putative ABC transporter ATP-binding protein YbbA;	95.83
PRK14242	253	phosphate transporter ATP-binding protein; Provisi	95.81
PRK11629	233	lolD lipoprotein transporter ATP-binding subunit;	95.81
TIGR02315	243	ABC_phnC phosphonate ABC transporter, ATP-binding	95.8
cd03260	227	ABC_PstB_phosphate_transporter Phosphate uptake is	95.77
cd03263	220	ABC_subfamily_A The ABCA subfamily mediates the tr	95.76
cd03264	211	ABC_drug_resistance_like ABC-type multidrug transp	95.76
cd03219	236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	95.75
cd03250	204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	95.75
cd03279	213	ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex	95.73
cd03297	214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	95.73
cd03218	232	ABC_YhbG The ABC transporters belonging to the Yhb	95.73
cd03301	213	ABC_MalK_N The N-terminal ATPase domain of the mal	95.72
PF13191	185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	95.72
cd03254	229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	95.7
TIGR02324	224	CP_lyasePhnL phosphonate C-P lyase system protein	95.7
cd03251	234	ABCC_MsbA MsbA is an essential ABC transporter, cl	95.69
cd03262	213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	95.69
PRK13541	195	cytochrome c biogenesis protein CcmA; Provisional	95.68
cd03253	236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	95.66
cd03272	243	ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein	95.64
cd03221	144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	95.64
PRK10247	225	putative ABC transporter ATP-binding protein YbbL;	95.63
cd03298	211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	95.62
cd03215	182	ABC_Carb_Monos_II This family represents domain II	95.62
cd01130	186	VirB11-like_ATPase Type IV secretory pathway compo	95.61
PRK11248	255	tauB taurine transporter ATP-binding subunit; Prov	95.58
cd03247	178	ABCC_cytochrome_bd The CYD subfamily implicated in	95.58
TIGR02323	253	CP_lyasePhnK phosphonate C-P lyase system protein	95.57
PRK14273	254	phosphate ABC transporter ATP-binding protein; Pro	95.55
PRK14274	259	phosphate ABC transporter ATP-binding protein; Pro	95.55
cd03267	236	ABC_NatA_like Similar in sequence to NatA, this is	95.55
PRK11124	242	artP arginine transporter ATP-binding subunit; Pro	95.55
TIGR03015	269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	95.55
TIGR03410	230	urea_trans_UrtE urea ABC transporter, ATP-binding	95.55
cd03223	166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	95.54
cd03240	204	ABC_Rad50 The catalytic domains of Rad50 are simil	95.53
PRK13649	280	cbiO cobalt transporter ATP-binding subunit; Provi	95.52
TIGR00972	247	3a0107s01c2 phosphate ABC transporter, ATP-binding	95.52
TIGR01189	198	ccmA heme ABC exporter, ATP-binding protein CcmA.	95.52
PRK10908	222	cell division protein FtsE; Provisional	95.52
cd03296	239	ABC_CysA_sulfate_importer Part of the ABC transpor	95.51
PRK14247	250	phosphate ABC transporter ATP-binding protein; Pro	95.51
TIGR00150	133	HI0065_YjeE ATPase, YjeE family. Members of this f	95.49
cd03246	173	ABCC_Protease_Secretion This family represents the	95.49
cd03228	171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	95.48
cd03249	238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	95.47
cd03281	213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	95.44
cd03252	237	ABCC_Hemolysin The ABC-transporter hemolysin B is	95.44
PRK13543	214	cytochrome c biogenesis protein CcmA; Provisional	95.44
cd03245	220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	95.44
PRK13539	207	cytochrome c biogenesis protein CcmA; Provisional	95.43
cd03232	192	ABC_PDR_domain2 The pleiotropic drug resistance-li	95.43
cd03229	178	ABC_Class3 This class is comprised of all BPD (Bin	95.43
PRK10895	241	lipopolysaccharide ABC transporter ATP-binding pro	95.42
PRK10744	260	pstB phosphate transporter ATP-binding protein; Pr	95.42
PRK11264	250	putative amino-acid ABC transporter ATP-binding pr	95.41
PRK13645	289	cbiO cobalt transporter ATP-binding subunit; Provi	95.41
PRK13632	271	cbiO cobalt transporter ATP-binding subunit; Provi	95.41
PRK14241	258	phosphate transporter ATP-binding protein; Provisi	95.41
PRK13638	271	cbiO cobalt transporter ATP-binding subunit; Provi	95.4
PRK13538	204	cytochrome c biogenesis protein CcmA; Provisional	95.4
TIGR03864	236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	95.39
PRK09493	240	glnQ glutamine ABC transporter ATP-binding protein	95.38
COG0419	908	SbcC ATPase involved in DNA repair [DNA replicatio	95.36
cd03294	269	ABC_Pro_Gly_Bertaine This family comprises the gly	95.36
PRK14261	253	phosphate ABC transporter ATP-binding protein; Pro	95.36
cd03244	221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	95.35
PRK13540	200	cytochrome c biogenesis protein CcmA; Provisional	95.35
PRK11831	269	putative ABC transporter ATP-binding protein YrbF;	95.35
PRK11300	255	livG leucine/isoleucine/valine transporter ATP-bin	95.35
cd03234	226	ABCG_White The White subfamily represents ABC tran	95.34
PRK14262	250	phosphate ABC transporter ATP-binding protein; Pro	95.34
PRK14267	253	phosphate ABC transporter ATP-binding protein; Pro	95.33
PRK03695	248	vitamin B12-transporter ATPase; Provisional	95.33
PRK14245	250	phosphate ABC transporter ATP-binding protein; Pro	95.32
cd03230	173	ABC_DR_subfamily_A This family of ATP-binding prot	95.32
PRK14239	252	phosphate transporter ATP-binding protein; Provisi	95.32
PRK14253	249	phosphate ABC transporter ATP-binding protein; Pro	95.32
PRK14269	246	phosphate ABC transporter ATP-binding protein; Pro	95.31
cd03216	163	ABC_Carb_Monos_I This family represents the domain	95.31
PF13245	76	AAA_19: Part of AAA domain	95.31
cd03295	242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	95.3
PRK14256	252	phosphate ABC transporter ATP-binding protein; Pro	95.29
PRK14248	268	phosphate ABC transporter ATP-binding protein; Pro	95.28
cd03237	246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	95.27
cd03233	202	ABC_PDR_domain1 The pleiotropic drug resistance (P	95.27
cd00267	157	ABC_ATPase ABC (ATP-binding cassette) transporter	95.27
TIGR03740	223	galliderm_ABC gallidermin-class lantibiotic protec	95.27
cd03248	226	ABCC_TAP TAP, the Transporter Associated with Anti	95.27
CHL00131	252	ycf16 sulfate ABC transporter protein; Validated	95.26
TIGR03411	242	urea_trans_UrtD urea ABC transporter, ATP-binding	95.24
PRK14251	251	phosphate ABC transporter ATP-binding protein; Pro	95.24
PRK14270	251	phosphate ABC transporter ATP-binding protein; Pro	95.24
PRK14268	258	phosphate ABC transporter ATP-binding protein; Pro	95.21
cd03275	247	ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein	95.21
PRK14235	267	phosphate transporter ATP-binding protein; Provisi	95.19
PRK11231	255	fecE iron-dicitrate transporter ATP-binding subuni	95.18
cd03222	177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	95.18
PRK13648	269	cbiO cobalt transporter ATP-binding subunit; Provi	95.18
PRK14265	274	phosphate ABC transporter ATP-binding protein; Pro	95.18
PRK11247	257	ssuB aliphatic sulfonates transport ATP-binding su	95.18
TIGR03873	256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	95.17
PRK11614	237	livF leucine/isoleucine/valine transporter ATP-bin	95.16
PRK14255	252	phosphate ABC transporter ATP-binding protein; Pro	95.14
cd03290	218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	95.14
PRK14249	251	phosphate ABC transporter ATP-binding protein; Pro	95.13
cd03214	180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	95.13
TIGR01277	213	thiQ thiamine ABC transporter, ATP-binding protein	95.13
PRK09580	248	sufC cysteine desulfurase ATPase component; Review	95.12
TIGR00750	300	lao LAO/AO transport system ATPase. Mutations have	95.12
PRK13548	258	hmuV hemin importer ATP-binding subunit; Provision	95.11
cd03278	197	ABC_SMC_barmotin Barmotin is a tight junction-asso	95.11
TIGR03005	252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	95.1
PRK10418	254	nikD nickel transporter ATP-binding protein NikD;	95.09
PRK14237	267	phosphate transporter ATP-binding protein; Provisi	95.08
PRK10253	265	iron-enterobactin transporter ATP-binding protein;	95.08
PRK14266	250	phosphate ABC transporter ATP-binding protein; Pro	95.08
COG4133	209	CcmA ABC-type transport system involved in cytochr	95.08
PRK09544	251	znuC high-affinity zinc transporter ATPase; Review	95.07
PRK14250	241	phosphate ABC transporter ATP-binding protein; Pro	95.07
cd03231	201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	95.06
COG1120	258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	95.05
PRK15112	267	antimicrobial peptide ABC system ATP-binding prote	95.05
cd03220	224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	95.05
cd03217	200	ABC_FeS_Assembly ABC-type transport system involve	95.04
PRK15056	272	manganese/iron transporter ATP-binding protein; Pr	95.03
PRK14244	251	phosphate ABC transporter ATP-binding protein; Pro	95.03
PRK14240	250	phosphate transporter ATP-binding protein; Provisi	95.03
cd03369	207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	95.03
PRK10771	232	thiQ thiamine transporter ATP-binding subunit; Pro	95.01
PRK14259	269	phosphate ABC transporter ATP-binding protein; Pro	95.0
PF02463	220	SMC_N: RecF/RecN/SMC N terminal domain; InterPro:	94.99
cd03213	194	ABCG_EPDR ABCG transporters are involved in eye pi	94.98
COG0802	149	Predicted ATPase or kinase [General function predi	94.96
PRK14252	265	phosphate ABC transporter ATP-binding protein; Pro	94.96
cd03284	216	ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr	94.93
PRK11701	258	phnK phosphonate C-P lyase system protein PhnK; Pr	94.93
TIGR01288	303	nodI ATP-binding ABC transporter family nodulation	94.92
PRK14238	271	phosphate transporter ATP-binding protein; Provisi	94.91
PRK10575	265	iron-hydroxamate transporter ATP-binding subunit;	94.91
cd03271	261	ABC_UvrA_II The excision repair protein UvrA domai	94.9
PRK14272	252	phosphate ABC transporter ATP-binding protein; Pro	94.88
PRK13635	279	cbiO cobalt transporter ATP-binding subunit; Provi	94.87
PRK10619	257	histidine/lysine/arginine/ornithine transporter su	94.86
TIGR02633	500	xylG D-xylose ABC transporter, ATP-binding protein	94.83
PRK14275	286	phosphate ABC transporter ATP-binding protein; Pro	94.83
cd03300	232	ABC_PotA_N PotA is an ABC-type transporter and the	94.82
cd03239	178	ABC_SMC_head The structural maintenance of chromos	94.82
PRK13547	272	hmuV hemin importer ATP-binding subunit; Provision	94.8
TIGR02769	265	nickel_nikE nickel import ATP-binding protein NikE	94.8
PRK09984	262	phosphonate/organophosphate ester transporter subu	94.78
cd03236	255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	94.78
PRK14260	259	phosphate ABC transporter ATP-binding protein; Pro	94.76
PRK10419	268	nikE nickel transporter ATP-binding protein NikE;	94.74
PRK13644	274	cbiO cobalt transporter ATP-binding subunit; Provi	94.71
PRK14243	264	phosphate transporter ATP-binding protein; Provisi	94.71
PRK10938	490	putative molybdenum transport ATP-binding protein	94.7
PRK09700	510	D-allose transporter ATP-binding protein; Provisio	94.66
PRK13633	280	cobalt transporter ATP-binding subunit; Provisiona	94.66
PRK13652	277	cbiO cobalt transporter ATP-binding subunit; Provi	94.65
PRK13641	287	cbiO cobalt transporter ATP-binding subunit; Provi	94.64
PHA00547	337	hypothetical protein	94.64
TIGR02524	358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	94.6
cd03274	212	ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein	94.6
PRK13851	344	type IV secretion system protein VirB11; Provision	94.58
TIGR01420	343	pilT_fam pilus retraction protein PilT. This model	94.56
TIGR02982	220	heterocyst_DevA ABC exporter ATP-binding subunit,	94.56
PRK14271	276	phosphate ABC transporter ATP-binding protein; Pro	94.53
cd01129	264	PulE-GspE PulE/GspE The type II secretory pathway	94.52
TIGR03522	301	GldA_ABC_ATP gliding motility-associated ABC trans	94.5
TIGR02142	354	modC_ABC molybdenum ABC transporter, ATP-binding p	94.5
TIGR02788	308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	94.49
PF00437	270	T2SE: Type II/IV secretion system protein; InterPr	94.49
PRK13640	282	cbiO cobalt transporter ATP-binding subunit; Provi	94.48
PRK14236	272	phosphate transporter ATP-binding protein; Provisi	94.48
TIGR00968	237	3a0106s01 sulfate ABC transporter, ATP-binding pro	94.47
TIGR03269	520	met_CoM_red_A2 methyl coenzyme M reductase system,	94.47
cd03277	213	ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein	94.47
COG1119	257	ModF ABC-type molybdenum transport system, ATPase	94.47
PRK00454	196	engB GTP-binding protein YsxC; Reviewed	94.44
COG1131	293	CcmA ABC-type multidrug transport system, ATPase c	94.41
PRK13833	323	conjugal transfer protein TrbB; Provisional	94.4
PRK14258	261	phosphate ABC transporter ATP-binding protein; Pro	94.4
PRK09700	510	D-allose transporter ATP-binding protein; Provisio	94.38
PRK13549	506	xylose transporter ATP-binding subunit; Provisiona	94.38
PRK13549	506	xylose transporter ATP-binding subunit; Provisiona	94.38
PRK13650	279	cbiO cobalt transporter ATP-binding subunit; Provi	94.37
PRK11144	352	modC molybdate transporter ATP-binding protein; Pr	94.37
PRK13646	286	cbiO cobalt transporter ATP-binding subunit; Provi	94.35
PRK11000	369	maltose/maltodextrin transporter ATP-binding prote	94.34
PRK10938	490	putative molybdenum transport ATP-binding protein	94.34
PRK13546	264	teichoic acids export protein ATP-binding subunit;	94.33
PRK11153	343	metN DL-methionine transporter ATP-binding subunit	94.32
cd03242	270	ABC_RecF RecF is a recombinational DNA repair ATPa	94.32
PRK14254	285	phosphate ABC transporter ATP-binding protein; Pro	94.32
PRK13900	332	type IV secretion system ATPase VirB11; Provisiona	94.31
PRK14263	261	phosphate ABC transporter ATP-binding protein; Pro	94.29
PRK10762	501	D-ribose transporter ATP binding protein; Provisio	94.23
PRK15439	510	autoinducer 2 ABC transporter ATP-binding protein	94.23
cd03241	276	ABC_RecN RecN ATPase involved in DNA repair; ABC (	94.22
cd03273	251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	94.18
PRK10646	153	ADP-binding protein; Provisional	94.18
COG0411	250	LivG ABC-type branched-chain amino acid transport	94.18
PRK09270	229	nucleoside triphosphate hydrolase domain-containin	94.17
PRK15064	530	ABC transporter ATP-binding protein; Provisional	94.15
TIGR03719	552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	94.15
COG1121	254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	94.11
PRK13647	274	cbiO cobalt transporter ATP-binding subunit; Provi	94.11
cd03276	198	ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein	94.09
TIGR02782	299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	94.08
PRK10762	501	D-ribose transporter ATP binding protein; Provisio	94.07
PRK15064	530	ABC transporter ATP-binding protein; Provisional	94.07
PRK11288	501	araG L-arabinose transporter ATP-binding protein;	94.06
PRK11819	556	putative ABC transporter ATP-binding protein; Revi	94.06
PRK15439	510	autoinducer 2 ABC transporter ATP-binding protein	94.06
TIGR03269	520	met_CoM_red_A2 methyl coenzyme M reductase system,	94.05
PRK15134	529	microcin C ABC transporter ATP-binding protein Yej	94.01
cd03291	282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	93.93
TIGR02633	500	xylG D-xylose ABC transporter, ATP-binding protein	93.93
PRK10982	491	galactose/methyl galaxtoside transporter ATP-bindi	93.93
PRK13651	305	cobalt transporter ATP-binding subunit; Provisiona	93.92
PRK13634	290	cbiO cobalt transporter ATP-binding subunit; Provi	93.91
PRK11288	501	araG L-arabinose transporter ATP-binding protein;	93.88
PRK13639	275	cbiO cobalt transporter ATP-binding subunit; Provi	93.86
PF01637	234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	93.86
TIGR00618	1042	sbcc exonuclease SbcC. This family is based on the	93.86
TIGR03185	650	DNA_S_dndD DNA sulfur modification protein DndD. T	93.84
PRK14264	305	phosphate ABC transporter ATP-binding protein; Pro	93.82
PRK13642	277	cbiO cobalt transporter ATP-binding subunit; Provi	93.81
cd03288	257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	93.81
cd03282	204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	93.79
PRK15134	529	microcin C ABC transporter ATP-binding protein Yej	93.78
PRK14246	257	phosphate ABC transporter ATP-binding protein; Pro	93.77
cd03270	226	ABC_UvrA_I The excision repair protein UvrA domain	93.74
PRK13643	288	cbiO cobalt transporter ATP-binding subunit; Provi	93.74
TIGR03719	552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	93.71
PRK13637	287	cbiO cobalt transporter ATP-binding subunit; Provi	93.64
PRK13631	320	cbiO cobalt transporter ATP-binding subunit; Provi	93.63
cd03299	235	ABC_ModC_like Archeal protein closely related to M	93.61
PRK10070	400	glycine betaine transporter ATP-binding subunit; P	93.61
PRK11819	556	putative ABC transporter ATP-binding protein; Revi	93.61
COG1126	240	GlnQ ABC-type polar amino acid transport system, A	93.6
TIGR02525	372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	93.56
PRK11650	356	ugpC glycerol-3-phosphate transporter ATP-binding	93.55
PLN02200	234	adenylate kinase family protein	93.54
PHA02562	562	46 endonuclease subunit; Provisional	93.54
PRK13537	306	nodulation ABC transporter NodI; Provisional	93.49
cd03285	222	ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS	93.45
TIGR00554	290	panK_bact pantothenate kinase, bacterial type. Sho	93.44
PRK10636	638	putative ABC transporter ATP-binding protein; Prov	93.43
TIGR03265	353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	93.4
TIGR02168	1179	SMC_prok_B chromosome segregation protein SMC, com	93.36
PRK10982	491	galactose/methyl galaxtoside transporter ATP-bindi	93.34
COG3950	440	Predicted ATP-binding protein involved in virulenc	93.31
TIGR02314	343	ABC_MetN D-methionine ABC transporter, ATP-binding	93.31
PRK13636	283	cbiO cobalt transporter ATP-binding subunit; Provi	93.3
PRK11432	351	fbpC ferric transporter ATP-binding subunit; Provi	93.29
PRK13894	319	conjugal transfer ATPase TrbB; Provisional	93.28
PRK13536	340	nodulation factor exporter subunit NodI; Provision	93.26
PRK02224	880	chromosome segregation protein; Provisional	93.25
PRK09452	375	potA putrescine/spermidine ABC transporter ATPase	93.19
TIGR03258	362	PhnT 2-aminoethylphosphonate ABC transport system,	93.19
PRK10851	353	sulfate/thiosulfate transporter subunit; Provision	93.18
PRK11147	635	ABC transporter ATPase component; Reviewed	93.14
PRK11147	635	ABC transporter ATPase component; Reviewed	93.12
COG1122	235	CbiO ABC-type cobalt transport system, ATPase comp	93.03
PRK06696	223	uridine kinase; Validated	92.99
COG3839	338	MalK ABC-type sugar transport systems, ATPase comp	92.94
TIGR02169	1164	SMC_prok_A chromosome segregation protein SMC, pri	92.92
PRK10636	638	putative ABC transporter ATP-binding protein; Prov	92.89
PRK00064	361	recF recombination protein F; Reviewed	92.84
PRK14079	349	recF recombination protein F; Provisional	92.83
PRK09087	226	hypothetical protein; Validated	92.78
KOG2373	514	consensus Predicted mitochondrial DNA helicase twi	92.71
PRK12402	337	replication factor C small subunit 2; Reviewed	92.66
TIGR02868	529	CydC thiol reductant ABC exporter, CydC subunit. T	92.64
TIGR02533	486	type_II_gspE general secretory pathway protein E.	92.62
PRK11607	377	potG putrescine transporter ATP-binding subunit; P	92.61
PRK09536	402	btuD corrinoid ABC transporter ATPase; Reviewed	92.57
TIGR00606	1311	rad50 rad50. This family is based on the phylogeno	92.53
PRK14489	366	putative bifunctional molybdopterin-guanine dinucl	92.52
COG4962	355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	92.51
PRK10261	623	glutathione transporter ATP-binding protein; Provi	92.4
TIGR02203	571	MsbA_lipidA lipid A export permease/ATP-binding pr	92.37
PRK09435	332	membrane ATPase/protein kinase; Provisional	92.34
PRK03846	198	adenylylsulfate kinase; Provisional	92.32
PLN03073	718	ABC transporter F family; Provisional	92.32
PRK06620	214	hypothetical protein; Validated	92.24
PRK10261	623	glutathione transporter ATP-binding protein; Provi	92.23
TIGR01069	771	mutS2 MutS2 family protein. Function of MutS2 is u	92.2
PRK15093	330	antimicrobial peptide ABC transporter ATP-binding	92.16
PF03193	161	DUF258: Protein of unknown function, DUF258; Inter	92.08
TIGR00611	365	recf recF protein. All proteins in this family for	92.08
PRK01156	895	chromosome segregation protein; Provisional	92.0
TIGR02857	529	CydD thiol reductant ABC exporter, CydD subunit. U	91.99
TIGR03415	382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	91.98
PRK13409	590	putative ATPase RIL; Provisional	91.97
cd01858	157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	91.96
PRK10246	1047	exonuclease subunit SbcC; Provisional	91.86
PLN02165	334	adenylate isopentenyltransferase	91.82
PRK13657	588	cyclic beta-1,2-glucan ABC transporter; Provisiona	91.77
COG4148	352	ModC ABC-type molybdate transport system, ATPase c	91.76
COG2804	500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	91.75
COG4525	259	TauB ABC-type taurine transport system, ATPase com	91.75
PRK11176	582	lipid transporter ATP-binding/permease protein; Pr	91.74
PRK10789	569	putative multidrug transporter membrane\ATP-bindin	91.69
PRK11058	426	GTPase HflX; Provisional	91.66
PRK11022	326	dppD dipeptide transporter ATP-binding subunit; Pr	91.65
COG0410	237	LivF ABC-type branched-chain amino acid transport	91.62
PLN03211	659	ABC transporter G-25; Provisional	91.58
TIGR00955	617	3a01204 The Eye Pigment Precursor Transporter (EPP	91.54
PRK13409	590	putative ATPase RIL; Provisional	91.53
PRK00440	319	rfc replication factor C small subunit; Reviewed	91.52
TIGR00635	305	ruvB Holliday junction DNA helicase, RuvB subunit.	91.51
PRK03918	880	chromosome segregation protein; Provisional	91.43
cd03289	275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	91.41
PF00488	235	MutS_V: MutS domain V C-terminus.; InterPro: IPR00	91.36
PF13481	193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	91.33
PRK15079	331	oligopeptide ABC transporter ATP-binding protein O	91.24
PRK08084	235	DNA replication initiation factor; Provisional	91.12
PRK06893	229	DNA replication initiation factor; Validated	91.08
PRK10436	462	hypothetical protein; Provisional	91.05
TIGR03238	504	dnd_assoc_3 dnd system-associated protein 3. cereu	91.02
TIGR00634	563	recN DNA repair protein RecN. All proteins in this	91.01
COG3840	231	ThiQ ABC-type thiamine transport system, ATPase co	90.99
PF13175	415	AAA_15: AAA ATPase domain	90.96
PRK00098	298	GTPase RsgA; Reviewed	90.95
TIGR03878	259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	90.94
PRK11174	588	cysteine/glutathione ABC transporter membrane/ATP-	90.92
PRK10522	547	multidrug transporter membrane component/ATP-bindi	90.91
PRK11308	327	dppF dipeptide transporter ATP-binding subunit; Pr	90.85
COG1116	248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	90.82
TIGR02538	564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	90.81
PRK14257	329	phosphate ABC transporter ATP-binding protein; Pro	90.69
PRK04841	903	transcriptional regulator MalT; Provisional	90.65
TIGR01194	555	cyc_pep_trnsptr cyclic peptide transporter. This m	90.59
TIGR02204	576	MsbA_rel ABC transporter, permease/ATP-binding pro	90.54
COG0467	260	RAD55 RecA-superfamily ATPases implicated in signa	90.52
KOG0061	613	consensus Transporter, ABC superfamily (Breast can	90.51
PRK13764	602	ATPase; Provisional	90.47
TIGR01192	585	chvA glucan exporter ATP-binding protein. This mod	90.45
TIGR03156	351	GTP_HflX GTP-binding protein HflX. This protein fa	90.4
COG3842	352	PotA ABC-type spermidine/putrescine transport syst	90.4
TIGR01842	544	type_I_sec_PrtD type I secretion system ABC transp	90.38
PRK09473	330	oppD oligopeptide transporter ATP-binding componen	90.33
TIGR03499	282	FlhF flagellar biosynthetic protein FlhF.	90.24
COG4559	259	ABC-type hemin transport system, ATPase component	90.16
PRK05439	311	pantothenate kinase; Provisional	90.12
PRK11160	574	cysteine/glutathione ABC transporter membrane/ATP-	90.12
cd03287	222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	90.1
TIGR03796	710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	90.08
TIGR03797	686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	90.02
TIGR02236	310	recomb_radA DNA repair and recombination protein R	90.02
TIGR00958	711	3a01208 Conjugate Transporter-2 (CT2) Family prote	89.98
PRK09361	225	radB DNA repair and recombination protein RadB; Pr	89.83
TIGR03375	694	type_I_sec_LssB type I secretion system ATPase, Ls	89.82
PRK13545	549	tagH teichoic acids export protein ATP-binding sub	89.8
PLN03140	1470	ABC transporter G family member; Provisional	89.8
PRK08533	230	flagellar accessory protein FlaH; Reviewed	89.8
PRK00411	394	cdc6 cell division control protein 6; Reviewed	89.74
cd01854	287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	89.68
PRK10790	592	putative multidrug transporter membrane\ATP-bindin	89.66
TIGR00954	659	3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA	89.58
PTZ00202	550	tuzin; Provisional	89.54
PRK08903	227	DnaA regulatory inactivator Hda; Validated	89.49
TIGR00956	1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	89.47
TIGR02858	270	spore_III_AA stage III sporulation protein AA. Mem	89.46
TIGR00157	245	ribosome small subunit-dependent GTPase A. The Aqu	89.38
COG1106	371	Predicted ATPases [General function prediction onl	89.32
PRK10869	553	recombination and repair protein; Provisional	89.18
PLN02840	421	tRNA dimethylallyltransferase	89.18
COG0630	312	VirB11 Type IV secretory pathway, VirB11 component	89.11
PLN03140	1470	ABC transporter G family member; Provisional	89.05
TIGR00956	1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	89.02
PRK12288	347	GTPase RsgA; Reviewed	88.99
smart00053	240	DYNc Dynamin, GTPase. Large GTPases that mediate v	88.94
TIGR03420	226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	88.9
TIGR03819	340	heli_sec_ATPase helicase/secretion neighborhood AT	88.87
PRK14974	336	cell division protein FtsY; Provisional	88.85
TIGR01193	708	bacteriocin_ABC ABC-type bacteriocin transporter.	88.66
KOG0926	1172	consensus DEAH-box RNA helicase [RNA processing an	88.65
TIGR01448	720	recD_rel helicase, putative, RecD/TraA family. Thi	88.63
PRK06067	234	flagellar accessory protein FlaH; Validated	88.61
COG4555	245	NatA ABC-type Na+ transport system, ATPase compone	88.45
PRK00080	328	ruvB Holliday junction DNA helicase RuvB; Reviewed	88.34
TIGR02881	261	spore_V_K stage V sporulation protein K. Members o	88.29
PRK10535	648	macrolide transporter ATP-binding /permease protei	88.29
COG0488	530	Uup ATPase components of ABC transporters with dup	88.28
PLN03073	718	ABC transporter F family; Provisional	88.27
PRK10416	318	signal recognition particle-docking protein FtsY;	88.14
TIGR01846	694	type_I_sec_HlyB type I secretion system ABC transp	88.12
PRK04301	317	radA DNA repair and recombination protein RadA; Va	88.04
COG1118	345	CysA ABC-type sulfate/molybdate transport systems,	87.98
PRK12289	352	GTPase RsgA; Reviewed	87.95
COG2884	223	FtsE Predicted ATPase involved in cell division [C	87.93
cd01122	271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	87.87
TIGR00630	924	uvra excinuclease ABC, A subunit. This family is b	87.86
PLN03025	319	replication factor C subunit; Provisional	87.85
PLN03046	460	D-glycerate 3-kinase; Provisional	87.83
PLN02348	395	phosphoribulokinase	87.68
PRK13342	413	recombination factor protein RarA; Reviewed	87.41
PRK08099	399	bifunctional DNA-binding transcriptional repressor	87.4
PLN02674	244	adenylate kinase	87.32
PF03215	519	Rad17: Rad17 cell cycle checkpoint protein	87.31
KOG2355	291	consensus Predicted ABC-type transport, ATPase com	87.28
TIGR01271	1490	CFTR_protein cystic fibrosis transmembrane conduct	87.26
PRK03003	472	GTP-binding protein Der; Reviewed	87.25
TIGR03877	237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	87.22
PRK05537	568	bifunctional sulfate adenylyltransferase subunit 1	87.21
TIGR02768	744	TraA_Ti Ti-type conjugative transfer relaxase TraA	87.16
PRK08154	309	anaerobic benzoate catabolism transcriptional regu	87.06
TIGR02928	365	orc1/cdc6 family replication initiation protein. M	87.06
KOG0962	1294	consensus DNA repair protein RAD50, ABC-type ATPas	86.97
COG1125	309	OpuBA ABC-type proline/glycine betaine transport s	86.77
PTZ00243	1560	ABC transporter; Provisional	86.74
COG4604	252	CeuD ABC-type enterochelin transport system, ATPas	86.67
TIGR00416	454	sms DNA repair protein RadA. The gene protuct code	86.66
PTZ00035	337	Rad51 protein; Provisional	86.64
PRK09866	741	hypothetical protein; Provisional	86.56
PRK00409	782	recombination and DNA strand exchange inhibitor pr	86.44
PLN02772	398	guanylate kinase	86.37
COG4619	223	ABC-type uncharacterized transport system, ATPase	86.35
TIGR02238	313	recomb_DMC1 meiotic recombinase Dmc1. This model d	86.26
PRK06851	367	hypothetical protein; Provisional	86.26
cd01849	155	YlqF_related_GTPase YlqF-related GTPases. These pr	86.1
PRK04863	1486	mukB cell division protein MukB; Provisional	86.07
TIGR03881	229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	86.0
PLN02748	468	tRNA dimethylallyltransferase	85.95
PRK05973	237	replicative DNA helicase; Provisional	85.82
TIGR01447	586	recD exodeoxyribonuclease V, alpha subunit. This f	85.78
TIGR02655	484	circ_KaiC circadian clock protein KaiC. Members of	85.76
COG1134	249	TagH ABC-type polysaccharide/polyol phosphate tran	85.73
PLN02796	347	D-glycerate 3-kinase	85.72
PRK14722	374	flhF flagellar biosynthesis regulator FlhF; Provis	85.65
PRK04328	249	hypothetical protein; Provisional	85.64
PLN03187	344	meiotic recombination protein DMC1 homolog; Provis	85.4
PRK04220	301	2-phosphoglycerate kinase; Provisional	85.39
TIGR01526	325	nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr	85.38
PRK09183	259	transposase/IS protein; Provisional	85.34
COG1162	301	Predicted GTPases [General function prediction onl	85.32
PRK10875	615	recD exonuclease V subunit alpha; Provisional	85.28
COG2805	353	PilT Tfp pilus assembly protein, pilus retraction	85.13
TIGR00064	272	ftsY signal recognition particle-docking protein F	85.0
COG4674	249	Uncharacterized ABC-type transport system, ATPase	84.99
cd01857	141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	84.8
PLN02318	656	phosphoribulokinase/uridine kinase	84.75
PF05496	233	RuvB_N: Holliday junction DNA helicase ruvB N-term	84.73
PRK14721	420	flhF flagellar biosynthesis regulator FlhF; Provis	84.72
COG1117	253	PstB ABC-type phosphate transport system, ATPase c	84.67
COG3451	796	VirB4 Type IV secretory pathway, VirB4 components	84.66
TIGR00957	1522	MRP_assoc_pro multi drug resistance-associated pro	84.39
TIGR02239	316	recomb_RAD51 DNA repair protein RAD51. This eukary	84.38
PLN03232	1495	ABC transporter C family member; Provisional	84.24
COG2262	411	HflX GTPases [General function prediction only]	84.22
COG1195	363	RecF Recombinational DNA repair ATPase (RecF pathw	84.12
TIGR03348	1169	VI_IcmF type VI secretion protein IcmF. Members of	84.11
PRK00349	943	uvrA excinuclease ABC subunit A; Reviewed	84.03
cd03286	218	ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS	83.97
PRK13853	789	type IV secretion system protein VirB4; Provisiona	83.72
PLN02459	261	probable adenylate kinase	83.55
TIGR01663	526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	83.43
PRK15494	339	era GTPase Era; Provisional	83.42
PRK13898	800	type IV secretion system ATPase VirB4; Provisional	83.34
PRK10536	262	hypothetical protein; Provisional	83.22
COG1101	263	PhnK ABC-type uncharacterized transport system, AT	83.21

>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism]

Probab=99.00  E-value=8.2e-11  Score=100.14  Aligned_cols=33  Identities=52%  Similarity=0.762  Sum_probs=30.5

Q ss_pred             cccccccCCCCCCCCceEEEecccCCCccCCCC
Q 033696           81 EDSDLLTKIPPDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        81 ~~s~~~~~~~~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +++++.+...++++|||||||||||||||||||
T Consensus        43 e~~~~~~~~~~~~rIPvtIITGyLGaGKtTLLn   75 (391)
T KOG2743|consen   43 EEEDVVTKSSLGARIPVTIITGYLGAGKTTLLN   75 (391)
T ss_pred             cccccccccCCCCccceEEEEecccCChHHHHH
Confidence            556888999999999999999999999999986

>TIGR00073 hypB hydrogenase accessory protein HypB

Probab=97.79  E-value=4.4e-06  Score=61.89  Aligned_cols=23  Identities=22%  Similarity=0.120  Sum_probs=20.3

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..+|++.++||+|||||||++
T Consensus        18 ~~~~~~~i~~~G~~gsGKTTli~   40 (207)
T TIGR00073        18 DKHGLVVLNFMSSPGSGKTTLIE   40 (207)
T ss_pred             hhcCcEEEEEECCCCCCHHHHHH
Confidence            34689999999999999999974

HypB is implicated in insertion of nickel into the large subunit of NiFe hydrogenases.

>COG3910 Predicted ATPase [General function prediction only]

Probab=96.77  E-value=0.00042  Score=56.57  Aligned_cols=21  Identities=52%  Similarity=0.564  Sum_probs=19.2

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      +=+-|||+|+|-.|+||+|||
T Consensus        34 eF~apIT~i~GENGsGKSTLL   54 (233)
T COG3910          34 EFRAPITFITGENGSGKSTLL   54 (233)
T ss_pred             cccCceEEEEcCCCccHHHHH
Confidence            457899999999999999997

>PF13555 AAA_29: P-loop containing region of AAA domain

Probab=96.73  E-value=0.00041  Score=45.76  Aligned_cols=17  Identities=53%  Similarity=0.520  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++|+|+|..||||||||
T Consensus        24 ~~tli~G~nGsGKSTll   40 (62)
T PF13555_consen   24 DVTLITGPNGSGKSTLL   40 (62)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            38999999999999986

>cd01878 HflX HflX subfamily

Probab=96.58  E-value=0.00055  Score=49.19  Aligned_cols=23  Identities=26%  Similarity=0.447  Sum_probs=20.5

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .++.+|.++|.|..|+|||||||
T Consensus        37 ~~~~~~~I~iiG~~g~GKStLl~   59 (204)
T cd01878          37 KRSGIPTVALVGYTNAGKSTLFN   59 (204)
T ss_pred             hhcCCCeEEEECCCCCCHHHHHH
Confidence            35778999999999999999985

A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily. The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear. HflX is widespread, but not universally represented in all three superkingdoms.

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion

Probab=96.56  E-value=0.00052  Score=51.39  Aligned_cols=17  Identities=41%  Similarity=0.558  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||||
T Consensus        23 ~~~l~G~nG~GKSTLl~   39 (176)
T cd03238          23 LVVVTGVSGSGKSTLVN   39 (176)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999985

Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.

>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals

Probab=96.54  E-value=0.00054  Score=52.40  Aligned_cols=17  Identities=29%  Similarity=0.223  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      +.-|.|.||||||++||
T Consensus        22 ~IgL~G~WGsGKSs~l~   38 (325)
T PF07693_consen   22 VIGLYGEWGSGKSSFLN   38 (325)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67799999999999975

Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [].

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes

Probab=96.50  E-value=0.00062  Score=51.25  Aligned_cols=18  Identities=39%  Similarity=0.244  Sum_probs=16.4

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =+++|||..|+||||||+
T Consensus        26 ~~~~ltGpNg~GKSTllr   43 (199)
T cd03283          26 NGILITGSNMSGKSTFLR   43 (199)
T ss_pred             cEEEEECCCCCChHHHHH
Confidence            589999999999999974

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes

Probab=96.44  E-value=0.00072  Score=49.89  Aligned_cols=18  Identities=28%  Similarity=0.278  Sum_probs=16.3

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -+++|||+.|+||||||+
T Consensus        29 ~~~~ltG~Ng~GKStll~   46 (200)
T cd03280          29 RVLVITGPNAGGKTVTLK   46 (200)
T ss_pred             eEEEEECCCCCChHHHHH
Confidence            589999999999999973

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, a

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch

Probab=96.37  E-value=0.00085  Score=49.45  Aligned_cols=18  Identities=33%  Similarity=0.170  Sum_probs=16.3

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =+++|||..|+||||||+
T Consensus        30 ~~~~l~G~Ng~GKStll~   47 (202)
T cd03243          30 RLLLITGPNMGGKSTYLR   47 (202)
T ss_pred             eEEEEECCCCCccHHHHH
Confidence            489999999999999974

Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota

Probab=96.14  E-value=0.0012  Score=48.08  Aligned_cols=18  Identities=39%  Similarity=0.348  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        28 ~~~~l~G~nGsGKSTLl~   45 (211)
T cd03225          28 EFVLIVGPNGSGKSTLLR   45 (211)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378999999999999974

The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota

Probab=96.11  E-value=0.0013  Score=48.05  Aligned_cols=18  Identities=33%  Similarity=0.366  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 e~~~i~G~nGsGKSTLl~   44 (205)
T cd03226          27 EIIALTGKNGAGKTTLAK   44 (205)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            388999999999999974

The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional

Probab=96.11  E-value=0.0014  Score=53.84  Aligned_cols=22  Identities=23%  Similarity=0.128  Sum_probs=20.0

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+++.++-|+|++||||||||+
T Consensus       101 ~~~~~~v~l~G~pGsGKTTLl~  122 (290)
T PRK10463        101 ARKQLVLNLVSSPGSGKTTLLT  122 (290)
T ss_pred             hcCCeEEEEECCCCCCHHHHHH
Confidence            5779999999999999999974

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance

Probab=96.11  E-value=0.0013  Score=47.99  Aligned_cols=18  Identities=28%  Similarity=0.176  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 ~~~~i~G~nGsGKSTLl~   44 (208)
T cd03268          27 EIYGFLGPNGAGKTTTMK   44 (208)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            478999999999999974

Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)

Probab=96.09  E-value=0.0013  Score=48.12  Aligned_cols=18  Identities=39%  Similarity=0.303  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        31 ~~~~l~G~nGsGKSTLl~   48 (218)
T cd03255          31 EFVAIVGPSGSGKSTLLN   48 (218)
T ss_pred             CEEEEEcCCCCCHHHHHH
Confidence            378999999999999974

They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein

Probab=96.06  E-value=0.0014  Score=48.08  Aligned_cols=18  Identities=28%  Similarity=0.375  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        30 e~~~i~G~nGsGKSTLl~   47 (216)
T TIGR00960        30 EMVFLVGHSGAGKSTFLK   47 (216)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity

Probab=96.03  E-value=0.0015  Score=47.76  Aligned_cols=17  Identities=29%  Similarity=0.214  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        28 ~~~i~G~nGsGKSTLl~   44 (210)
T cd03269          28 IFGLLGPNGAGKTTTIR   44 (210)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively

Probab=96.03  E-value=0.0015  Score=48.20  Aligned_cols=17  Identities=29%  Similarity=0.260  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~i~G~nGsGKSTLl~   48 (220)
T cd03293          32 FVALVGPSGCGKSTLLR   48 (220)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport

Probab=96.03  E-value=0.0015  Score=48.46  Aligned_cols=17  Identities=35%  Similarity=0.223  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        33 ~~~l~G~nGsGKSTLl~   49 (233)
T cd03258          33 IFGIIGRSGAGKSTLIR   49 (233)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin

Probab=96.01  E-value=0.0015  Score=48.14  Aligned_cols=18  Identities=28%  Similarity=0.196  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 e~~~i~G~nGsGKSTLl~   44 (220)
T cd03265          27 EIFGLLGPNGAGKTTTIK   44 (220)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules

Probab=96.00  E-value=0.0016  Score=48.55  Aligned_cols=18  Identities=39%  Similarity=0.290  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        27 e~~~l~G~nGsGKSTLl~   44 (235)
T cd03261          27 EILAIIGPSGSGKSTLLR   44 (235)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            368999999999999974

The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]

Probab=95.97  E-value=0.0017  Score=51.87  Aligned_cols=18  Identities=39%  Similarity=0.303  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =.+.|.|..|||||||||
T Consensus        32 e~vaI~GpSGSGKSTLLn   49 (226)
T COG1136          32 EFVAIVGPSGSGKSTLLN   49 (226)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999986

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system

Probab=95.96  E-value=0.0017  Score=48.14  Aligned_cols=17  Identities=29%  Similarity=0.268  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (241)
T cd03256          29 FVALIGPSGAGKSTLLR   45 (241)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup

Probab=95.95  E-value=0.0017  Score=47.55  Aligned_cols=17  Identities=29%  Similarity=0.202  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        28 ~~~i~G~nGsGKSTLl~   44 (213)
T cd03259          28 FLALLGPSGCGKTTLLR   44 (213)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group

Probab=95.95  E-value=0.0017  Score=47.02  Aligned_cols=17  Identities=41%  Similarity=0.311  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|+|..||||||||+
T Consensus        26 ~~~i~G~nGsGKSTLl~   42 (206)
T TIGR03608        26 MYAIIGESGSGKSTLLN   42 (206)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein

Probab=95.93  E-value=0.0018  Score=47.58  Aligned_cols=19  Identities=37%  Similarity=0.244  Sum_probs=16.5

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =-++.|.|..||||||||+
T Consensus        31 G~~~~i~G~nGsGKSTLl~   49 (221)
T TIGR02211        31 GEIVAIVGSSGSGKSTLLH   49 (221)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            3478999999999999974

This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.

>TIGR01978 sufC FeS assembly ATPase SufC

Probab=95.91  E-value=0.0019  Score=47.95  Aligned_cols=17  Identities=47%  Similarity=0.407  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        28 ~~~i~G~nGsGKSTLl~   44 (243)
T TIGR01978        28 IHAIMGPNGSGKSTLSK   44 (243)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78999999999999974

SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane

Probab=95.91  E-value=0.0018  Score=47.13  Aligned_cols=18  Identities=28%  Similarity=0.292  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        28 ~~~~i~G~nGsGKSTLl~   45 (214)
T cd03292          28 EFVFLVGPSGAGKSTLLK   45 (214)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.

>TIGR02673 FtsE cell division ATP-binding protein FtsE

Probab=95.90  E-value=0.0018  Score=47.26  Aligned_cols=17  Identities=35%  Similarity=0.335  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        30 ~~~l~G~nGsGKSTLl~   46 (214)
T TIGR02673        30 FLFLTGPSGAGKTTLLK   46 (214)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)

Probab=95.90  E-value=0.0018  Score=47.40  Aligned_cols=18  Identities=33%  Similarity=0.294  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        32 e~~~i~G~nGsGKSTLl~   49 (228)
T cd03257          32 ETLGLVGESGSGKSTLAR   49 (228)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake

Probab=95.89  E-value=0.0019  Score=47.27  Aligned_cols=17  Identities=35%  Similarity=0.317  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|+|..||||||||+
T Consensus        33 ~~~i~G~nGsGKSTLl~   49 (218)
T cd03266          33 VTGLLGPNGAGKTTTLR   49 (218)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999974

NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids

Probab=95.89  E-value=0.0019  Score=47.32  Aligned_cols=18  Identities=28%  Similarity=0.250  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 e~~~i~G~nGsGKSTLl~   44 (222)
T cd03224          27 EIVALLGRNGAGKTTLLK   44 (222)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            478999999999999974

The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.

>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport

Probab=95.87  E-value=0.0021  Score=46.13  Aligned_cols=17  Identities=59%  Similarity=0.538  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -+++|||.+||||||+|
T Consensus        22 ~~~~i~G~NgsGKS~~l   38 (162)
T cd03227          22 SLTIITGPNGSGKSTIL   38 (162)
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            48999999999999986

These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2). No known transmembrane proteins or domains are associated with these proteins.

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters

Probab=95.85  E-value=0.002  Score=47.18  Aligned_cols=18  Identities=33%  Similarity=0.241  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        26 e~~~l~G~nGsGKSTLl~   43 (213)
T cd03235          26 EFLAIVGPNGAGKSTLLK   43 (213)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378999999999999974

This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional

Probab=95.83  E-value=0.002  Score=47.59  Aligned_cols=18  Identities=39%  Similarity=0.361  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..|+||||||+
T Consensus        37 e~~~i~G~nGsGKSTLl~   54 (228)
T PRK10584         37 ETIALIGESGSGKSTLLA   54 (228)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            488999999999999974

>PRK14242 phosphate transporter ATP-binding protein; Provisional

Probab=95.81  E-value=0.0021  Score=48.35  Aligned_cols=18  Identities=33%  Similarity=0.307  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        33 e~~~i~G~nGsGKSTLl~   50 (253)
T PRK14242         33 QVTALIGPSGCGKSTFLR   50 (253)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional

Probab=95.81  E-value=0.0021  Score=47.92  Aligned_cols=17  Identities=41%  Similarity=0.360  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|+|..||||||||+
T Consensus        37 ~~~l~G~nGsGKSTLl~   53 (233)
T PRK11629         37 MMAIVGSSGSGKSTLLH   53 (233)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein

Probab=95.80  E-value=0.0021  Score=47.76  Aligned_cols=17  Identities=35%  Similarity=0.292  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        30 ~~~l~G~nGsGKSTLl~   46 (243)
T TIGR02315        30 FVAIIGPSGAGKSTLLR   46 (243)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient

Probab=95.77  E-value=0.0022  Score=47.35  Aligned_cols=18  Identities=33%  Similarity=0.300  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++-|.|..||||||||+
T Consensus        27 e~~~i~G~nGsGKSTLl~   44 (227)
T cd03260          27 EITALIGPSGCGKSTLLR   44 (227)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds

Probab=95.76  E-value=0.0023  Score=46.96  Aligned_cols=17  Identities=29%  Similarity=0.284  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        30 ~~~i~G~nGsGKSTLl~   46 (220)
T cd03263          30 IFGLLGHNGAGKTTTLK   46 (220)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component

Probab=95.76  E-value=0.002  Score=47.06  Aligned_cols=17  Identities=29%  Similarity=0.165  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        27 ~~~i~G~nGsGKSTLl~   43 (211)
T cd03264          27 MYGLLGPNGAGKTTLMR   43 (211)
T ss_pred             cEEEECCCCCCHHHHHH
Confidence            89999999999999974

The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine

Probab=95.75  E-value=0.0023  Score=47.42  Aligned_cols=18  Identities=28%  Similarity=0.167  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 e~~~l~G~nGsGKSTLl~   44 (236)
T cd03219          27 EIHGLIGPNGAGKTTLFN   44 (236)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C

Probab=95.75  E-value=0.0024  Score=46.64  Aligned_cols=18  Identities=33%  Similarity=0.403  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..|+||||||+
T Consensus        32 ~~~~i~G~nG~GKSTLl~   49 (204)
T cd03250          32 ELVAIVGPVGSGKSSLLS   49 (204)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            488999999999999974

This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends

Probab=95.73  E-value=0.0029  Score=47.16  Aligned_cols=19  Identities=32%  Similarity=0.247  Sum_probs=16.7

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =.++.|.|..||||||||+
T Consensus        28 ~~~~~i~G~NGsGKSTll~   46 (213)
T cd03279          28 NGLFLICGPTGAGKSTILD   46 (213)
T ss_pred             cCEEEEECCCCCCHHHHHH
Confidence            3589999999999999974

They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB

Probab=95.73  E-value=0.0023  Score=46.99  Aligned_cols=20  Identities=40%  Similarity=0.328  Sum_probs=17.5

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+ -++.|.|..||||||||+
T Consensus        22 ~~-e~~~i~G~nGsGKSTLl~   41 (214)
T cd03297          22 NE-EVTGIFGASGAGKSTLLR   41 (214)
T ss_pred             cc-eeEEEECCCCCCHHHHHH
Confidence            45 789999999999999974

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids

Probab=95.73  E-value=0.0024  Score=47.21  Aligned_cols=17  Identities=29%  Similarity=0.206  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        28 ~~~l~G~nGsGKSTLl~   44 (232)
T cd03218          28 IVGLLGPNGAGKTTTFY   44 (232)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK

Probab=95.72  E-value=0.0024  Score=46.62  Aligned_cols=18  Identities=28%  Similarity=0.338  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 e~~~l~G~nGsGKSTLl~   44 (213)
T cd03301          27 EFVVLLGPSGCGKTTTLR   44 (213)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            368899999999999974

ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A

Probab=95.72  E-value=0.0019  Score=44.71  Aligned_cols=22  Identities=27%  Similarity=0.271  Sum_probs=13.3

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...-++++|+|.-|+|||+||+
T Consensus        21 ~~~~~~~ll~G~~G~GKT~ll~   42 (185)
T PF13191_consen   21 SGSPRNLLLTGESGSGKTSLLR   42 (185)
T ss_dssp             S-----EEE-B-TTSSHHHHHH
T ss_pred             cCCCcEEEEECCCCCCHHHHHH
Confidence            3445899999999999999874

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein

Probab=95.70  E-value=0.0025  Score=47.05  Aligned_cols=17  Identities=35%  Similarity=0.380  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        31 ~~~i~G~nGsGKSTLl~   47 (229)
T cd03254          31 TVAIVGPTGAGKTTLIN   47 (229)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL

Probab=95.70  E-value=0.0025  Score=47.02  Aligned_cols=18  Identities=28%  Similarity=0.338  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        35 e~~~l~G~nGsGKSTLl~   52 (224)
T TIGR02324        35 ECVALSGPSGAGKSTLLK   52 (224)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins

Probab=95.69  E-value=0.0025  Score=47.17  Aligned_cols=18  Identities=33%  Similarity=0.355  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        29 e~~~i~G~nGsGKSTLl~   46 (234)
T cd03251          29 ETVALVGPSGSGKSTLVN   46 (234)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively

Probab=95.69  E-value=0.0025  Score=46.39  Aligned_cols=18  Identities=39%  Similarity=0.403  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 ~~~~l~G~nGsGKSTLl~   44 (213)
T cd03262          27 EVVVIIGPSGSGKSTLLR   44 (213)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378999999999999974

Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.68  E-value=0.0025  Score=46.44  Aligned_cols=17  Identities=35%  Similarity=0.358  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        28 ~~~l~G~nGsGKSTLl~   44 (195)
T PRK13541         28 ITYIKGANGCGKSSLLR   44 (195)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            88999999999999974

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria

Probab=95.66  E-value=0.0026  Score=47.13  Aligned_cols=18  Identities=39%  Similarity=0.329  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        28 e~~~l~G~nGsGKSTLl~   45 (236)
T cd03253          28 KKVAIVGPSGSGKSTILR   45 (236)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=95.64  E-value=0.0026  Score=47.29  Aligned_cols=16  Identities=31%  Similarity=0.382  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.|.|..||||||||
T Consensus        25 ~~~i~GpNGsGKStll   40 (243)
T cd03272          25 HNVVVGRNGSGKSNFF   40 (243)
T ss_pred             cEEEECCCCCCHHHHH
Confidence            9999999999999996

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth

Probab=95.64  E-value=0.0027  Score=45.01  Aligned_cols=18  Identities=28%  Similarity=0.202  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|+|..|+|||||++
T Consensus        27 e~~~i~G~nGsGKStLl~   44 (144)
T cd03221          27 DRIGLVGRNGAGKSTLLK   44 (144)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional

Probab=95.63  E-value=0.0028  Score=47.35  Aligned_cols=18  Identities=39%  Similarity=0.377  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        34 e~~~i~G~nGsGKSTLl~   51 (225)
T PRK10247         34 EFKLITGPSGCGKSTLLK   51 (225)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP

Probab=95.62  E-value=0.0028  Score=46.37  Aligned_cols=18  Identities=44%  Similarity=0.377  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        25 e~~~l~G~nGsGKSTLl~   42 (211)
T cd03298          25 EITAIVGPSGSGKSTLLN   42 (211)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)

Probab=95.62  E-value=0.0028  Score=45.90  Aligned_cols=18  Identities=22%  Similarity=0.407  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 ~~~~i~G~nGsGKSTLl~   44 (182)
T cd03215          27 EIVGIAGLVGNGQTELAE   44 (182)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            478999999999999974

The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases

Probab=95.61  E-value=0.0028  Score=46.44  Aligned_cols=17  Identities=41%  Similarity=0.438  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .++|.|..|||||||++
T Consensus        27 ~i~I~G~tGSGKTTll~   43 (186)
T cd01130          27 NILISGGTGSGKTTLLN   43 (186)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68999999999999864

The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional

Probab=95.58  E-value=0.0029  Score=48.56  Aligned_cols=17  Identities=29%  Similarity=0.311  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (255)
T PRK11248         29 LLVVLGPSGCGKTTLLN   45 (255)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis

Probab=95.58  E-value=0.0029  Score=45.51  Aligned_cols=17  Identities=35%  Similarity=0.321  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        30 ~~~i~G~nGsGKStLl~   46 (178)
T cd03247          30 KIALLGRSGSGKSTLLQ   46 (178)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK

Probab=95.57  E-value=0.003  Score=47.55  Aligned_cols=18  Identities=39%  Similarity=0.268  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        30 e~~~i~G~nGsGKSTLl~   47 (253)
T TIGR02323        30 EVLGIVGESGSGKSTLLG   47 (253)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.55  E-value=0.0031  Score=47.65  Aligned_cols=18  Identities=33%  Similarity=0.301  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        34 e~~~i~G~nGsGKSTLl~   51 (254)
T PRK14273         34 SITALIGPSGCGKSTFLR   51 (254)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.55  E-value=0.003  Score=47.93  Aligned_cols=17  Identities=41%  Similarity=0.362  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        40 ~~~l~G~nGsGKSTLl~   56 (259)
T PRK14274         40 VTAIIGPSGCGKSTFIK   56 (259)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68999999999999974

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake

Probab=95.55  E-value=0.0031  Score=47.56  Aligned_cols=18  Identities=28%  Similarity=0.211  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        48 e~~~i~G~NGsGKSTLl~   65 (236)
T cd03267          48 EIVGFIGPNGAGKTTTLK   65 (236)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional

Probab=95.55  E-value=0.003  Score=47.20  Aligned_cols=18  Identities=22%  Similarity=0.314  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        29 e~~~i~G~nGsGKSTLl~   46 (242)
T PRK11124         29 ETLVLLGPSGAGKSSLLR   46 (242)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily

Probab=95.55  E-value=0.0031  Score=46.99  Aligned_cols=20  Identities=40%  Similarity=0.418  Sum_probs=17.0

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +-++.+|+|..|+|||||++
T Consensus        42 ~~~~~~l~G~~G~GKTtl~~   61 (269)
T TIGR03015        42 REGFILITGEVGAGKTTLIR   61 (269)
T ss_pred             CCCEEEEEcCCCCCHHHHHH
Confidence            34689999999999999863

Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE

Probab=95.55  E-value=0.0031  Score=46.71  Aligned_cols=18  Identities=33%  Similarity=0.274  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        27 e~~~l~G~nGsGKSTLl~   44 (230)
T TIGR03410        27 EVTCVLGRNGVGKTTLLK   44 (230)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378999999999999974

Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome

Probab=95.54  E-value=0.0031  Score=45.43  Aligned_cols=17  Identities=35%  Similarity=0.405  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|+|..||||||||+
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (166)
T cd03223          29 RLLITGPSGTGKSSLFR   45 (166)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68999999999999974

The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains

Probab=95.53  E-value=0.0033  Score=47.16  Aligned_cols=18  Identities=44%  Similarity=0.573  Sum_probs=16.3

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      +++.|.|..|+||||||+
T Consensus        23 g~~~i~G~NGsGKTTLl~   40 (204)
T cd03240          23 PLTLIVGQNGAGKTTIIE   40 (204)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            399999999999999973

The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.52  E-value=0.0032  Score=48.47  Aligned_cols=17  Identities=41%  Similarity=0.413  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~l~G~nGsGKSTLl~   51 (280)
T PRK13649         35 YTAFIGHTGSGKSTIMQ   51 (280)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein

Probab=95.52  E-value=0.0032  Score=47.38  Aligned_cols=17  Identities=35%  Similarity=0.345  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (247)
T TIGR00972        29 VTALIGPSGCGKSTLLR   45 (247)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA

Probab=95.52  E-value=0.0032  Score=45.89  Aligned_cols=20  Identities=35%  Similarity=0.160  Sum_probs=16.8

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +=-++.|.|..||||||||+
T Consensus        25 ~Ge~~~i~G~nGsGKSTLl~   44 (198)
T TIGR01189        25 AGEALQVTGPNGIGKTTLLR   44 (198)
T ss_pred             CCcEEEEECCCCCCHHHHHH
Confidence            34578899999999999974

This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.

>PRK10908 cell division protein FtsE; Provisional

Probab=95.52  E-value=0.0032  Score=46.51  Aligned_cols=19  Identities=32%  Similarity=0.345  Sum_probs=16.4

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =-++.|.|..||||||||+
T Consensus        28 Ge~~~i~G~nGsGKSTLl~   46 (222)
T PRK10908         28 GEMAFLTGHSGAGKSTLLK   46 (222)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            3478899999999999974

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import

Probab=95.51  E-value=0.0032  Score=47.12  Aligned_cols=18  Identities=33%  Similarity=0.265  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        29 e~~~i~G~nGsGKSTLl~   46 (239)
T cd03296          29 ELVALLGPSGSGKTTLLR   46 (239)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            368899999999999974

Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.51  E-value=0.0032  Score=47.27  Aligned_cols=17  Identities=41%  Similarity=0.368  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~~~i~G~nGsGKSTLl~   47 (250)
T PRK14247         31 ITALMGPSGSGKSTLLR   47 (250)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>TIGR00150 HI0065_YjeE ATPase, YjeE family

Probab=95.49  E-value=0.0032  Score=46.27  Aligned_cols=17  Identities=35%  Similarity=0.532  Sum_probs=15.2

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .++.+.|.+|+|||||.
T Consensus        23 ~~i~l~G~lGaGKTtl~   39 (133)
T TIGR00150        23 TVVLLKGDLGAGKTTLV   39 (133)
T ss_pred             CEEEEEcCCCCCHHHHH
Confidence            37899999999999984

Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain

Probab=95.49  E-value=0.0033  Score=45.19  Aligned_cols=18  Identities=39%  Similarity=0.385  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|+||||||+
T Consensus        29 e~~~i~G~nGsGKStLl~   46 (173)
T cd03246          29 ESLAIIGPSGSGKSTLAR   46 (173)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            488999999999999974

They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export

Probab=95.48  E-value=0.0033  Score=45.08  Aligned_cols=18  Identities=39%  Similarity=0.337  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        29 ~~~~l~G~nGsGKstLl~   46 (171)
T cd03228          29 EKVAIVGPSGSGKSTLLK   46 (171)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1

Probab=95.47  E-value=0.0033  Score=46.77  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        30 e~~~l~G~nGsGKSTLl~   47 (238)
T cd03249          30 KTVALVGSSGCGKSTVVS   47 (238)
T ss_pred             CEEEEEeCCCCCHHHHHH
Confidence            478999999999999974

In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes

Probab=95.44  E-value=0.0037  Score=47.55  Aligned_cols=19  Identities=32%  Similarity=0.223  Sum_probs=16.8

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+.+|||..|+||||||+
T Consensus        29 ~~~~~itGpNg~GKStlLk   47 (213)
T cd03281          29 PSIMVITGPNSSGKSVYLK   47 (213)
T ss_pred             ceEEEEECCCCCChHHHHH
Confidence            3689999999999999974

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E

Probab=95.44  E-value=0.0035  Score=46.61  Aligned_cols=18  Identities=39%  Similarity=0.355  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        29 e~~~i~G~nGsGKSTLl~   46 (237)
T cd03252          29 EVVGIVGRSGSGKSTLTK   46 (237)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378999999999999974

coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.44  E-value=0.0035  Score=46.48  Aligned_cols=17  Identities=35%  Similarity=0.384  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        39 ~~~i~G~nGsGKSTLl~   55 (214)
T PRK13543         39 ALLVQGDNGAGKTTLLR   55 (214)
T ss_pred             EEEEEcCCCCCHHHHHH
Confidence            68899999999999974

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters

Probab=95.44  E-value=0.0035  Score=45.97  Aligned_cols=18  Identities=39%  Similarity=0.409  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        31 ~~~~i~G~nGsGKSTLl~   48 (220)
T cd03245          31 EKVAIIGRVGSGKSTLLK   48 (220)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.43  E-value=0.0035  Score=46.22  Aligned_cols=18  Identities=44%  Similarity=0.433  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..|+||||||+
T Consensus        29 e~~~i~G~nGsGKSTLl~   46 (207)
T PRK13539         29 EALVLTGPNGSGKTTLLR   46 (207)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters

Probab=95.43  E-value=0.0037  Score=45.77  Aligned_cols=18  Identities=33%  Similarity=0.318  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        34 e~~~l~G~nGsGKSTLl~   51 (192)
T cd03232          34 TLTALMGESGAGKTTLLD   51 (192)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            478999999999999974

PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment

Probab=95.43  E-value=0.0036  Score=45.20  Aligned_cols=17  Identities=35%  Similarity=0.305  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        28 ~~~i~G~nGsGKSTLl~   44 (178)
T cd03229          28 IVALLGPSGSGKSTLLR   44 (178)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999964

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional

Probab=95.42  E-value=0.0036  Score=46.80  Aligned_cols=18  Identities=28%  Similarity=0.185  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        30 e~~~l~G~nGsGKSTLl~   47 (241)
T PRK10895         30 EIVGLLGPNGAGKTTTFY   47 (241)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            368899999999999974

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional

Probab=95.42  E-value=0.0036  Score=47.69  Aligned_cols=18  Identities=33%  Similarity=0.289  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        40 e~~~i~G~nGsGKSTLl~   57 (260)
T PRK10744         40 QVTAFIGPSGCGKSTLLR   57 (260)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional

Probab=95.41  E-value=0.0037  Score=46.86  Aligned_cols=17  Identities=41%  Similarity=0.352  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~~~i~G~nGsGKSTLl~   47 (250)
T PRK11264         31 VVAIIGPSGSGKTTLLR   47 (250)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.41  E-value=0.0037  Score=48.60  Aligned_cols=17  Identities=41%  Similarity=0.464  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        39 ~~~l~G~nGsGKSTLl~   55 (289)
T PRK13645         39 VTCVIGTTGSGKSTMIQ   55 (289)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.41  E-value=0.0037  Score=48.18  Aligned_cols=18  Identities=44%  Similarity=0.409  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        36 e~~~l~G~nGsGKSTLl~   53 (271)
T PRK13632         36 EYVAILGHNGSGKSTISK   53 (271)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK14241 phosphate transporter ATP-binding protein; Provisional

Probab=95.41  E-value=0.0037  Score=47.46  Aligned_cols=18  Identities=33%  Similarity=0.320  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        31 e~~~i~G~nGsGKSTLl~   48 (258)
T PRK14241         31 SVTAFIGPSGCGKSTVLR   48 (258)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            368899999999999974

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.40  E-value=0.0037  Score=48.02  Aligned_cols=17  Identities=35%  Similarity=0.280  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (271)
T PRK13638         29 VTGLVGANGCGKSTLFM   45 (271)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.40  E-value=0.0037  Score=45.90  Aligned_cols=18  Identities=28%  Similarity=0.233  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        28 e~~~l~G~nGsGKSTLl~   45 (204)
T PRK13538         28 ELVQIEGPNGAGKTSLLR   45 (204)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            488999999999999964

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system

Probab=95.39  E-value=0.0038  Score=46.69  Aligned_cols=17  Identities=29%  Similarity=0.257  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (236)
T TIGR03864        29 FVALLGPNGAGKSTLFS   45 (236)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed

Probab=95.38  E-value=0.0038  Score=46.63  Aligned_cols=18  Identities=39%  Similarity=0.403  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        28 e~~~l~G~nGsGKSTLl~   45 (240)
T PRK09493         28 EVVVIIGPSGSGKSTLLR   45 (240)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]

Probab=95.36  E-value=0.0051  Score=55.59  Aligned_cols=21  Identities=24%  Similarity=0.099  Sum_probs=19.3

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      ...-||++|.|..||||||||
T Consensus        22 ~f~~gi~lI~G~nGsGKSSIl   42 (908)
T COG0419          22 LFDSGIFLIVGPNGAGKSSIL   42 (908)
T ss_pred             cCCCCeEEEECCCCCcHHHHH
Confidence            567899999999999999997

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea

Probab=95.36  E-value=0.0039  Score=48.11  Aligned_cols=18  Identities=39%  Similarity=0.453  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        51 e~~~l~G~nGsGKSTLl~   68 (269)
T cd03294          51 EIFVIMGLSGSGKSTLLR   68 (269)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.36  E-value=0.0039  Score=47.08  Aligned_cols=17  Identities=35%  Similarity=0.345  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        34 ~~~i~G~nGsGKSTLl~   50 (253)
T PRK14261         34 VTALIGPSGCGKSTLLR   50 (253)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68999999999999974

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C

Probab=95.35  E-value=0.0039  Score=45.75  Aligned_cols=17  Identities=35%  Similarity=0.286  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~i~G~nGsGKSTLl~   48 (221)
T cd03244          32 KVGIVGRTGSGKSSLLL   48 (221)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.35  E-value=0.0039  Score=45.63  Aligned_cols=19  Identities=26%  Similarity=0.116  Sum_probs=16.3

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =-++.|.|..|+||||||+
T Consensus        27 Ge~~~l~G~nGsGKSTLl~   45 (200)
T PRK13540         27 GGLLHLKGSNGAGKTTLLK   45 (200)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            3478899999999999974

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional

Probab=95.35  E-value=0.0039  Score=47.95  Aligned_cols=18  Identities=39%  Similarity=0.278  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        34 e~~~i~G~nGsGKSTLl~   51 (269)
T PRK11831         34 KITAIMGPSGIGKTTLLR   51 (269)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional

Probab=95.35  E-value=0.0041  Score=46.72  Aligned_cols=18  Identities=28%  Similarity=0.243  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        32 e~~~l~G~nGsGKSTLl~   49 (255)
T PRK11300         32 EIVSLIGPNGAGKTTVFN   49 (255)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            478899999999999974

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors

Probab=95.34  E-value=0.004  Score=46.23  Aligned_cols=17  Identities=41%  Similarity=0.352  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|+|..||||||||+
T Consensus        35 ~~~l~G~nGsGKSTLlk   51 (226)
T cd03234          35 VMAILGSSGSGKTTLLD   51 (226)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.34  E-value=0.004  Score=46.78  Aligned_cols=17  Identities=41%  Similarity=0.343  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        31 ~~~i~G~nGsGKSTLl~   47 (250)
T PRK14262         31 ITAIIGPSGCGKTTLLR   47 (250)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.33  E-value=0.004  Score=46.87  Aligned_cols=17  Identities=29%  Similarity=0.253  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        32 ~~~l~G~nGsGKSTLl~   48 (253)
T PRK14267         32 VFALMGPSGCGKSTLLR   48 (253)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK03695 vitamin B12-transporter ATPase; Provisional

Probab=95.33  E-value=0.004  Score=47.37  Aligned_cols=17  Identities=35%  Similarity=0.298  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        24 i~~l~G~nGsGKSTLl~   40 (248)
T PRK03695         24 ILHLVGPNGAGKSTLLA   40 (248)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78999999999999974

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.32  E-value=0.0041  Score=46.88  Aligned_cols=18  Identities=28%  Similarity=0.239  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        30 e~~~i~G~nGsGKSTLl~   47 (250)
T PRK14245         30 SVVAFIGPSGCGKSTFLR   47 (250)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity

Probab=95.32  E-value=0.0041  Score=44.72  Aligned_cols=17  Identities=29%  Similarity=0.159  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        28 ~~~i~G~nGsGKStLl~   44 (173)
T cd03230          28 IYGLLGPNGAGKTTLIK   44 (173)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14239 phosphate transporter ATP-binding protein; Provisional

Probab=95.32  E-value=0.0041  Score=46.67  Aligned_cols=17  Identities=41%  Similarity=0.368  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        33 ~~~i~G~nGsGKSTLl~   49 (252)
T PRK14239         33 ITALIGPSGSGKSTLLR   49 (252)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.32  E-value=0.0041  Score=46.71  Aligned_cols=17  Identities=35%  Similarity=0.345  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~~~i~G~nGsGKSTLl~   47 (249)
T PRK14253         31 VTALIGPSGCGKSTLLR   47 (249)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.31  E-value=0.0041  Score=46.88  Aligned_cols=18  Identities=33%  Similarity=0.311  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        29 e~~~i~G~nGsGKSTLl~   46 (246)
T PRK14269         29 KITALIGASGCGKSTFLR   46 (246)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)

Probab=95.31  E-value=0.0041  Score=44.67  Aligned_cols=19  Identities=26%  Similarity=0.176  Sum_probs=16.5

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =-++.|.|..|+||||||+
T Consensus        26 Ge~~~l~G~nGsGKSTLl~   44 (163)
T cd03216          26 GEVHALLGENGAGKSTLMK   44 (163)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            3478999999999999974

The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.

>PF13245 AAA_19: Part of AAA domain

Probab=95.31  E-value=0.0052  Score=40.66  Aligned_cols=18  Identities=33%  Similarity=0.517  Sum_probs=15.4

Q ss_pred             CCceEEEecccCCCccCC
Q 033696           94 RIPATIITGFLGSGKNTG  111 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTL  111 (113)
                      +=|+.||.|..|+|||++
T Consensus         9 ~~~~~vv~g~pGtGKT~~   26 (76)
T PF13245_consen    9 GSPLFVVQGPPGTGKTTT   26 (76)
T ss_pred             hCCeEEEECCCCCCHHHH
Confidence            347899999999999964

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment

Probab=95.30  E-value=0.0042  Score=46.60  Aligned_cols=17  Identities=35%  Similarity=0.415  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (242)
T cd03295          29 FLVLIGPSGSGKTTTMK   45 (242)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.29  E-value=0.0042  Score=46.86  Aligned_cols=18  Identities=39%  Similarity=0.375  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        31 e~~~i~G~nGsGKSTLl~   48 (252)
T PRK14256         31 SVTAIIGPSGCGKSTVLR   48 (252)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            368899999999999974

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.28  E-value=0.0043  Score=47.48  Aligned_cols=17  Identities=35%  Similarity=0.329  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        49 ~~~i~G~nGsGKSTLl~   65 (268)
T PRK14248         49 VTALIGPSGCGKSTFLR   65 (268)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor

Probab=95.27  E-value=0.0043  Score=47.89  Aligned_cols=18  Identities=33%  Similarity=0.135  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        26 e~~~i~G~NGsGKSTLlk   43 (246)
T cd03237          26 EVIGILGPNGIGKTTFIK   43 (246)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters

Probab=95.27  E-value=0.0043  Score=45.88  Aligned_cols=17  Identities=29%  Similarity=0.278  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~i~G~nGsGKSTLl~   51 (202)
T cd03233          35 MVLVLGRPGSGCSTLLK   51 (202)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            88999999999999974

PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules

Probab=95.27  E-value=0.0043  Score=43.55  Aligned_cols=18  Identities=33%  Similarity=0.287  Sum_probs=16.3

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .++.|+|..|+||||||+
T Consensus        26 ~~~~i~G~nGsGKStll~   43 (157)
T cd00267          26 EIVALVGPNGSGKSTLLR   43 (157)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            589999999999999963

The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit

Probab=95.27  E-value=0.0043  Score=45.86  Aligned_cols=19  Identities=26%  Similarity=0.118  Sum_probs=16.5

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =-++.|.|..|+||||||+
T Consensus        26 Ge~~~i~G~nGsGKSTLl~   44 (223)
T TIGR03740        26 NSVYGLLGPNGAGKSTLLK   44 (223)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            3478999999999999974

Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules

Probab=95.27  E-value=0.0043  Score=45.81  Aligned_cols=18  Identities=44%  Similarity=0.462  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        41 e~~~i~G~nGsGKSTLl~   58 (226)
T cd03248          41 EVTALVGPSGSGKSTVVA   58 (226)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378999999999999974

Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.

>CHL00131 ycf16 sulfate ABC transporter protein; Validated

Probab=95.26  E-value=0.0043  Score=46.52  Aligned_cols=18  Identities=44%  Similarity=0.375  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        34 e~~~i~G~nGsGKSTLl~   51 (252)
T CHL00131         34 EIHAIMGPNGSGKSTLSK   51 (252)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            478899999999999974

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD

Probab=95.24  E-value=0.0044  Score=46.21  Aligned_cols=17  Identities=35%  Similarity=0.397  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        30 ~~~l~G~nGsGKSTLl~   46 (242)
T TIGR03411        30 LRVIIGPNGAGKTTMMD   46 (242)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.24  E-value=0.0045  Score=46.55  Aligned_cols=17  Identities=35%  Similarity=0.303  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|+|..||||||||+
T Consensus        32 ~~~i~G~nGsGKSTLl~   48 (251)
T PRK14251         32 LTALIGPSGCGKSTFLR   48 (251)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.24  E-value=0.0045  Score=46.68  Aligned_cols=18  Identities=33%  Similarity=0.283  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        31 e~~~i~G~nGsGKSTLl~   48 (251)
T PRK14270         31 KITALIGPSGCGKSTFLR   48 (251)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.21  E-value=0.0046  Score=47.05  Aligned_cols=17  Identities=35%  Similarity=0.335  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        40 ~~~i~G~nGsGKSTLl~   56 (258)
T PRK14268         40 VTALIGPSGCGKSTFIR   56 (258)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=95.21  E-value=0.0059  Score=46.58  Aligned_cols=17  Identities=41%  Similarity=0.307  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|.|..||||||||
T Consensus        23 ~~~~i~G~NGsGKStll   39 (247)
T cd03275          23 RFTCIIGPNGSGKSNLM   39 (247)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            59999999999999996

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for

>PRK14235 phosphate transporter ATP-binding protein; Provisional

Probab=95.19  E-value=0.0047  Score=47.47  Aligned_cols=18  Identities=33%  Similarity=0.279  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        46 e~~~i~G~nGsGKSTLl~   63 (267)
T PRK14235         46 TVTAFIGPSGCGKSTFLR   63 (267)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            468899999999999974

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional

Probab=95.18  E-value=0.0048  Score=46.76  Aligned_cols=18  Identities=33%  Similarity=0.285  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        29 e~~~l~G~nGsGKSTLl~   46 (255)
T PRK11231         29 KITALIGPNGCGKSTLLK   46 (255)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            478899999999999974

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids

Probab=95.18  E-value=0.0043  Score=46.49  Aligned_cols=18  Identities=33%  Similarity=0.340  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        26 e~~~l~G~nGsGKSTLl~   43 (177)
T cd03222          26 EVIGIVGPNGTGKTTAVK   43 (177)
T ss_pred             CEEEEECCCCChHHHHHH
Confidence            488999999999999974

RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.18  E-value=0.0048  Score=47.37  Aligned_cols=18  Identities=44%  Similarity=0.420  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        36 e~~~I~G~nGsGKSTLl~   53 (269)
T PRK13648         36 QWTSIVGHNGSGKSTIAK   53 (269)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.18  E-value=0.0048  Score=47.85  Aligned_cols=17  Identities=29%  Similarity=0.231  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        48 ~~~IiG~nGsGKSTLl~   64 (274)
T PRK14265         48 IIAFIGPSGCGKSTLLR   64 (274)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional

Probab=95.18  E-value=0.0048  Score=47.91  Aligned_cols=18  Identities=28%  Similarity=0.259  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        39 e~~~I~G~NGsGKSTLlk   56 (257)
T PRK11247         39 QFVAVVGRSGCGKSTLLR   56 (257)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein

Probab=95.17  E-value=0.0049  Score=46.74  Aligned_cols=17  Identities=41%  Similarity=0.257  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (256)
T TIGR03873        29 LTGLLGPNGSGKSTLLR   45 (256)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional

Probab=95.16  E-value=0.0048  Score=45.99  Aligned_cols=17  Identities=29%  Similarity=0.327  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        33 ~~~i~G~nGsGKSTLl~   49 (237)
T PRK11614         33 IVTLIGANGAGKTTLLG   49 (237)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.14  E-value=0.005  Score=46.32  Aligned_cols=17  Identities=35%  Similarity=0.335  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|+|..||||||||+
T Consensus        33 ~~~l~G~nGsGKSTLl~   49 (252)
T PRK14255         33 ITALIGPSGCGKSTYLR   49 (252)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>cd03290 ABCC_SUR1_N The SUR domain 1

Probab=95.14  E-value=0.005  Score=45.38  Aligned_cols=18  Identities=33%  Similarity=0.457  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        28 e~~~i~G~nGsGKSTLl~   45 (218)
T cd03290          28 QLTMIVGQVGCGKSSLLL   45 (218)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            488999999999999974

The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.13  E-value=0.005  Score=46.41  Aligned_cols=17  Identities=41%  Similarity=0.350  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~i~G~nGsGKSTLl~   48 (251)
T PRK14249         32 ITAIIGPSGCGKSTLLR   48 (251)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea

Probab=95.13  E-value=0.0051  Score=44.48  Aligned_cols=19  Identities=32%  Similarity=0.111  Sum_probs=16.3

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =-++.|.|..||||||||+
T Consensus        25 G~~~~l~G~nGsGKStLl~   43 (180)
T cd03214          25 GEIVGILGPNGAGKSTLLK   43 (180)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            3478999999999999964

Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein

Probab=95.13  E-value=0.005  Score=45.33  Aligned_cols=18  Identities=33%  Similarity=0.300  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        25 e~~~i~G~nGsGKSTLl~   42 (213)
T TIGR01277        25 EIVAIMGPSGAGKSTLLN   42 (213)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed

Probab=95.12  E-value=0.005  Score=45.92  Aligned_cols=18  Identities=50%  Similarity=0.444  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        28 e~~~i~G~nGsGKSTLl~   45 (248)
T PRK09580         28 EVHAIMGPNGSGKSTLSA   45 (248)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

>TIGR00750 lao LAO/AO transport system ATPase

Probab=95.12  E-value=0.0067  Score=48.11  Aligned_cols=22  Identities=32%  Similarity=0.208  Sum_probs=18.9

Q ss_pred             CCCCCceEEEecccCCCccCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLL  112 (113)
                      ...+..++.|+|+.|+|||||+
T Consensus        30 ~~~~~~~i~i~G~~G~GKttl~   51 (300)
T TIGR00750        30 YTGNAHRVGITGTPGAGKSTLL   51 (300)
T ss_pred             ccCCceEEEEECCCCCCHHHHH
Confidence            3456889999999999999985

Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however.

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional

Probab=95.11  E-value=0.0051  Score=47.05  Aligned_cols=17  Identities=35%  Similarity=0.307  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        30 ~~~i~G~nGsGKSTLl~   46 (258)
T PRK13548         30 VVAILGPNGAGKSTLLR   46 (258)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function

Probab=95.11  E-value=0.0048  Score=46.18  Aligned_cols=17  Identities=41%  Similarity=0.348  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        24 ~~~i~G~nGsGKStll~   40 (197)
T cd03278          24 LTAIVGPNGSGKSNIID   40 (197)
T ss_pred             cEEEECCCCCCHHHHHH
Confidence            89999999999999963

Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein

Probab=95.10  E-value=0.0052  Score=46.36  Aligned_cols=18  Identities=33%  Similarity=0.298  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 e~~~i~G~nGsGKSTLl~   44 (252)
T TIGR03005        27 EKVALIGPSGSGKSTILR   44 (252)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            368899999999999974

Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional

Probab=95.09  E-value=0.0052  Score=46.64  Aligned_cols=18  Identities=33%  Similarity=0.350  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        30 e~~~l~G~nGsGKSTLl~   47 (254)
T PRK10418         30 RVLALVGGSGSGKSLTCA   47 (254)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK14237 phosphate transporter ATP-binding protein; Provisional

Probab=95.08  E-value=0.0053  Score=47.19  Aligned_cols=17  Identities=41%  Similarity=0.376  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        48 ~~~I~G~nGsGKSTLl~   64 (267)
T PRK14237         48 ITALIGPSGSGKSTYLR   64 (267)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional

Probab=95.08  E-value=0.0053  Score=47.02  Aligned_cols=18  Identities=39%  Similarity=0.266  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        34 e~~~i~G~nGsGKSTLl~   51 (265)
T PRK10253         34 HFTAIIGPNGCGKSTLLR   51 (265)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.08  E-value=0.0053  Score=46.11  Aligned_cols=18  Identities=33%  Similarity=0.324  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|+||||||+
T Consensus        30 e~~~i~G~nGsGKSTLl~   47 (250)
T PRK14266         30 SVTALIGPSGCGKSTFIR   47 (250)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]

Probab=95.08  E-value=0.0065  Score=49.05  Aligned_cols=16  Identities=50%  Similarity=0.407  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|.+|+||||||
T Consensus        30 ~~~i~G~NG~GKTtLL   45 (209)
T COG4133          30 ALQITGPNGAGKTTLL   45 (209)
T ss_pred             EEEEECCCCCcHHHHH
Confidence            6899999999999997

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed

Probab=95.07  E-value=0.0054  Score=47.26  Aligned_cols=18  Identities=28%  Similarity=0.241  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        31 e~~~I~G~NGsGKSTLl~   48 (251)
T PRK09544         31 KILTLLGPNGAGKSTLVR   48 (251)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.07  E-value=0.0054  Score=46.25  Aligned_cols=18  Identities=33%  Similarity=0.298  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        30 e~~~i~G~nGsGKSTLl~   47 (241)
T PRK14250         30 AIYTIVGPSGAGKSTLIK   47 (241)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter

Probab=95.06  E-value=0.0054  Score=45.04  Aligned_cols=19  Identities=42%  Similarity=0.249  Sum_probs=16.4

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =-++.|.|..|+||||||+
T Consensus        26 Ge~~~i~G~nGsGKSTLl~   44 (201)
T cd03231          26 GEALQVTGPNGSGKTTLLR   44 (201)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            3478899999999999974

The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]

Probab=95.05  E-value=0.0055  Score=49.79  Aligned_cols=18  Identities=44%  Similarity=0.266  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|-|.+||||||||+
T Consensus        29 ~i~~iiGpNG~GKSTLLk   46 (258)
T COG1120          29 EITGILGPNGSGKSTLLK   46 (258)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional

Probab=95.05  E-value=0.0054  Score=47.15  Aligned_cols=17  Identities=41%  Similarity=0.391  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        41 ~~~i~G~NGsGKSTLl~   57 (267)
T PRK15112         41 TLAIIGENGSGKSTLAK   57 (267)
T ss_pred             EEEEEcCCCCCHHHHHH
Confidence            68899999999999974

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export

Probab=95.05  E-value=0.0055  Score=45.98  Aligned_cols=17  Identities=29%  Similarity=0.212  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        50 ~~~i~G~nGsGKSTLl~   66 (224)
T cd03220          50 RIGLIGRNGAGKSTLLR   66 (224)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component

Probab=95.04  E-value=0.0055  Score=45.09  Aligned_cols=18  Identities=33%  Similarity=0.349  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..|+||||||+
T Consensus        27 e~~~i~G~nGsGKStLl~   44 (200)
T cd03217          27 EVHALMGPNGSGKSTLAK   44 (200)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            478999999999999974

Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional

Probab=95.03  E-value=0.0056  Score=47.19  Aligned_cols=18  Identities=33%  Similarity=0.377  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        34 e~~~l~G~nGsGKSTLl~   51 (272)
T PRK15056         34 SIAALVGVNGSGKSTLFK   51 (272)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.03  E-value=0.0056  Score=46.16  Aligned_cols=17  Identities=35%  Similarity=0.294  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        33 ~~~I~G~nGsGKSTLl~   49 (251)
T PRK14244         33 VTAFIGPSGCGKSTFLR   49 (251)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK14240 phosphate transporter ATP-binding protein; Provisional

Probab=95.03  E-value=0.0056  Score=45.98  Aligned_cols=17  Identities=35%  Similarity=0.329  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~~~i~G~nGsGKSTLl~   47 (250)
T PRK14240         31 VTALIGPSGCGKSTFLR   47 (250)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)

Probab=95.03  E-value=0.0056  Score=44.78  Aligned_cols=18  Identities=33%  Similarity=0.254  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|+||||||+
T Consensus        35 ~~~~i~G~nGsGKSTLl~   52 (207)
T cd03369          35 EKIGIVGRTGAGKSTLIL   52 (207)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            368899999999999974

NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional

Probab=95.01  E-value=0.0057  Score=45.61  Aligned_cols=18  Identities=33%  Similarity=0.290  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        26 e~~~l~G~nGsGKSTLl~   43 (232)
T PRK10771         26 ERVAILGPSGAGKSTLLN   43 (232)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.00  E-value=0.0058  Score=47.17  Aligned_cols=17  Identities=35%  Similarity=0.366  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        41 ~~~l~G~nGsGKSTLl~   57 (269)
T PRK14259         41 VTALIGPSGCGKSTVLR   57 (269)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []

Probab=94.99  E-value=0.0059  Score=44.78  Aligned_cols=16  Identities=38%  Similarity=0.409  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|..|+|||+||
T Consensus        26 ~~~i~G~NGsGKS~il   41 (220)
T PF02463_consen   26 LNVIVGPNGSGKSNIL   41 (220)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             CEEEEcCCCCCHHHHH
Confidence            8999999999999985

The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)

Probab=94.98  E-value=0.006  Score=44.84  Aligned_cols=18  Identities=39%  Similarity=0.338  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|+||||||+
T Consensus        36 e~~~l~G~nGsGKStLl~   53 (194)
T cd03213          36 ELTAIMGPSGAGKSTLLN   53 (194)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.

>COG0802 Predicted ATPase or kinase [General function prediction only]

Probab=94.96  E-value=0.0087  Score=45.64  Aligned_cols=17  Identities=35%  Similarity=0.544  Sum_probs=15.2

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -|.++.|-||||||||.
T Consensus        26 ~Vv~L~GdLGAGKTtf~   42 (149)
T COG0802          26 DVVLLSGDLGAGKTTLV   42 (149)
T ss_pred             CEEEEEcCCcCChHHHH
Confidence            48899999999999983

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.96  E-value=0.006  Score=46.58  Aligned_cols=17  Identities=35%  Similarity=0.329  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        44 ~~~i~G~nGsGKSTLl~   60 (265)
T PRK14252         44 VTALIGPSGCGKSTFLR   60 (265)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes

Probab=94.93  E-value=0.0069  Score=46.15  Aligned_cols=18  Identities=33%  Similarity=0.204  Sum_probs=16.5

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -+++|||..|+||||||+
T Consensus        31 ~~~~l~Gpn~sGKstllr   48 (216)
T cd03284          31 QILLITGPNMAGKSTYLR   48 (216)
T ss_pred             eEEEEECCCCCChHHHHH
Confidence            789999999999999974

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional

Probab=94.93  E-value=0.0062  Score=46.22  Aligned_cols=18  Identities=39%  Similarity=0.246  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        33 e~~~i~G~nGsGKSTLl~   50 (258)
T PRK11701         33 EVLGIVGESGSGKTTLLN   50 (258)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI

Probab=94.92  E-value=0.0063  Score=47.83  Aligned_cols=18  Identities=28%  Similarity=0.215  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        31 e~~~l~G~NGaGKSTLl~   48 (303)
T TIGR01288        31 ECFGLLGPNGAGKSTIAR   48 (303)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.

>PRK14238 phosphate transporter ATP-binding protein; Provisional

Probab=94.91  E-value=0.0063  Score=47.00  Aligned_cols=18  Identities=39%  Similarity=0.355  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        51 e~~~I~G~nGsGKSTLl~   68 (271)
T PRK14238         51 EVTAIIGPSGCGKSTYIK   68 (271)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional

Probab=94.91  E-value=0.0063  Score=46.60  Aligned_cols=17  Identities=41%  Similarity=0.372  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        39 ~~~i~G~nGsGKSTLl~   55 (265)
T PRK10575         39 VTGLIGHNGSGKSTLLK   55 (265)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion

Probab=94.90  E-value=0.0071  Score=48.22  Aligned_cols=17  Identities=41%  Similarity=0.489  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      +|.|||..|||||||++
T Consensus        23 ~~~vtGvSGsGKStL~~   39 (261)
T cd03271          23 LTCVTGVSGSGKSSLIN   39 (261)
T ss_pred             EEEEECCCCCchHHHHH
Confidence            78999999999999963

Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.88  E-value=0.0066  Score=45.55  Aligned_cols=18  Identities=28%  Similarity=0.268  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|+||||||+
T Consensus        31 e~~~i~G~nGsGKSTLl~   48 (252)
T PRK14272         31 TVNALIGPSGCGKTTFLR   48 (252)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            368899999999999974

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.87  E-value=0.0065  Score=47.35  Aligned_cols=17  Identities=41%  Similarity=0.421  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        35 ~~~i~G~nGaGKSTLl~   51 (279)
T PRK13635         35 WVAIVGHNGSGKSTLAK   51 (279)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78999999999999974

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional

Probab=94.86  E-value=0.0066  Score=46.05  Aligned_cols=18  Identities=39%  Similarity=0.302  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|+||||||+
T Consensus        32 e~~~l~G~nGsGKSTLl~   49 (257)
T PRK10619         32 DVISIIGSSGSGKSTFLR   49 (257)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            367899999999999974

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein

Probab=94.83  E-value=0.0068  Score=50.30  Aligned_cols=18  Identities=17%  Similarity=0.350  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus       287 e~~~l~G~NGsGKSTLl~  304 (500)
T TIGR02633       287 EILGVAGLVGAGRTELVQ  304 (500)
T ss_pred             cEEEEeCCCCCCHHHHHH
Confidence            378899999999999974

Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.83  E-value=0.0069  Score=47.38  Aligned_cols=18  Identities=39%  Similarity=0.276  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        66 e~~~l~G~nGsGKSTLl~   83 (286)
T PRK14275         66 YVTAIIGPSGCGKSTFLR   83 (286)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D

Probab=94.82  E-value=0.0069  Score=45.29  Aligned_cols=17  Identities=29%  Similarity=0.188  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        28 ~~~i~G~nGsGKSTLl~   44 (232)
T cd03300          28 FFTLLGPSGCGKTTLLR   44 (232)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78999999999999974

PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms

Probab=94.82  E-value=0.0088  Score=44.35  Aligned_cols=17  Identities=35%  Similarity=0.317  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      |+++|+|..|+|||++|
T Consensus        23 ~~~~i~G~NGsGKSnil   39 (178)
T cd03239          23 SFNAIVGPNGSGKSNIV   39 (178)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            59999999999999986

SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional

Probab=94.80  E-value=0.007  Score=47.36  Aligned_cols=17  Identities=35%  Similarity=0.348  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        29 ~~~l~G~nGsGKSTLl~   45 (272)
T PRK13547         29 VTALLGRNGAGKSTLLK   45 (272)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78999999999999974

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE

Probab=94.80  E-value=0.007  Score=46.34  Aligned_cols=18  Identities=28%  Similarity=0.268  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        38 e~~~i~G~nGsGKSTLl~   55 (265)
T TIGR02769        38 ETVGLLGRSGCGKSTLAR   55 (265)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional

Probab=94.78  E-value=0.0071  Score=46.00  Aligned_cols=18  Identities=33%  Similarity=0.281  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        31 e~~~i~G~nGsGKSTLl~   48 (262)
T PRK09984         31 EMVALLGPSGSGKSTLLR   48 (262)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378999999999999974

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor

Probab=94.78  E-value=0.0072  Score=47.12  Aligned_cols=18  Identities=28%  Similarity=0.237  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        27 e~~~IvG~nGsGKSTLlk   44 (255)
T cd03236          27 QVLGLVGPNGIGKSTALK   44 (255)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            389999999999999975

The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.76  E-value=0.0073  Score=45.99  Aligned_cols=17  Identities=41%  Similarity=0.362  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~l~G~nGsGKSTLlk   51 (259)
T PRK14260         35 VTAIIGPSGCGKSTFIK   51 (259)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional

Probab=94.74  E-value=0.0074  Score=46.53  Aligned_cols=18  Identities=28%  Similarity=0.337  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        39 e~~~i~G~nGsGKSTLl~   56 (268)
T PRK10419         39 ETVALLGRSGCGKSTLAR   56 (268)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999963

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.71  E-value=0.0076  Score=46.74  Aligned_cols=17  Identities=41%  Similarity=0.274  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        30 ~~~i~G~nGsGKSTLl~   46 (274)
T PRK13644         30 YIGIIGKNGSGKSTLAL   46 (274)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK14243 phosphate transporter ATP-binding protein; Provisional

Probab=94.71  E-value=0.0077  Score=46.24  Aligned_cols=18  Identities=33%  Similarity=0.270  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++-|.|..|+||||||+
T Consensus        37 e~~~i~G~nGsGKSTLl~   54 (264)
T PRK14243         37 QITAFIGPSGCGKSTILR   54 (264)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional

Probab=94.70  E-value=0.0077  Score=49.84  Aligned_cols=18  Identities=28%  Similarity=0.272  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        30 e~~~liG~nGsGKSTLl~   47 (490)
T PRK10938         30 DSWAFVGANGSGKSALAR   47 (490)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            368899999999999974

>PRK09700 D-allose transporter ATP-binding protein; Provisional

Probab=94.66  E-value=0.008  Score=50.13  Aligned_cols=17  Identities=24%  Similarity=0.350  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       291 ~~~l~G~NGsGKSTLlk  307 (510)
T PRK09700        291 ILGFAGLVGSGRTELMN  307 (510)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>PRK13633 cobalt transporter ATP-binding subunit; Provisional

Probab=94.66  E-value=0.008  Score=46.64  Aligned_cols=17  Identities=41%  Similarity=0.409  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        38 ~~~l~G~nGsGKSTLl~   54 (280)
T PRK13633         38 FLVILGRNGSGKSTIAK   54 (280)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.65  E-value=0.0081  Score=46.55  Aligned_cols=17  Identities=29%  Similarity=0.264  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~i~G~NGsGKSTLl~   48 (277)
T PRK13652         32 RIAVIGPNGAGKSTLFR   48 (277)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.64  E-value=0.0081  Score=46.88  Aligned_cols=17  Identities=35%  Similarity=0.411  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~iiG~NGaGKSTLl~   51 (287)
T PRK13641         35 FVALVGHTGSGKSTLMQ   51 (287)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>PHA00547 hypothetical protein

Probab=94.64  E-value=0.01  Score=50.62  Aligned_cols=19  Identities=37%  Similarity=0.513  Sum_probs=16.9

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      .-|++++.|.||+|||+|+
T Consensus        74 ~spis~i~G~LGsGKTlLM   92 (337)
T PHA00547         74 DNPLSVIIGKLGTGKTLLL   92 (337)
T ss_pred             cCCceEEeccCCCchhHHH
Confidence            4599999999999999874

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB

Probab=94.60  E-value=0.0085  Score=49.74  Aligned_cols=19  Identities=47%  Similarity=0.410  Sum_probs=16.8

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =-.++|+|..||||||+|+
T Consensus       134 ~glilI~GpTGSGKTTtL~  152 (358)
T TIGR02524       134 EGIVFITGATGSGKSTLLA  152 (358)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            3689999999999999974

Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.

>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=94.60  E-value=0.0092  Score=45.24  Aligned_cols=18  Identities=33%  Similarity=0.320  Sum_probs=16.6

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .++-|-|..||||||||+
T Consensus        26 ~i~~ivGpNGaGKSTll~   43 (212)
T cd03274          26 SFSAIVGPNGSGKSNVID   43 (212)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            799999999999999974

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>PRK13851 type IV secretion system protein VirB11; Provisional

Probab=94.58  E-value=0.0078  Score=49.99  Aligned_cols=18  Identities=39%  Similarity=0.449  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      --++|+|..|||||||||
T Consensus       163 ~nilI~G~tGSGKTTll~  180 (344)
T PRK13851        163 LTMLLCGPTGSGKTTMSK  180 (344)
T ss_pred             CeEEEECCCCccHHHHHH
Confidence            358999999999999975

>TIGR01420 pilT_fam pilus retraction protein PilT

Probab=94.56  E-value=0.0088  Score=48.49  Aligned_cols=19  Identities=42%  Similarity=0.445  Sum_probs=16.7

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      --+++|+|..||||||+|+
T Consensus       122 ~g~ili~G~tGSGKTT~l~  140 (343)
T TIGR01420       122 RGLILVTGPTGSGKSTTLA  140 (343)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            3679999999999999974

This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family

Probab=94.56  E-value=0.0087  Score=44.28  Aligned_cols=18  Identities=44%  Similarity=0.453  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..|+||||||+
T Consensus        32 ~~~~I~G~nGsGKStLl~   49 (220)
T TIGR02982        32 EIVILTGPSGSGKTTLLT   49 (220)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            488999999999999964

Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.53  E-value=0.009  Score=46.51  Aligned_cols=18  Identities=39%  Similarity=0.344  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|+||||||+
T Consensus        48 e~~~I~G~nGsGKSTLl~   65 (276)
T PRK14271         48 AVTSLMGPTGSGKTTFLR   65 (276)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            367899999999999974

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)

Probab=94.52  E-value=0.0093  Score=47.03  Aligned_cols=19  Identities=37%  Similarity=0.368  Sum_probs=16.5

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      --+++|+|.-||||||+|+
T Consensus        80 ~GlilisG~tGSGKTT~l~   98 (264)
T cd01129          80 HGIILVTGPTGSGKTTTLY   98 (264)
T ss_pred             CCEEEEECCCCCcHHHHHH
Confidence            3479999999999999874

It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA

Probab=94.50  E-value=0.0092  Score=46.99  Aligned_cols=17  Identities=29%  Similarity=0.241  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..|+||||||+
T Consensus        30 i~~l~G~NGaGKTTLl~   46 (301)
T TIGR03522        30 IVGFLGPNGAGKSTTMK   46 (301)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein

Probab=94.50  E-value=0.0093  Score=48.33  Aligned_cols=18  Identities=44%  Similarity=0.337  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        24 ei~~l~G~nGsGKSTLl~   41 (354)
T TIGR02142        24 GVTAIFGRSGSGKTTLIR   41 (354)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            388999999999999974

This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter.

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11

Probab=94.49  E-value=0.0086  Score=47.76  Aligned_cols=18  Identities=44%  Similarity=0.409  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -.++|+|..||||||||+
T Consensus       145 ~~ili~G~tGsGKTTll~  162 (308)
T TIGR02788       145 KNIIISGGTGSGKTTFLK  162 (308)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]

Probab=94.49  E-value=0.0074  Score=45.97  Aligned_cols=19  Identities=37%  Similarity=0.347  Sum_probs=16.4

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      --.+||+|.-||||||+|+
T Consensus       127 ~~~ili~G~tGSGKTT~l~  145 (270)
T PF00437_consen  127 RGNILISGPTGSGKTTLLN  145 (270)
T ss_dssp             TEEEEEEESTTSSHHHHHH
T ss_pred             ceEEEEECCCccccchHHH
Confidence            3578999999999999863

These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.48  E-value=0.0092  Score=46.46  Aligned_cols=17  Identities=47%  Similarity=0.454  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~I~G~nGaGKSTLl~   51 (282)
T PRK13640         35 WTALIGHNGSGKSTISK   51 (282)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78999999999999974

>PRK14236 phosphate transporter ATP-binding protein; Provisional

Probab=94.48  E-value=0.0093  Score=45.97  Aligned_cols=18  Identities=33%  Similarity=0.276  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        52 e~~~I~G~nGsGKSTLl~   69 (272)
T PRK14236         52 RVTAFIGPSGCGKSTLLR   69 (272)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378999999999999974

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein

Probab=94.47  E-value=0.0094  Score=44.83  Aligned_cols=17  Identities=35%  Similarity=0.298  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        28 ~~~l~G~nGsGKSTLl~   44 (237)
T TIGR00968        28 LVALLGPSGSGKSTLLR   44 (237)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999963

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2

Probab=94.47  E-value=0.0095  Score=49.79  Aligned_cols=18  Identities=28%  Similarity=0.180  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        27 e~~~iiG~nGsGKSTLl~   44 (520)
T TIGR03269        27 EVLGILGRSGAGKSVLMH   44 (520)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            368899999999999974

The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.

>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=94.47  E-value=0.012  Score=44.79  Aligned_cols=17  Identities=35%  Similarity=0.411  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|+|..|+||||||
T Consensus        24 g~n~i~G~NgsGKS~ll   40 (213)
T cd03277          24 SLNMIIGPNGSGKSSIV   40 (213)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            68999999999999996

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]

Probab=94.47  E-value=0.0081  Score=49.60  Aligned_cols=16  Identities=38%  Similarity=0.306  Sum_probs=14.1

Q ss_pred             EEEecccCCCccCCCC
Q 033696           98 TIITGFLGSGKNTGSA  113 (113)
Q Consensus        98 TIiTGfLGsGKtTLLn  113 (113)
                      -+|+|.+||||||||+
T Consensus        60 W~I~G~NGsGKTTLL~   75 (257)
T COG1119          60 WAIVGPNGAGKTTLLS   75 (257)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            4789999999999974

>PRK00454 engB GTP-binding protein YsxC; Reviewed

Probab=94.44  E-value=0.012  Score=41.41  Aligned_cols=25  Identities=20%  Similarity=0.193  Sum_probs=20.8

Q ss_pred             CCCCCCCceEEEecccCCCccCCCC
Q 033696           89 IPPDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        89 ~~~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+...+|-++|.|..|+|||||+|
T Consensus        18 ~~~~~~~~~v~ivG~~~~GKSsli~   42 (196)
T PRK00454         18 QLPPDDGPEIAFAGRSNVGKSSLIN   42 (196)
T ss_pred             hCCCCCCCEEEEEcCCCCCHHHHHH
Confidence            3445578889999999999999975

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]

Probab=94.41  E-value=0.0099  Score=47.43  Aligned_cols=17  Identities=29%  Similarity=0.147  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      |+-+.|..||||||||+
T Consensus        33 i~gllG~NGAGKTTllk   49 (293)
T COG1131          33 IFGLLGPNGAGKTTLLK   49 (293)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK13833 conjugal transfer protein TrbB; Provisional

Probab=94.40  E-value=0.0092  Score=49.33  Aligned_cols=16  Identities=44%  Similarity=0.544  Sum_probs=14.7

Q ss_pred             EEEecccCCCccCCCC
Q 033696           98 TIITGFLGSGKNTGSA  113 (113)
Q Consensus        98 TIiTGfLGsGKtTLLn  113 (113)
                      +||+|.-|||||||||
T Consensus       147 ilI~G~tGSGKTTll~  162 (323)
T PRK13833        147 IVISGGTGSGKTTLAN  162 (323)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            5899999999999975

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.40  E-value=0.0099  Score=45.43  Aligned_cols=19  Identities=37%  Similarity=0.277  Sum_probs=16.4

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      =-++.|.|..|+||||||+
T Consensus        33 Ge~~~I~G~nGsGKSTLl~   51 (261)
T PRK14258         33 SKVTAIIGPSGCGKSTFLK   51 (261)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            3478899999999999974

>PRK09700 D-allose transporter ATP-binding protein; Provisional

Probab=94.38  E-value=0.01  Score=49.51  Aligned_cols=18  Identities=28%  Similarity=0.252  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        32 e~~~liG~nGsGKSTLl~   49 (510)
T PRK09700         32 EIHALLGENGAGKSTLMK   49 (510)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>PRK13549 xylose transporter ATP-binding subunit; Provisional

Probab=94.38  E-value=0.01  Score=49.58  Aligned_cols=17  Identities=24%  Similarity=0.397  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       290 ~~~l~G~NGsGKSTLlk  306 (506)
T PRK13549        290 ILGIAGLVGAGRTELVQ  306 (506)
T ss_pred             EEEEeCCCCCCHHHHHH
Confidence            78899999999999974

>PRK13549 xylose transporter ATP-binding subunit; Provisional

Probab=94.38  E-value=0.01  Score=49.57  Aligned_cols=17  Identities=29%  Similarity=0.278  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        33 ~~~l~G~nGsGKSTLl~   49 (506)
T PRK13549         33 IVSLCGENGAGKSTLMK   49 (506)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.37  E-value=0.01  Score=46.15  Aligned_cols=18  Identities=39%  Similarity=0.353  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        34 e~~~i~G~nGsGKSTLl~   51 (279)
T PRK13650         34 EWLSIIGHNGSGKSTTVR   51 (279)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional

Probab=94.37  E-value=0.01  Score=48.14  Aligned_cols=18  Identities=33%  Similarity=0.287  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        25 e~~~l~G~nGsGKSTLl~   42 (352)
T PRK11144         25 GITAIFGRSGAGKTSLIN   42 (352)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            389999999999999974

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.35  E-value=0.01  Score=46.27  Aligned_cols=17  Identities=41%  Similarity=0.343  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~i~G~nGsGKSTLl~   51 (286)
T PRK13646         35 YYAIVGQTGSGKSTLIQ   51 (286)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional

Probab=94.34  E-value=0.01  Score=48.62  Aligned_cols=18  Identities=28%  Similarity=0.276  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        30 e~~~l~G~nGsGKSTLL~   47 (369)
T PRK11000         30 EFVVFVGPSGCGKSTLLR   47 (369)
T ss_pred             CEEEEECCCCCcHHHHHH
Confidence            378999999999999974

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional

Probab=94.34  E-value=0.011  Score=49.06  Aligned_cols=17  Identities=35%  Similarity=0.259  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       288 ~~~i~G~NGsGKSTLl~  304 (490)
T PRK10938        288 HWQIVGPNGAGKSTLLS  304 (490)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional

Probab=94.33  E-value=0.011  Score=46.30  Aligned_cols=18  Identities=39%  Similarity=0.394  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        51 e~~~liG~NGsGKSTLlk   68 (264)
T PRK13546         51 DVIGLVGINGSGKSTLSN   68 (264)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            467899999999999974

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional

Probab=94.32  E-value=0.011  Score=47.92  Aligned_cols=18  Identities=28%  Similarity=0.202  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        32 ei~~iiG~nGsGKSTLlk   49 (343)
T PRK11153         32 EIFGVIGASGAGKSTLIR   49 (343)
T ss_pred             CEEEEECCCCCcHHHHHH
Confidence            367899999999999974

>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage

Probab=94.32  E-value=0.013  Score=45.46  Aligned_cols=17  Identities=24%  Similarity=0.229  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|+|..|+||||+|
T Consensus        22 ~~~~i~G~NGsGKS~ll   38 (270)
T cd03242          22 GVTVLVGENAQGKTNLL   38 (270)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            58999999999999985

When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task. This CD represents the nucleotide binding domain of RecF. RecF belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.32  E-value=0.011  Score=46.41  Aligned_cols=18  Identities=33%  Similarity=0.301  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|+||||||+
T Consensus        66 e~~~I~G~nGsGKSTLl~   83 (285)
T PRK14254         66 QVTAMIGPSGCGKSTFLR   83 (285)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

>PRK13900 type IV secretion system ATPase VirB11; Provisional

Probab=94.31  E-value=0.01  Score=48.73  Aligned_cols=17  Identities=35%  Similarity=0.382  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -++|+|.-|||||||||
T Consensus       162 nili~G~tgSGKTTll~  178 (332)
T PRK13900        162 NIIISGGTSTGKTTFTN  178 (332)
T ss_pred             cEEEECCCCCCHHHHHH
Confidence            58999999999999975

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.29  E-value=0.011  Score=45.57  Aligned_cols=17  Identities=35%  Similarity=0.241  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        36 ~~~i~G~nGsGKSTLl~   52 (261)
T PRK14263         36 ITGFIGPSGCGKSTVLR   52 (261)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK10762 D-ribose transporter ATP binding protein; Provisional

Probab=94.23  E-value=0.011  Score=49.23  Aligned_cols=17  Identities=29%  Similarity=0.331  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~l~G~NGsGKSTLl~   48 (501)
T PRK10762         32 VMALVGENGAGKSTMMK   48 (501)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional

Probab=94.23  E-value=0.012  Score=49.54  Aligned_cols=18  Identities=28%  Similarity=0.244  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        38 e~~~liG~NGsGKSTLl~   55 (510)
T PRK15439         38 EVHALLGGNGAGKSTLMK   55 (510)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            368899999999999974

>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules

Probab=94.22  E-value=0.014  Score=45.49  Aligned_cols=17  Identities=35%  Similarity=0.409  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ..++|+|..|||||++|
T Consensus        22 ~~~~i~G~nGsGKS~il   38 (276)
T cd03241          22 GLTVLTGETGAGKSILL   38 (276)
T ss_pred             CeEEEEcCCCCCHHHHH
Confidence            47999999999999986

The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=94.18  E-value=0.015  Score=44.26  Aligned_cols=18  Identities=39%  Similarity=0.373  Sum_probs=16.4

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -+++.|.|..||||||||
T Consensus        25 ~~~~~IvG~NGsGKStll   42 (251)
T cd03273          25 PQFNAITGLNGSGKSNIL   42 (251)
T ss_pred             CCeEEEECCCCCCHHHHH
Confidence            468999999999999996

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>PRK10646 ADP-binding protein; Provisional

Probab=94.18  E-value=0.016  Score=43.72  Aligned_cols=16  Identities=44%  Similarity=0.486  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      |..+.|-||+|||||.
T Consensus        30 vi~L~GdLGaGKTtf~   45 (153)
T PRK10646         30 VIYLYGDLGAGKTTFS   45 (153)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            7889999999999983

>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]

Probab=94.18  E-value=0.022  Score=46.89  Aligned_cols=17  Identities=29%  Similarity=0.192  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      |+-+-|++|||||||+|
T Consensus        32 i~~LIGPNGAGKTTlfN   48 (250)
T COG0411          32 IVGLIGPNGAGKTTLFN   48 (250)
T ss_pred             EEEEECCCCCCceeeee
Confidence            78889999999999987

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed

Probab=94.17  E-value=0.014  Score=44.03  Aligned_cols=21  Identities=33%  Similarity=0.316  Sum_probs=17.6

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      ..+.-++.|.|..|||||||.
T Consensus        30 ~~~~~iigi~G~~GsGKTTl~   50 (229)
T PRK09270         30 PQRRTIVGIAGPPGAGKSTLA   50 (229)
T ss_pred             CCCCEEEEEECCCCCCHHHHH
Confidence            345678889999999999985

>PRK15064 ABC transporter ATP-binding protein; Provisional

Probab=94.15  E-value=0.012  Score=49.34  Aligned_cols=17  Identities=29%  Similarity=0.186  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        29 ~~~liG~NGsGKSTLl~   45 (530)
T PRK15064         29 RYGLIGANGCGKSTFMK   45 (530)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family

Probab=94.15  E-value=0.013  Score=49.79  Aligned_cols=17  Identities=29%  Similarity=0.309  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        33 ~~~liG~NGsGKSTLl~   49 (552)
T TIGR03719        33 KIGVLGLNGAGKSTLLR   49 (552)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown.

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]

Probab=94.11  E-value=0.013  Score=47.73  Aligned_cols=17  Identities=35%  Similarity=0.331  Sum_probs=15.4

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      =++.|.|++|||||||+
T Consensus        31 ~~~~iiGPNGaGKSTLl   47 (254)
T COG1121          31 EITALIGPNGAGKSTLL   47 (254)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            47899999999999996

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.11  E-value=0.012  Score=45.61  Aligned_cols=17  Identities=35%  Similarity=0.311  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        33 ~~~i~G~nGsGKSTLl~   49 (274)
T PRK13647         33 KTALLGPNGAGKSTLLL   49 (274)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999964

>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=94.09  E-value=0.016  Score=43.45  Aligned_cols=17  Identities=35%  Similarity=0.368  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|.|..|+||||||
T Consensus        22 gl~~i~G~NGsGKStll   38 (198)
T cd03276          22 RVNFIVGNNGSGKSAIL   38 (198)
T ss_pred             CeEEEECCCCCcHHHHH
Confidence            48899999999999986

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB

Probab=94.08  E-value=0.012  Score=47.37  Aligned_cols=17  Identities=35%  Similarity=0.454  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -++|+|.-|||||||||
T Consensus       134 ~ilI~G~tGSGKTTll~  150 (299)
T TIGR02782       134 NILVVGGTGSGKTTLAN  150 (299)
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            46899999999999974

The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.

>PRK10762 D-ribose transporter ATP binding protein; Provisional

Probab=94.07  E-value=0.013  Score=48.97  Aligned_cols=17  Identities=18%  Similarity=0.405  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       280 ~~~liG~NGsGKSTLl~  296 (501)
T PRK10762        280 ILGVSGLMGAGRTELMK  296 (501)
T ss_pred             EEEEecCCCCCHHHHHH
Confidence            78899999999999974

>PRK15064 ABC transporter ATP-binding protein; Provisional

Probab=94.07  E-value=0.013  Score=49.25  Aligned_cols=17  Identities=35%  Similarity=0.231  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       347 ~~~l~G~NGsGKSTLl~  363 (530)
T PRK15064        347 RLAIIGENGVGKTTLLR  363 (530)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional

Probab=94.06  E-value=0.013  Score=48.94  Aligned_cols=17  Identities=18%  Similarity=0.341  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       281 ~~~iiG~NGsGKSTLlk  297 (501)
T PRK11288        281 IVGLFGLVGAGRSELMK  297 (501)
T ss_pred             EEEEEcCCCCCHHHHHH
Confidence            78899999999999974

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed

Probab=94.06  E-value=0.013  Score=49.78  Aligned_cols=17  Identities=29%  Similarity=0.309  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~iiG~NGsGKSTLlk   51 (556)
T PRK11819         35 KIGVLGLNGAGKSTLLR   51 (556)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional

Probab=94.06  E-value=0.013  Score=49.18  Aligned_cols=18  Identities=17%  Similarity=0.351  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus       290 e~~~l~G~NGsGKSTLl~  307 (510)
T PRK15439        290 EILGLAGVVGAGRTELAE  307 (510)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2

Probab=94.05  E-value=0.013  Score=48.97  Aligned_cols=17  Identities=41%  Similarity=0.329  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       312 ~~~l~G~NGsGKSTLl~  328 (520)
T TIGR03269       312 IFGIVGTSGAGKTTLSK  328 (520)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional

Probab=94.01  E-value=0.013  Score=49.12  Aligned_cols=17  Identities=35%  Similarity=0.360  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       314 ~~~i~G~nGsGKSTLlk  330 (529)
T PRK15134        314 TLGLVGESGSGKSTTGL  330 (529)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1

Probab=93.93  E-value=0.014  Score=46.31  Aligned_cols=17  Identities=41%  Similarity=0.386  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        65 ~~~liG~NGsGKSTLl~   81 (282)
T cd03291          65 MLAITGSTGSGKTSLLM   81 (282)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein

Probab=93.93  E-value=0.014  Score=48.41  Aligned_cols=17  Identities=29%  Similarity=0.251  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        29 ~~~liG~nGsGKSTLl~   45 (500)
T TIGR02633        29 CVGLCGENGAGKSTLMK   45 (500)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional

Probab=93.93  E-value=0.014  Score=48.43  Aligned_cols=17  Identities=29%  Similarity=0.276  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        26 ~~~liG~nGsGKSTLl~   42 (491)
T PRK10982         26 IHALMGENGAGKSTLLK   42 (491)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK13651 cobalt transporter ATP-binding subunit; Provisional

Probab=93.92  E-value=0.014  Score=46.57  Aligned_cols=17  Identities=41%  Similarity=0.335  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        35 ~v~iiG~nGsGKSTLl~   51 (305)
T PRK13651         35 FIAIIGQTGSGKTTFIE   51 (305)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            67899999999999974

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=93.91  E-value=0.014  Score=45.73  Aligned_cols=17  Identities=41%  Similarity=0.411  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~i~G~nGsGKSTLl~   51 (290)
T PRK13634         35 YVAIIGHTGSGKSTLLQ   51 (290)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional

Probab=93.88  E-value=0.015  Score=48.57  Aligned_cols=17  Identities=29%  Similarity=0.294  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~l~G~nGsGKSTLl~   48 (501)
T PRK11288         32 VHALMGENGAGKSTLLK   48 (501)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78999999999999974

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=93.86  E-value=0.015  Score=45.05  Aligned_cols=17  Identities=29%  Similarity=0.243  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        30 ~~~l~G~nGsGKSTLl~   46 (275)
T PRK13639         30 MVALLGPNGAGKSTLFL   46 (275)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999963

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP

Probab=93.86  E-value=0.012  Score=41.44  Aligned_cols=20  Identities=25%  Similarity=0.230  Sum_probs=16.6

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      .-..++|+|.-|+|||+||+
T Consensus        19 ~~~~~~l~G~rg~GKTsLl~   38 (234)
T PF01637_consen   19 PSQHILLYGPRGSGKTSLLK   38 (234)
T ss_dssp             -SSEEEEEESTTSSHHHHHH
T ss_pred             cCcEEEEEcCCcCCHHHHHH
Confidence            45679999999999999863

; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.

>TIGR00618 sbcc exonuclease SbcC

Probab=93.86  E-value=0.018  Score=52.78  Aligned_cols=17  Identities=41%  Similarity=0.528  Sum_probs=16.3

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|+|..||||||||
T Consensus        27 gl~~I~G~nGaGKSTil   43 (1042)
T TIGR00618        27 PIFLICGKTGAGKTTLL   43 (1042)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            89999999999999986

This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD

Probab=93.84  E-value=0.015  Score=50.76  Aligned_cols=20  Identities=35%  Similarity=0.471  Sum_probs=17.8

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      .-|+++|.|..|+||||||+
T Consensus        27 ~~~~~~i~G~Ng~GKttll~   46 (650)
T TIGR03185        27 PKPIILIGGLNGAGKTTLLD   46 (650)
T ss_pred             CCeEEEEECCCCCCHHHHHH
Confidence            36799999999999999974

This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria.

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional

Probab=93.82  E-value=0.015  Score=45.95  Aligned_cols=18  Identities=33%  Similarity=0.318  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        72 e~~~IvG~nGsGKSTLl~   89 (305)
T PRK14264         72 SVTALIGPSGCGKSTFLR   89 (305)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            367899999999999974

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=93.81  E-value=0.015  Score=45.04  Aligned_cols=18  Identities=39%  Similarity=0.370  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++-|.|..||||||||+
T Consensus        34 e~~~I~G~nGsGKSTLl~   51 (277)
T PRK13642         34 EWVSIIGQNGSGKSTTAR   51 (277)
T ss_pred             CEEEEECCCCCcHHHHHH
Confidence            368899999999999963

>cd03288 ABCC_SUR2 The SUR domain 2

Probab=93.81  E-value=0.015  Score=44.32  Aligned_cols=17  Identities=41%  Similarity=0.360  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        49 ~~~i~G~nGsGKSTLl~   65 (257)
T cd03288          49 KVGICGRTGSGKSSLSL   65 (257)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes

Probab=93.79  E-value=0.017  Score=44.03  Aligned_cols=19  Identities=42%  Similarity=0.184  Sum_probs=16.7

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      .-+++|||..|+||||||+
T Consensus        29 ~~~~~l~G~n~~GKstll~   47 (204)
T cd03282          29 SRFHIITGPNMSGKSTYLK   47 (204)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            4689999999999999863

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional

Probab=93.78  E-value=0.016  Score=48.75  Aligned_cols=17  Identities=29%  Similarity=0.397  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        37 ~~~iiG~nGsGKSTLl~   53 (529)
T PRK15134         37 TLALVGESGSGKSVTAL   53 (529)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            68899999999999974

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional

Probab=93.77  E-value=0.016  Score=44.61  Aligned_cols=18  Identities=39%  Similarity=0.226  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        37 e~~~i~G~nGsGKSTLl~   54 (257)
T PRK14246         37 SIFGIMGPSGSGKSTLLK   54 (257)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion

Probab=93.74  E-value=0.019  Score=43.53  Aligned_cols=16  Identities=44%  Similarity=0.640  Sum_probs=14.9

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++-|+|..|||||||+
T Consensus        23 ~~~l~G~sGsGKSTL~   38 (226)
T cd03270          23 LVVITGVSGSGKSSLA   38 (226)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            7889999999999995

Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=93.74  E-value=0.016  Score=45.45  Aligned_cols=17  Identities=41%  Similarity=0.436  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        34 ~v~i~G~nGsGKSTLl~   50 (288)
T PRK13643         34 YTALIGHTGSGKSTLLQ   50 (288)
T ss_pred             EEEEECCCCChHHHHHH
Confidence            67899999999999974

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family

Probab=93.71  E-value=0.017  Score=49.07  Aligned_cols=17  Identities=29%  Similarity=0.200  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       350 ~~~l~G~NGsGKSTLl~  366 (552)
T TIGR03719       350 IVGVIGPNGAGKSTLFR  366 (552)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown.

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=93.64  E-value=0.017  Score=45.23  Aligned_cols=17  Identities=35%  Similarity=0.319  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~i~G~nGaGKSTLl~   51 (287)
T PRK13637         35 FVGLIGHTGSGKSTLIQ   51 (287)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=93.63  E-value=0.017  Score=46.47  Aligned_cols=17  Identities=41%  Similarity=0.399  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        54 ~~~I~G~nGsGKSTLl~   70 (320)
T PRK13631         54 IYFIIGNSGSGKSTLVT   70 (320)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>cd03299 ABC_ModC_like Archeal protein closely related to ModC

Probab=93.61  E-value=0.018  Score=43.33  Aligned_cols=16  Identities=38%  Similarity=0.333  Sum_probs=14.9

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.|.|..|+||||||
T Consensus        27 ~~~i~G~nG~GKStLl   42 (235)
T cd03299          27 YFVILGPTGSGKSVLL   42 (235)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            7889999999999996

ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional

Probab=93.61  E-value=0.016  Score=48.75  Aligned_cols=17  Identities=41%  Similarity=0.528  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        56 i~~LvG~NGsGKSTLLr   72 (400)
T PRK10070         56 IFVIMGLSGSGKSTMVR   72 (400)
T ss_pred             EEEEECCCCchHHHHHH
Confidence            78999999999999974

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed

Probab=93.61  E-value=0.018  Score=49.05  Aligned_cols=17  Identities=35%  Similarity=0.221  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       352 ~~~l~G~NGsGKSTLl~  368 (556)
T PRK11819        352 IVGIIGPNGAGKSTLFK  368 (556)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]

Probab=93.60  E-value=0.022  Score=46.84  Aligned_cols=19  Identities=37%  Similarity=0.361  Sum_probs=16.3

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +==|+.|-|..||||||||
T Consensus        27 ~Gevv~iiGpSGSGKSTlL   45 (240)
T COG1126          27 KGEVVVIIGPSGSGKSTLL   45 (240)
T ss_pred             CCCEEEEECCCCCCHHHHH
Confidence            3358899999999999996

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ

Probab=93.56  E-value=0.019  Score=48.32  Aligned_cols=17  Identities=47%  Similarity=0.520  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .++|+|.-||||||+|+
T Consensus       151 lilI~G~TGSGKTT~l~  167 (372)
T TIGR02525       151 LGLICGETGSGKSTLAA  167 (372)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68999999999999974

Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524).

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional

Probab=93.55  E-value=0.018  Score=47.22  Aligned_cols=17  Identities=29%  Similarity=0.325  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~llG~sGsGKSTLLr   48 (356)
T PRK11650         32 FIVLVGPSGCGKSTLLR   48 (356)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>PLN02200 adenylate kinase family protein

Probab=93.54  E-value=0.039  Score=42.83  Aligned_cols=16  Identities=44%  Similarity=0.424  Sum_probs=14.2

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      .+++|+|..||||||+
T Consensus        44 ~ii~I~G~PGSGKsT~   59 (234)
T PLN02200         44 FITFVLGGPGSGKGTQ   59 (234)
T ss_pred             EEEEEECCCCCCHHHH
Confidence            4678899999999997

>PHA02562 46 endonuclease subunit; Provisional

Probab=93.54  E-value=0.022  Score=47.36  Aligned_cols=18  Identities=44%  Similarity=0.547  Sum_probs=16.7

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      .++++|+|..|+||||||
T Consensus        27 ~g~~~i~G~NG~GKStll   44 (562)
T PHA02562         27 VKKTLITGKNGAGKSTML   44 (562)
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            489999999999999986

>PRK13537 nodulation ABC transporter NodI; Provisional

Probab=93.49  E-value=0.019  Score=45.67  Aligned_cols=17  Identities=29%  Similarity=0.233  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-+.|..||||||||+
T Consensus        35 i~gllGpNGaGKSTLl~   51 (306)
T PRK13537         35 CFGLLGPNGAGKTTTLR   51 (306)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999963

>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes

Probab=93.45  E-value=0.021  Score=43.80  Aligned_cols=19  Identities=37%  Similarity=0.195  Sum_probs=16.9

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +-.+++|||..|+||||||
T Consensus        29 ~~~~~~l~G~n~~GKstll   47 (222)
T cd03285          29 KSRFLIITGPNMGGKSTYI   47 (222)
T ss_pred             CCeEEEEECCCCCChHHHH
Confidence            4569999999999999986

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c

>TIGR00554 panK_bact pantothenate kinase, bacterial type

Probab=93.44  E-value=0.025  Score=46.12  Aligned_cols=20  Identities=40%  Similarity=0.635  Sum_probs=16.1

Q ss_pred             CCCceEE-EecccCCCccCCC
Q 033696           93 NRIPATI-ITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTI-iTGfLGsGKtTLL  112 (113)
                      .+.|.+| |.|..|||||||.
T Consensus        59 ~~~p~IIGIaG~~GSGKSTla   79 (290)
T TIGR00554        59 AKIPYIISIAGSVAVGKSTTA   79 (290)
T ss_pred             CCCCEEEEEECCCCCCHHHHH
Confidence            4556555 9999999999984

Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.

>PRK10636 putative ABC transporter ATP-binding protein; Provisional

Probab=93.43  E-value=0.02  Score=50.07  Aligned_cols=18  Identities=28%  Similarity=0.204  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus       339 e~~~l~G~NGsGKSTLlk  356 (638)
T PRK10636        339 SRIGLLGRNGAGKSTLIK  356 (638)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            367899999999999974

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein

Probab=93.40  E-value=0.02  Score=46.91  Aligned_cols=17  Identities=29%  Similarity=0.221  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~l~GpsGsGKSTLLr   48 (353)
T TIGR03265        32 FVCLLGPSGCGKTTLLR   48 (353)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            88999999999999974

This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type

Probab=93.36  E-value=0.027  Score=49.23  Aligned_cols=17  Identities=35%  Similarity=0.233  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .++.|+|..||||||||
T Consensus        24 ~~~~i~G~NGsGKS~ll   40 (1179)
T TIGR02168        24 GITGIVGPNGCGKSNIV   40 (1179)
T ss_pred             CcEEEECCCCCChhHHH
Confidence            38999999999999986

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional

Probab=93.34  E-value=0.021  Score=47.47  Aligned_cols=18  Identities=17%  Similarity=0.228  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++-|.|..||||||||+
T Consensus       275 e~~~l~G~nGsGKSTLl~  292 (491)
T PRK10982        275 EILGIAGLVGAKRTDIVE  292 (491)
T ss_pred             cEEEEecCCCCCHHHHHH
Confidence            378899999999999964

>COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only]

Probab=93.31  E-value=0.03  Score=49.24  Aligned_cols=17  Identities=53%  Similarity=0.522  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -.|||+|..||||||+|
T Consensus        25 ~ttIivgpNGsGKTtvL   41 (440)
T COG3950          25 ETTIIVGPNGSGKTTVL   41 (440)
T ss_pred             ceEEEECCCCCChhhHH
Confidence            37999999999999986

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein

Probab=93.31  E-value=0.021  Score=46.90  Aligned_cols=17  Identities=29%  Similarity=0.229  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        33 i~gIiG~sGaGKSTLlr   49 (343)
T TIGR02314        33 IYGVIGASGAGKSTLIR   49 (343)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria.

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=93.30  E-value=0.021  Score=44.49  Aligned_cols=17  Identities=41%  Similarity=0.323  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus        34 ~~~i~G~nGaGKSTLl~   50 (283)
T PRK13636         34 VTAILGGNGAGKSTLFQ   50 (283)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional

Probab=93.29  E-value=0.021  Score=46.84  Aligned_cols=18  Identities=28%  Similarity=0.270  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        33 e~~~llGpsGsGKSTLLr   50 (351)
T PRK11432         33 TMVTLLGPSGCGKTTVLR   50 (351)
T ss_pred             CEEEEECCCCCcHHHHHH
Confidence            388999999999999974

>PRK13894 conjugal transfer ATPase TrbB; Provisional

Probab=93.28  E-value=0.02  Score=46.91  Aligned_cols=18  Identities=33%  Similarity=0.362  Sum_probs=15.4

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      --++|+|.-|||||||||
T Consensus       149 ~~ilI~G~tGSGKTTll~  166 (319)
T PRK13894        149 RNILVIGGTGSGKTTLVN  166 (319)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            357888999999999975

>PRK13536 nodulation factor exporter subunit NodI; Provisional

Probab=93.26  E-value=0.022  Score=46.48  Aligned_cols=18  Identities=28%  Similarity=0.215  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++-+.|..||||||||+
T Consensus        68 ei~gLlGpNGaGKSTLl~   85 (340)
T PRK13536         68 ECFGLLGPNGAGKSTIAR   85 (340)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

>PRK02224 chromosome segregation protein; Provisional

Probab=93.25  E-value=0.026  Score=49.84  Aligned_cols=17  Identities=41%  Similarity=0.511  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|+|..||||||||
T Consensus        24 g~~~i~G~Ng~GKStil   40 (880)
T PRK02224         24 GVTVIHGVNGSGKSSLL   40 (880)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            69999999999999986

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed

Probab=93.19  E-value=0.022  Score=47.29  Aligned_cols=17  Identities=29%  Similarity=0.227  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        42 ~~~LlGpsGsGKSTLLr   58 (375)
T PRK09452         42 FLTLLGPSGCGKTTVLR   58 (375)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            88999999999999974

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT

Probab=93.19  E-value=0.023  Score=46.95  Aligned_cols=17  Identities=29%  Similarity=0.247  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        33 ~~~llGpsGsGKSTLLr   49 (362)
T TIGR03258        33 LLALIGKSGCGKTTLLR   49 (362)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional

Probab=93.18  E-value=0.023  Score=46.58  Aligned_cols=17  Identities=35%  Similarity=0.300  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        30 ~~~llGpsGsGKSTLLr   46 (353)
T PRK10851         30 MVALLGPSGSGKTTLLR   46 (353)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK11147 ABC transporter ATPase component; Reviewed

Probab=93.14  E-value=0.023  Score=49.34  Aligned_cols=17  Identities=29%  Similarity=0.253  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       347 ~~~l~G~NGsGKSTLlk  363 (635)
T PRK11147        347 KIALIGPNGCGKTTLLK  363 (635)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            67899999999999974

>PRK11147 ABC transporter ATPase component; Reviewed

Probab=93.12  E-value=0.024  Score=49.27  Aligned_cols=17  Identities=29%  Similarity=0.319  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~v~LvG~NGsGKSTLLr   47 (635)
T PRK11147         31 RVCLVGRNGAGKSTLMK   47 (635)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999974

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=93.03  E-value=0.025  Score=44.72  Aligned_cols=17  Identities=35%  Similarity=0.378  Sum_probs=15.3

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -.+.|.|..|||||||+
T Consensus        31 e~~~i~G~nGsGKSTL~   47 (235)
T COG1122          31 ERVLLIGPNGSGKSTLL   47 (235)
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            37889999999999996

>PRK06696 uridine kinase; Validated

Probab=92.99  E-value=0.042  Score=41.33  Aligned_cols=19  Identities=37%  Similarity=0.343  Sum_probs=16.8

Q ss_pred             CCCceEEEecccCCCccCC
Q 033696           93 NRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTL  111 (113)
                      .+..++.|.|..|||||||
T Consensus        20 ~~~~iI~I~G~sgsGKSTl   38 (223)
T PRK06696         20 TRPLRVAIDGITASGKTTF   38 (223)
T ss_pred             CCceEEEEECCCCCCHHHH
Confidence            4567999999999999997

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]

Probab=92.94  E-value=0.026  Score=47.44  Aligned_cols=17  Identities=29%  Similarity=0.311  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ..++.|+.|+||||||+
T Consensus        31 f~vllGPSGcGKSTlLr   47 (338)
T COG3839          31 FVVLLGPSGCGKSTLLR   47 (338)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999985

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type

Probab=92.92  E-value=0.032  Score=49.27  Aligned_cols=17  Identities=41%  Similarity=0.450  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+|+|+|..||||||+|
T Consensus        24 ~~~~i~G~NGsGKS~il   40 (1164)
T TIGR02169        24 GFTVISGPNGSGKSNIG   40 (1164)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            48999999999999985

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.

>PRK10636 putative ABC transporter ATP-binding protein; Provisional

Probab=92.89  E-value=0.027  Score=49.22  Aligned_cols=17  Identities=35%  Similarity=0.276  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        29 ~v~LvG~NGsGKSTLLk   45 (638)
T PRK10636         29 KVGLVGKNGCGKSTLLA   45 (638)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999974

>PRK00064 recF recombination protein F; Reviewed

Probab=92.84  E-value=0.032  Score=45.66  Aligned_cols=17  Identities=24%  Similarity=0.309  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|+|..|+||||||
T Consensus        24 ~~~~i~G~NgsGKT~ll   40 (361)
T PRK00064         24 GVNVLVGENGQGKTNLL   40 (361)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            39999999999999986

>PRK14079 recF recombination protein F; Provisional

Probab=92.83  E-value=0.032  Score=45.55  Aligned_cols=17  Identities=24%  Similarity=0.176  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .++||+|..|+|||+||
T Consensus        24 g~nvi~G~NGsGKT~lL   40 (349)
T PRK14079         24 GVTAVVGENAAGKTNLL   40 (349)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            38999999999999986

>PRK09087 hypothetical protein; Validated

Probab=92.78  E-value=0.029  Score=43.26  Aligned_cols=19  Identities=32%  Similarity=0.590  Sum_probs=16.9

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      -|..+|.|.-|+|||+||+
T Consensus        44 ~~~l~l~G~~GsGKThLl~   62 (226)
T PRK09087         44 SPVVVLAGPVGSGKTHLAS   62 (226)
T ss_pred             CCeEEEECCCCCCHHHHHH
Confidence            5888999999999999974

>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair]

Probab=92.71  E-value=0.052  Score=48.32  Aligned_cols=17  Identities=47%  Similarity=0.491  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -.||+||..||||||+|
T Consensus       274 ElTvlTGpTGsGKTTFl  290 (514)
T KOG2373|consen  274 ELTVLTGPTGSGKTTFL  290 (514)
T ss_pred             ceEEEecCCCCCceeEe
Confidence            46999999999999986

>PRK12402 replication factor C small subunit 2; Reviewed

Probab=92.66  E-value=0.036  Score=42.51  Aligned_cols=20  Identities=30%  Similarity=0.556  Sum_probs=17.6

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .++|..+++|..|+|||||+
T Consensus        34 ~~~~~lll~Gp~GtGKT~la   53 (337)
T PRK12402         34 PNLPHLLVQGPPGSGKTAAV   53 (337)
T ss_pred             CCCceEEEECCCCCCHHHHH
Confidence            46788999999999999974

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit

Probab=92.64  E-value=0.03  Score=46.60  Aligned_cols=17  Identities=41%  Similarity=0.331  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..|||||||+|
T Consensus       363 ~vaIvG~SGsGKSTLl~  379 (529)
T TIGR02868       363 RVAILGPSGSGKSTLLM  379 (529)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46789999999999974

The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.

>TIGR02533 type_II_gspE general secretory pathway protein E

Probab=92.62  E-value=0.031  Score=48.15  Aligned_cols=20  Identities=35%  Similarity=0.335  Sum_probs=17.0

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +-.+++|+|..||||||+|+
T Consensus       241 ~~GlilitGptGSGKTTtL~  260 (486)
T TIGR02533       241 PHGIILVTGPTGSGKTTTLY  260 (486)
T ss_pred             CCCEEEEEcCCCCCHHHHHH
Confidence            34689999999999999863

This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis.

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional

Probab=92.61  E-value=0.03  Score=46.43  Aligned_cols=17  Identities=29%  Similarity=0.251  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        47 ~~~llGpsGsGKSTLLr   63 (377)
T PRK11607         47 IFALLGASGCGKSTLLR   63 (377)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed

Probab=92.57  E-value=0.029  Score=47.24  Aligned_cols=18  Identities=28%  Similarity=0.200  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        30 eiv~liGpNGaGKSTLLk   47 (402)
T PRK09536         30 SLVGLVGPNGAGKTTLLR   47 (402)
T ss_pred             CEEEEECCCCchHHHHHH
Confidence            478899999999999974

>TIGR00606 rad50 rad50

Probab=92.53  E-value=0.038  Score=52.16  Aligned_cols=18  Identities=44%  Similarity=0.517  Sum_probs=16.7

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -|+++|.|..||||||+|
T Consensus        28 ~~~~~I~G~NGaGKTTil   45 (1311)
T TIGR00606        28 SPLTILVGPNGAGKTTII   45 (1311)
T ss_pred             cceEEEECCCCCCHHHHH
Confidence            489999999999999985

This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional

Probab=92.52  E-value=0.048  Score=44.72  Aligned_cols=20  Identities=30%  Similarity=0.416  Sum_probs=18.2

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .++|+.-|+|+-|||||||+
T Consensus       203 ~~~~~~~~~g~~~~GKtt~~  222 (366)
T PRK14489        203 GAPPLLGVVGYSGTGKTTLL  222 (366)
T ss_pred             CCccEEEEecCCCCCHHHHH
Confidence            36899999999999999985

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]

Probab=92.51  E-value=0.029  Score=48.11  Aligned_cols=17  Identities=41%  Similarity=0.438  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      =++|.|--|||||||||
T Consensus       175 NILisGGTGSGKTTlLN  191 (355)
T COG4962         175 NILISGGTGSGKTTLLN  191 (355)
T ss_pred             eEEEeCCCCCCHHHHHH
Confidence            36889999999999987

>PRK10261 glutathione transporter ATP-binding protein; Provisional

Probab=92.40  E-value=0.034  Score=48.32  Aligned_cols=17  Identities=35%  Similarity=0.425  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       352 ~~~lvG~nGsGKSTLlk  368 (623)
T PRK10261        352 TLSLVGESGSGKSTTGR  368 (623)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA

Probab=92.37  E-value=0.034  Score=46.36  Aligned_cols=17  Identities=35%  Similarity=0.397  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|+|..||||||||+
T Consensus       360 ~v~IvG~sGsGKSTLl~  376 (571)
T TIGR02203       360 TVALVGRSGSGKSTLVN  376 (571)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            56799999999999964

This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes.

>PRK09435 membrane ATPase/protein kinase; Provisional

Probab=92.34  E-value=0.035  Score=46.13  Aligned_cols=20  Identities=35%  Similarity=0.245  Sum_probs=17.1

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+-.+.-|+|+.|||||||+
T Consensus        54 ~~~~~igi~G~~GaGKSTl~   73 (332)
T PRK09435         54 GNALRIGITGVPGVGKSTFI   73 (332)
T ss_pred             CCcEEEEEECCCCCCHHHHH
Confidence            45568889999999999985

>PRK03846 adenylylsulfate kinase; Provisional

Probab=92.32  E-value=0.049  Score=40.17  Aligned_cols=16  Identities=44%  Similarity=0.559  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.|+|..|||||||.
T Consensus        26 ~i~i~G~~GsGKSTla   41 (198)
T PRK03846         26 VLWFTGLSGSGKSTVA   41 (198)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            8889999999999984

>PLN03073 ABC transporter F family; Provisional

Probab=92.32  E-value=0.035  Score=49.96  Aligned_cols=17  Identities=29%  Similarity=0.223  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       537 ~i~LvG~NGsGKSTLLk  553 (718)
T PLN03073        537 RIAMVGPNGIGKSTILK  553 (718)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            67899999999999974

>PRK06620 hypothetical protein; Validated

Probab=92.24  E-value=0.036  Score=42.38  Aligned_cols=18  Identities=28%  Similarity=0.202  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      +..++.|.-|+|||+|++
T Consensus        45 ~~l~l~Gp~G~GKThLl~   62 (214)
T PRK06620         45 FTLLIKGPSSSGKTYLTK   62 (214)
T ss_pred             ceEEEECCCCCCHHHHHH
Confidence            568999999999999974

>PRK10261 glutathione transporter ATP-binding protein; Provisional

Probab=92.23  E-value=0.035  Score=48.22  Aligned_cols=17  Identities=35%  Similarity=0.421  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        44 ~~~lvG~nGsGKSTLl~   60 (623)
T PRK10261         44 TLAIVGESGSGKSVTAL   60 (623)
T ss_pred             EEEEECCCCChHHHHHH
Confidence            68899999999999974

>TIGR01069 mutS2 MutS2 family protein

Probab=92.20  E-value=0.045  Score=49.87  Aligned_cols=19  Identities=26%  Similarity=0.130  Sum_probs=16.8

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      -.+.+|||..|+||||||+
T Consensus       322 ~~~liItGpNg~GKSTlLK  340 (771)
T TIGR01069       322 KRVLAITGPNTGGKTVTLK  340 (771)
T ss_pred             ceEEEEECCCCCCchHHHH
Confidence            3589999999999999974

Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional

Probab=92.16  E-value=0.037  Score=44.44  Aligned_cols=17  Identities=29%  Similarity=0.243  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||++
T Consensus        35 ~~~ivG~sGsGKSTLl~   51 (330)
T PRK15093         35 IRGLVGESGSGKSLIAK   51 (330)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999964

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis

Probab=92.08  E-value=0.032  Score=42.34  Aligned_cols=18  Identities=22%  Similarity=0.359  Sum_probs=17.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .++++.|..|+||+||+|
T Consensus        36 k~~vl~G~SGvGKSSLiN   53 (161)
T PF03193_consen   36 KTSVLLGQSGVGKSSLIN   53 (161)
T ss_dssp             SEEEEECSTTSSHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            699999999999999986

RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.

>TIGR00611 recf recF protein

Probab=92.08  E-value=0.047  Score=45.14  Aligned_cols=16  Identities=31%  Similarity=0.389  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|..|+|||+||
T Consensus        25 ~nvi~G~NGsGKT~lL   40 (365)
T TIGR00611        25 VNVIVGPNGQGKTNLL   40 (365)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            8999999999999986

All proteins in this family for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).

>PRK01156 chromosome segregation protein; Provisional

Probab=92.00  E-value=0.048  Score=48.64  Aligned_cols=17  Identities=41%  Similarity=0.458  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|+|..||||||+|
T Consensus        24 gi~~I~G~NGsGKSsil   40 (895)
T PRK01156         24 GINIITGKNGAGKSSIV   40 (895)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            69999999999999986

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit

Probab=91.99  E-value=0.04  Score=45.85  Aligned_cols=18  Identities=28%  Similarity=0.292  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -.+.|+|..|||||||+|
T Consensus       349 ~~~~ivG~sGsGKSTL~~  366 (529)
T TIGR02857       349 ERVALVGPSGAGKSTLLN  366 (529)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            367899999999999964

Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein

Probab=91.98  E-value=0.04  Score=46.27  Aligned_cols=17  Identities=29%  Similarity=0.479  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        52 i~~I~G~nGsGKSTLlr   68 (382)
T TIGR03415        52 ICVLMGLSGSGKSSLLR   68 (382)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78999999999999974

Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines.

>PRK13409 putative ATPase RIL; Provisional

Probab=91.97  E-value=0.041  Score=48.16  Aligned_cols=17  Identities=35%  Similarity=0.235  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+||||||+
T Consensus       367 iv~l~G~NGsGKSTLlk  383 (590)
T PRK13409        367 VIGIVGPNGIGKTTFAK  383 (590)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>cd01858 NGP_1 NGP-1

Probab=91.96  E-value=0.041  Score=38.70  Aligned_cols=18  Identities=17%  Similarity=0.342  Sum_probs=15.4

Q ss_pred             ceEE-EecccCCCccCCCC
Q 033696           96 PATI-ITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTI-iTGfLGsGKtTLLn  113 (113)
                      +++| +.|..|+||+||+|
T Consensus       102 ~~~v~~~G~~nvGKStliN  120 (157)
T cd01858         102 QISVGFIGYPNVGKSSIIN  120 (157)
T ss_pred             ceEEEEEeCCCCChHHHHH
Confidence            4565 89999999999987

Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.

>PRK10246 exonuclease subunit SbcC; Provisional

Probab=91.86  E-value=0.055  Score=50.26  Aligned_cols=22  Identities=36%  Similarity=0.244  Sum_probs=18.9

Q ss_pred             CCCCCceEEEecccCCCccCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLL  112 (113)
                      +...-++++|+|..||||||+|
T Consensus        26 ~l~~~~l~~I~G~tGaGKStil   47 (1047)
T PRK10246         26 PFASNGLFAITGPTGAGKTTLL   47 (1047)
T ss_pred             cCCCCCEEEEECCCCCCHHHHH
Confidence            3455689999999999999986

>PLN02165 adenylate isopentenyltransferase

Probab=91.82  E-value=0.097  Score=44.10  Aligned_cols=21  Identities=29%  Similarity=0.366  Sum_probs=17.2

Q ss_pred             CCCCCceEEEecccCCCccCC
Q 033696           91 PDNRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTL  111 (113)
                      ...+-++++|.|..|||||||
T Consensus        39 ~~~~g~iivIiGPTGSGKStL   59 (334)
T PLN02165         39 QNCKDKVVVIMGATGSGKSRL   59 (334)
T ss_pred             cCCCCCEEEEECCCCCcHHHH
Confidence            334455899999999999998

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional

Probab=91.77  E-value=0.044  Score=46.44  Aligned_cols=17  Identities=35%  Similarity=0.388  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|+|..|||||||++
T Consensus       363 ~v~IvG~sGsGKSTLl~  379 (588)
T PRK13657        363 TVAIVGPTGAGKSTLIN  379 (588)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999964

>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=91.76  E-value=0.061  Score=46.33  Aligned_cols=21  Identities=29%  Similarity=0.173  Sum_probs=18.4

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...-||-|+|..|||||||+|
T Consensus        22 p~~GvTAlFG~SGsGKTslin   42 (352)
T COG4148          22 PARGITALFGPSGSGKTSLIN   42 (352)
T ss_pred             CCCceEEEecCCCCChhhHHH
Confidence            445789999999999999987

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]

Probab=91.75  E-value=0.053  Score=48.25  Aligned_cols=20  Identities=35%  Similarity=0.375  Sum_probs=17.3

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      +.=.+.++||+-||||||.|
T Consensus       256 ~p~GliLvTGPTGSGKTTTL  275 (500)
T COG2804         256 RPQGLILVTGPTGSGKTTTL  275 (500)
T ss_pred             CCCeEEEEeCCCCCCHHHHH
Confidence            45678999999999999975

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=91.75  E-value=0.044  Score=45.49  Aligned_cols=17  Identities=29%  Similarity=0.337  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ..++-|..|+|||||||
T Consensus        33 ~vv~lGpSGcGKTTLLn   49 (259)
T COG4525          33 LVVVLGPSGCGKTTLLN   49 (259)
T ss_pred             EEEEEcCCCccHHHHHH
Confidence            46788999999999997

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional

Probab=91.74  E-value=0.041  Score=46.20  Aligned_cols=17  Identities=35%  Similarity=0.436  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|+|..|||||||++
T Consensus       371 ~~aIvG~sGsGKSTLl~  387 (582)
T PRK11176        371 TVALVGRSGSGKSTIAN  387 (582)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46899999999999964

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional

Probab=91.69  E-value=0.046  Score=46.50  Aligned_cols=17  Identities=41%  Similarity=0.298  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|+|..||||||||+
T Consensus       343 ~~~ivG~sGsGKSTLl~  359 (569)
T PRK10789        343 MLGICGPTGSGKSTLLS  359 (569)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999974

>PRK11058 GTPase HflX; Provisional

Probab=91.66  E-value=0.056  Score=45.82  Aligned_cols=22  Identities=23%  Similarity=0.453  Sum_probs=19.5

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...+|.++|.|+.++|||||+|
T Consensus       194 ~~~~p~ValVG~~NaGKSSLlN  215 (426)
T PRK11058        194 KADVPTVSLVGYTNAGKSTLFN  215 (426)
T ss_pred             hcCCCEEEEECCCCCCHHHHHH
Confidence            3467999999999999999986

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional

Probab=91.65  E-value=0.044  Score=44.16  Aligned_cols=18  Identities=39%  Similarity=0.383  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++-|.|..|||||||++
T Consensus        34 e~~~lvG~sGsGKSTL~~   51 (326)
T PRK11022         34 EVVGIVGESGSGKSVSSL   51 (326)
T ss_pred             CEEEEECCCCChHHHHHH
Confidence            378899999999999963

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]

Probab=91.62  E-value=0.048  Score=44.61  Aligned_cols=18  Identities=28%  Similarity=0.250  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =|+-+-|.+|+||||||+
T Consensus        30 eiv~llG~NGaGKTTlLk   47 (237)
T COG0410          30 EIVALLGRNGAGKTTLLK   47 (237)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478889999999999974

>PLN03211 ABC transporter G-25; Provisional

Probab=91.58  E-value=0.049  Score=48.31  Aligned_cols=17  Identities=35%  Similarity=0.292  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||||
T Consensus        96 ~~aI~GpnGaGKSTLL~  112 (659)
T PLN03211         96 ILAVLGPSGSGKSTLLN  112 (659)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999975

>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein

Probab=91.54  E-value=0.05  Score=47.26  Aligned_cols=17  Identities=29%  Similarity=0.302  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||||
T Consensus        53 ~~aI~G~sGsGKSTLL~   69 (617)
T TIGR00955        53 LLAVMGSSGAGKTTLMN   69 (617)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999975

>PRK13409 putative ATPase RIL; Provisional

Probab=91.53  E-value=0.049  Score=47.71  Aligned_cols=17  Identities=41%  Similarity=0.341  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..|+||||||+
T Consensus       101 v~gLvG~NGaGKSTLlk  117 (590)
T PRK13409        101 VTGILGPNGIGKTTAVK  117 (590)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>PRK00440 rfc replication factor C small subunit; Reviewed

Probab=91.52  E-value=0.057  Score=40.99  Aligned_cols=20  Identities=30%  Similarity=0.609  Sum_probs=17.1

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ..+|..+++|.-|+||||++
T Consensus        36 ~~~~~~ll~G~~G~GKt~~~   55 (319)
T PRK00440         36 KNMPHLLFAGPPGTGKTTAA   55 (319)
T ss_pred             CCCCeEEEECCCCCCHHHHH
Confidence            45677899999999999975

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit

Probab=91.51  E-value=0.059  Score=41.42  Aligned_cols=20  Identities=25%  Similarity=0.310  Sum_probs=16.8

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+.+..+++|..|.|||+|+
T Consensus        28 ~~~~~~ll~Gp~G~GKT~la   47 (305)
T TIGR00635        28 EALDHLLLYGPPGLGKTTLA   47 (305)
T ss_pred             CCCCeEEEECCCCCCHHHHH
Confidence            34567899999999999985

RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.

>PRK03918 chromosome segregation protein; Provisional

Probab=91.43  E-value=0.058  Score=47.40  Aligned_cols=17  Identities=35%  Similarity=0.388  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|+|..|+||||+|
T Consensus        24 g~~~i~G~nG~GKStil   40 (880)
T PRK03918         24 GINLIIGQNGSGKSSIL   40 (880)
T ss_pred             CcEEEEcCCCCCHHHHH
Confidence            57999999999999985

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2

Probab=91.41  E-value=0.051  Score=43.04  Aligned_cols=18  Identities=33%  Similarity=0.278  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        31 e~~~IvG~nGsGKSTLl~   48 (275)
T cd03289          31 QRVGLLGRTGSGKSTLLS   48 (275)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478899999999999974

The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.

>PF00488 MutS_V: MutS domain V C-terminus

Probab=91.36  E-value=0.055  Score=42.11  Aligned_cols=18  Identities=44%  Similarity=0.202  Sum_probs=16.6

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      ..+.||||...+||||+|
T Consensus        43 ~~~~iiTGpN~sGKSt~l   60 (235)
T PF00488_consen   43 SRIIIITGPNMSGKSTFL   60 (235)
T ss_dssp             SSEEEEESSTTSSHHHHH
T ss_pred             eeEEEEeCCCccchhhHH
Confidence            479999999999999986

; InterPro: IPR000432 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication []. MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base []. MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch []. MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level []. Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA. MutS is a modular protein with a complex structure [], and is composed of: N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts. The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair. Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein [].This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions []. Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts []. This entry represents the C-terminal domain found in proteins in the MutS family of DNA mismatch repair proteins. The C-terminal region of MutS is comprised of the ATPase domain and the HTH (helix-turn-helix) domain, the latter being involved in dimer contacts. Yeast MSH3 [], bacterial proteins involved in DNA mismatch repair, and the predicted protein product of the Rep-3 gene of mouse share extensive sequence similarity. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. ; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair; PDB: 1FW6_A 1EWQ_A 1EWR_B 1NNE_B 2WTU_A 1OH7_A 1OH5_B 1W7A_B 1NG9_A 1OH8_B ....

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C

Probab=91.33  E-value=0.053  Score=38.52  Aligned_cols=16  Identities=50%  Similarity=0.574  Sum_probs=14.9

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|.-|+|||||+
T Consensus        34 l~~i~g~~g~GKT~~~   49 (193)
T PF13481_consen   34 LTLIAGPPGSGKTTLA   49 (193)
T ss_dssp             EEEEEECSTSSHHHHH
T ss_pred             EEEEEeCCCCCHHHHH
Confidence            8999999999999974

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional

Probab=91.24  E-value=0.054  Score=43.97  Aligned_cols=18  Identities=28%  Similarity=0.246  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..|||||||++
T Consensus        48 e~~~lvG~sGsGKSTLlk   65 (331)
T PRK15079         48 ETLGVVGESGCGKSTFAR   65 (331)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999963

>PRK08084 DNA replication initiation factor; Provisional

Probab=91.12  E-value=0.069  Score=40.87  Aligned_cols=18  Identities=11%  Similarity=-0.036  Sum_probs=16.0

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      .+..+++|.-|+|||+|+
T Consensus        45 ~~~l~l~Gp~G~GKThLl   62 (235)
T PRK08084         45 SGYIYLWSREGAGRSHLL   62 (235)
T ss_pred             CCeEEEECCCCCCHHHHH
Confidence            367899999999999986

>PRK06893 DNA replication initiation factor; Validated

Probab=91.08  E-value=0.06  Score=40.97  Aligned_cols=19  Identities=32%  Similarity=0.148  Sum_probs=17.0

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      .-|..++.|..|+|||.|+
T Consensus        38 ~~~~l~l~G~~G~GKThL~   56 (229)
T PRK06893         38 QQPFFYIWGGKSSGKSHLL   56 (229)
T ss_pred             CCCeEEEECCCCCCHHHHH
Confidence            3588999999999999986

>PRK10436 hypothetical protein; Provisional

Probab=91.05  E-value=0.072  Score=46.00  Aligned_cols=19  Identities=32%  Similarity=0.345  Sum_probs=16.7

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +--+++|||.-||||||+|
T Consensus       217 ~~GliLvtGpTGSGKTTtL  235 (462)
T PRK10436        217 PQGLILVTGPTGSGKTVTL  235 (462)
T ss_pred             cCCeEEEECCCCCChHHHH
Confidence            4568999999999999976

>TIGR03238 dnd_assoc_3 dnd system-associated protein 3

Probab=91.02  E-value=0.07  Score=47.56  Aligned_cols=18  Identities=28%  Similarity=0.305  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        33 Eiv~L~G~SGsGKSTLLr   50 (504)
T TIGR03238        33 SLLFLCGSSGDGKSEILA   50 (504)
T ss_pred             CEEEEECCCCCCHHHHHh
Confidence            478999999999999985

cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.

>TIGR00634 recN DNA repair protein RecN

Probab=91.01  E-value=0.07  Score=46.03  Aligned_cols=17  Identities=35%  Similarity=0.413  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|||..|||||+||
T Consensus        23 g~~vitG~nGaGKS~ll   39 (563)
T TIGR00634        23 GLTVLTGETGAGKSMII   39 (563)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            58999999999999986

All proteins in this family for which functions are known are ATP binding proteins involved in the initiation of recombination and recombinational repair.

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]

Probab=90.99  E-value=0.063  Score=44.02  Aligned_cols=17  Identities=35%  Similarity=0.313  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|-|..||||+||||
T Consensus        27 ~vAi~GpSGaGKSTLLn   43 (231)
T COG3840          27 IVAILGPSGAGKSTLLN   43 (231)
T ss_pred             EEEEECCCCccHHHHHH
Confidence            67788999999999987

>PF13175 AAA_15: AAA ATPase domain

Probab=90.96  E-value=0.06  Score=41.88  Aligned_cols=18  Identities=39%  Similarity=0.278  Sum_probs=16.4

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .+|||.|-.|+||||+|+
T Consensus        23 ~itiiiG~N~sGKT~IL~   40 (415)
T PF13175_consen   23 DITIIIGENNSGKTNILE   40 (415)
T ss_pred             ceEEEEccCCCCHHHHHH
Confidence            789999999999999873

>PRK00098 GTPase RsgA; Reviewed

Probab=90.95  E-value=0.059  Score=42.94  Aligned_cols=17  Identities=35%  Similarity=0.452  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++++.|..|+|||||+|
T Consensus       166 ~~~~~G~sgvGKStlin  182 (298)
T PRK00098        166 VTVLAGQSGVGKSTLLN  182 (298)
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            78899999999999986

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family

Probab=90.94  E-value=0.083  Score=41.19  Aligned_cols=15  Identities=33%  Similarity=0.341  Sum_probs=14.4

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      +|+|+|..|+|||+|
T Consensus        38 ~~lI~G~pGtGKT~l   52 (259)
T TIGR03878        38 VINITGVSDTGKSLM   52 (259)
T ss_pred             EEEEEcCCCCCHHHH
Confidence            899999999999997

This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed

Probab=90.92  E-value=0.061  Score=45.40  Aligned_cols=17  Identities=24%  Similarity=0.280  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+-|+|..|||||||++
T Consensus       378 ~vaIvG~SGsGKSTL~~  394 (588)
T PRK11174        378 RIALVGPSGAGKTSLLN  394 (588)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46799999999999964

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional

Probab=90.91  E-value=0.061  Score=45.44  Aligned_cols=17  Identities=35%  Similarity=0.337  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..|||||||++
T Consensus       351 ~~aivG~sGsGKSTL~~  367 (547)
T PRK10522        351 LLFLIGGNGSGKSTLAM  367 (547)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999964

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional

Probab=90.85  E-value=0.061  Score=43.47  Aligned_cols=17  Identities=29%  Similarity=0.358  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..|||||||++
T Consensus        43 ~~~IvG~sGsGKSTLl~   59 (327)
T PRK11308         43 TLAVVGESGCGKSTLAR   59 (327)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999963

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=90.82  E-value=0.062  Score=43.97  Aligned_cols=17  Identities=35%  Similarity=0.258  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|-|..|+|||||||
T Consensus        31 fvsilGpSGcGKSTLLr   47 (248)
T COG1116          31 FVAILGPSGCGKSTLLR   47 (248)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            56788999999999986

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB

Probab=90.81  E-value=0.076  Score=46.30  Aligned_cols=19  Identities=32%  Similarity=0.391  Sum_probs=16.7

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +--+++|||.-||||||+|
T Consensus       315 ~~Glilv~G~tGSGKTTtl  333 (564)
T TIGR02538       315 PQGMVLVTGPTGSGKTVSL  333 (564)
T ss_pred             cCCeEEEECCCCCCHHHHH
Confidence            3468999999999999986

This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional

Probab=90.69  E-value=0.066  Score=43.42  Aligned_cols=17  Identities=35%  Similarity=0.294  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       110 ~v~IvG~~GsGKSTLl~  126 (329)
T PRK14257        110 VTAFIGPSGCGKSTFLR  126 (329)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999973

>PRK04841 transcriptional regulator MalT; Provisional

Probab=90.65  E-value=0.086  Score=45.66  Aligned_cols=20  Identities=30%  Similarity=0.275  Sum_probs=18.4

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ...|+|+|+|.-|.|||||+
T Consensus        30 ~~~~~~~v~apaG~GKTtl~   49 (903)
T PRK04841         30 NNYRLVLVTSPAGYGKTTLI   49 (903)
T ss_pred             cCCCeEEEECCCCCCHHHHH
Confidence            46899999999999999986

>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter

Probab=90.59  E-value=0.068  Score=45.45  Aligned_cols=18  Identities=33%  Similarity=0.361  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -.+.|.|..|||||||+|
T Consensus       369 ~~~aivG~sGsGKSTl~~  386 (555)
T TIGR01194       369 DIVFIVGENGCGKSTLAK  386 (555)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            468899999999999964

This model describes cyclic peptide transporter in bacteria. Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. Syringomycin is an amphipathic, cylclic lipodepsipeptide when inserted into host causes formation of channels, permeable to variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein

Probab=90.54  E-value=0.069  Score=44.73  Aligned_cols=17  Identities=29%  Similarity=0.331  Sum_probs=14.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..|||||||++
T Consensus       368 ~i~IvG~sGsGKSTLlk  384 (576)
T TIGR02204       368 TVALVGPSGAGKSTLFQ  384 (576)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46789999999999964

This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]

Probab=90.52  E-value=0.098  Score=39.98  Aligned_cols=16  Identities=38%  Similarity=0.478  Sum_probs=14.7

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      =+++|+|..|+|||+|
T Consensus        24 ~~~lI~G~pGsGKT~f   39 (260)
T COG0467          24 SVVLITGPPGTGKTIF   39 (260)
T ss_pred             cEEEEEcCCCCcHHHH
Confidence            4799999999999997

>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]

Probab=90.51  E-value=0.069  Score=47.15  Aligned_cols=18  Identities=39%  Similarity=0.281  Sum_probs=16.3

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|-|.-|||||||||
T Consensus        57 el~AimG~SGsGKtTLL~   74 (613)
T KOG0061|consen   57 ELLAIMGPSGSGKTTLLN   74 (613)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            388999999999999986

>PRK13764 ATPase; Provisional

Probab=90.47  E-value=0.066  Score=48.10  Aligned_cols=17  Identities=35%  Similarity=0.509  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -++|+|..||||||||+
T Consensus       259 ~ILIsG~TGSGKTTll~  275 (602)
T PRK13764        259 GILIAGAPGAGKSTFAQ  275 (602)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            37999999999999974

>TIGR01192 chvA glucan exporter ATP-binding protein

Probab=90.45  E-value=0.071  Score=45.73  Aligned_cols=18  Identities=33%  Similarity=0.355  Sum_probs=15.3

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =.+.|+|..|||||||++
T Consensus       362 ~~~~ivG~sGsGKSTL~~  379 (585)
T TIGR01192       362 QTVAIVGPTGAGKTTLIN  379 (585)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            357899999999999964

This model describes glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. The In general, this protein is in some ways implicated in osmoregulation and suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bactrerial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmoadaptaion are related.

>TIGR03156 GTP_HflX GTP-binding protein HflX

Probab=90.40  E-value=0.09  Score=43.26  Aligned_cols=22  Identities=23%  Similarity=0.456  Sum_probs=19.6

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...+|.++|.|+.++|||||||
T Consensus       186 ~~~~~~ValvG~~NvGKSSLln  207 (351)
T TIGR03156       186 RADVPTVALVGYTNAGKSTLFN  207 (351)
T ss_pred             ccCCcEEEEECCCCCCHHHHHH
Confidence            3568999999999999999986

This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]

Probab=90.40  E-value=0.073  Score=45.04  Aligned_cols=18  Identities=28%  Similarity=0.209  Sum_probs=15.4

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++-+-|+.||||||||+
T Consensus        32 ef~~lLGPSGcGKTTlLR   49 (352)
T COG3842          32 EFVTLLGPSGCGKTTLLR   49 (352)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            467788999999999973

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family

Probab=90.38  E-value=0.073  Score=44.84  Aligned_cols=17  Identities=47%  Similarity=0.442  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..|||||||++
T Consensus       346 ~~~ivG~sGsGKSTL~~  362 (544)
T TIGR01842       346 ALAIIGPSGSGKSTLAR  362 (544)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999964

Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion.

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional

Probab=90.33  E-value=0.067  Score=43.31  Aligned_cols=18  Identities=33%  Similarity=0.300  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++-|.|..|||||||++
T Consensus        43 e~~~ivG~sGsGKSTL~~   60 (330)
T PRK09473         43 ETLGIVGESGSGKSQTAF   60 (330)
T ss_pred             CEEEEECCCCchHHHHHH
Confidence            378899999999999963

>TIGR03499 FlhF flagellar biosynthetic protein FlhF

Probab=90.24  E-value=0.092  Score=41.63  Aligned_cols=17  Identities=29%  Similarity=0.327  Sum_probs=15.1

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -++.+.|..|+||||++
T Consensus       195 ~vi~~vGptGvGKTTt~  211 (282)
T TIGR03499       195 GVIALVGPTGVGKTTTL  211 (282)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            48889999999999974

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=90.16  E-value=0.082  Score=44.00  Aligned_cols=18  Identities=33%  Similarity=0.261  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -|.-|-|.+|+||||||+
T Consensus        28 ev~ailGPNGAGKSTlLk   45 (259)
T COG4559          28 EVLAILGPNGAGKSTLLK   45 (259)
T ss_pred             cEEEEECCCCccHHHHHH
Confidence            377889999999999973

>PRK05439 pantothenate kinase; Provisional

Probab=90.12  E-value=0.14  Score=42.38  Aligned_cols=20  Identities=35%  Similarity=0.619  Sum_probs=15.8

Q ss_pred             CCCCceEE-EecccCCCccCC
Q 033696           92 DNRIPATI-ITGFLGSGKNTG  111 (113)
Q Consensus        92 ~~riPvTI-iTGfLGsGKtTL  111 (113)
                      ..+.|.+| |+|..|||||||
T Consensus        82 ~~~~~~iIgIaG~~gsGKSTl  102 (311)
T PRK05439         82 GQKVPFIIGIAGSVAVGKSTT  102 (311)
T ss_pred             CCCCCEEEEEECCCCCCHHHH
Confidence            34556554 999999999998

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed

Probab=90.12  E-value=0.079  Score=45.24  Aligned_cols=17  Identities=29%  Similarity=0.307  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..|||||||++
T Consensus       368 ~~aivG~sGsGKSTL~~  384 (574)
T PRK11160        368 KVALLGRTGCGKSTLLQ  384 (574)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999964

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes

Probab=90.10  E-value=0.082  Score=41.13  Aligned_cols=20  Identities=30%  Similarity=0.084  Sum_probs=17.1

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +-.+++|+|..|+||||||+
T Consensus        30 ~g~~~~itG~N~~GKStll~   49 (222)
T cd03287          30 GGYCQIITGPNMGGKSSYIR   49 (222)
T ss_pred             CCcEEEEECCCCCCHHHHHH
Confidence            44688999999999999863

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein

Probab=90.08  E-value=0.08  Score=45.93  Aligned_cols=17  Identities=35%  Similarity=0.372  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..|||||||++
T Consensus       507 ~vaIvG~sGsGKSTLlk  523 (710)
T TIGR03796       507 RVALVGGSGSGKSTIAK  523 (710)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            45689999999999964

This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin.

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein

Probab=90.02  E-value=0.082  Score=45.80  Aligned_cols=17  Identities=41%  Similarity=0.325  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+-|+|..|||||||++
T Consensus       481 ~vaIvG~sGsGKSTLlk  497 (686)
T TIGR03797       481 FVAIVGPSGSGKSTLLR  497 (686)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            35689999999999964

Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif

>TIGR02236 recomb_radA DNA repair and recombination protein RadA

Probab=90.02  E-value=0.11  Score=40.74  Aligned_cols=17  Identities=35%  Similarity=0.346  Sum_probs=15.5

Q ss_pred             CceEEEecccCCCccCC
Q 033696           95 IPATIITGFLGSGKNTG  111 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTL  111 (113)
                      --||.|+|..|+|||+|
T Consensus        95 g~i~ei~G~~g~GKT~l  111 (310)
T TIGR02236        95 QAITEVFGEFGSGKTQI  111 (310)
T ss_pred             CeEEEEECCCCCCHHHH
Confidence            45899999999999998

This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein

Probab=89.98  E-value=0.082  Score=46.49  Aligned_cols=17  Identities=41%  Similarity=0.491  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..|||||||+|
T Consensus       509 ~vaIvG~SGsGKSTLl~  525 (711)
T TIGR00958       509 VVALVGPSGSGKSTVAA  525 (711)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999964

>PRK09361 radB DNA repair and recombination protein RadB; Provisional

Probab=89.83  E-value=0.12  Score=38.21  Aligned_cols=16  Identities=44%  Similarity=0.368  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +|.|+|..|+|||+|.
T Consensus        25 i~~i~G~~GsGKT~l~   40 (225)
T PRK09361         25 ITQIYGPPGSGKTNIC   40 (225)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            8999999999999973

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family

Probab=89.82  E-value=0.086  Score=45.71  Aligned_cols=17  Identities=41%  Similarity=0.462  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|+|..|||||||++
T Consensus       493 ~iaIvG~sGsGKSTLlk  509 (694)
T TIGR03375       493 KVAIIGRIGSGKSTLLK  509 (694)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46789999999999964

Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional

Probab=89.80  E-value=0.086  Score=47.22  Aligned_cols=18  Identities=44%  Similarity=0.421  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        51 EivgIiGpNGSGKSTLLk   68 (549)
T PRK13545         51 EIVGIIGLNGSGKSTLSN   68 (549)
T ss_pred             CEEEEEcCCCCCHHHHHH
Confidence            478899999999999974

>PLN03140 ABC transporter G family member; Provisional

Probab=89.80  E-value=0.09  Score=51.01  Aligned_cols=17  Identities=35%  Similarity=0.282  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       193 ~~~llGpnGSGKSTLLk  209 (1470)
T PLN03140        193 MTLLLGPPSSGKTTLLL  209 (1470)
T ss_pred             EEEEEcCCCCCHHHHHH
Confidence            68899999999999985

>PRK08533 flagellar accessory protein FlaH; Reviewed

Probab=89.80  E-value=0.12  Score=39.71  Aligned_cols=15  Identities=27%  Similarity=0.264  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      +++|+|..|+|||||
T Consensus        26 ~~~i~G~~G~GKTtl   40 (230)
T PRK08533         26 LILIEGDESTGKSIL   40 (230)
T ss_pred             EEEEECCCCCCHHHH
Confidence            899999999999998

>PRK00411 cdc6 cell division control protein 6; Reviewed

Probab=89.74  E-value=0.11  Score=41.24  Aligned_cols=21  Identities=33%  Similarity=0.385  Sum_probs=17.0

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+-+..+|+|..|.|||++++
T Consensus        53 ~~~~~~lI~G~~GtGKT~l~~   73 (394)
T PRK00411         53 SRPLNVLIYGPPGTGKTTTVK   73 (394)
T ss_pred             CCCCeEEEECCCCCCHHHHHH
Confidence            344668999999999999863

>cd01854 YjeQ_engC YjeQ/EngC

Probab=89.68  E-value=0.088  Score=41.75  Aligned_cols=18  Identities=28%  Similarity=0.401  Sum_probs=16.4

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++++.|..|+|||||+|
T Consensus       162 k~~~~~G~sg~GKSTlin  179 (287)
T cd01854         162 KTSVLVGQSGVGKSTLIN  179 (287)
T ss_pred             ceEEEECCCCCCHHHHHH
Confidence            479999999999999976

YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional

Probab=89.66  E-value=0.09  Score=44.53  Aligned_cols=17  Identities=35%  Similarity=0.485  Sum_probs=14.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|+|..|||||||++
T Consensus       369 ~iaIvG~SGsGKSTLl~  385 (592)
T PRK10790        369 FVALVGHTGSGKSTLAS  385 (592)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            45789999999999964

>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei

Probab=89.58  E-value=0.092  Score=46.16  Aligned_cols=17  Identities=29%  Similarity=0.298  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||++
T Consensus       480 ~~~IvG~nGsGKSTLl~  496 (659)
T TIGR00954       480 HLLICGPNGCGKSSLFR  496 (659)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999964

>PTZ00202 tuzin; Provisional

Probab=89.54  E-value=0.12  Score=46.84  Aligned_cols=16  Identities=38%  Similarity=0.663  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      |++|||..|+|||||+
T Consensus       288 ivvLtG~~G~GKTTLl  303 (550)
T PTZ00202        288 IVVFTGFRGCGKSSLC  303 (550)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            9999999999999995

>PRK08903 DnaA regulatory inactivator Hda; Validated

Probab=89.49  E-value=0.099  Score=38.76  Aligned_cols=18  Identities=22%  Similarity=0.060  Sum_probs=15.4

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -+..+++|.-|+|||+|+
T Consensus        42 ~~~~~l~G~~G~GKT~La   59 (227)
T PRK08903         42 DRFFYLWGEAGSGRSHLL   59 (227)
T ss_pred             CCeEEEECCCCCCHHHHH
Confidence            346799999999999985

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein

Probab=89.47  E-value=0.098  Score=50.16  Aligned_cols=17  Identities=35%  Similarity=0.323  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||||
T Consensus        89 ~~aIlG~nGsGKSTLLk  105 (1394)
T TIGR00956        89 LTVVLGRPGSGCSTLLK  105 (1394)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999985

>TIGR02858 spore_III_AA stage III sporulation protein AA

Probab=89.46  E-value=0.1  Score=41.90  Aligned_cols=22  Identities=32%  Similarity=0.289  Sum_probs=18.3

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+..-++|.|..|+||||||+
T Consensus       108 ~~~~~~~~i~g~~g~GKttl~~  129 (270)
T TIGR02858       108 NNRVLNTLIISPPQCGKTTLLR  129 (270)
T ss_pred             CCCeeEEEEEcCCCCCHHHHHH
Confidence            3445789999999999999974

Members of this protein are the stage III sporulation protein AA, encoded by one of several genes in the spoIIIA locus. It seems that this protein is found in a species if and only if that species is capable of endospore formation.

>TIGR00157 ribosome small subunit-dependent GTPase A

Probab=89.38  E-value=0.099  Score=40.67  Aligned_cols=17  Identities=24%  Similarity=0.366  Sum_probs=16.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++++.|..|.||+||+|
T Consensus       122 ~~~~~G~sgvGKStLiN  138 (245)
T TIGR00157       122 ISVFAGQSGVGKSSLIN  138 (245)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            89999999999999987

The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).

>COG1106 Predicted ATPases [General function prediction only]

Probab=89.32  E-value=0.13  Score=43.95  Aligned_cols=18  Identities=33%  Similarity=0.268  Sum_probs=16.9

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -||.||+|..|+|||.||
T Consensus        22 ~~in~I~G~N~sGKSNll   39 (371)
T COG1106          22 GKINIIYGANGAGKSNLL   39 (371)
T ss_pred             cceEEEEcCCCCchhHHH
Confidence            789999999999999986

>PRK10869 recombination and repair protein; Provisional

Probab=89.18  E-value=0.12  Score=45.07  Aligned_cols=17  Identities=41%  Similarity=0.544  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ..+||||..|||||.||
T Consensus        23 glnvitGetGaGKS~il   39 (553)
T PRK10869         23 GMTVITGETGAGKSIAI   39 (553)
T ss_pred             CcEEEECCCCCChHHHH
Confidence            68999999999999875

>PLN02840 tRNA dimethylallyltransferase

Probab=89.18  E-value=0.22  Score=43.24  Aligned_cols=19  Identities=26%  Similarity=0.415  Sum_probs=16.3

Q ss_pred             CCCceEEEecccCCCccCC
Q 033696           93 NRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTL  111 (113)
                      .+-++++|.|.-|||||||
T Consensus        19 ~~~~vi~I~GptgsGKTtl   37 (421)
T PLN02840         19 KKEKVIVISGPTGAGKSRL   37 (421)
T ss_pred             cCCeEEEEECCCCCCHHHH
Confidence            3445899999999999998

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]

Probab=89.11  E-value=0.096  Score=42.65  Aligned_cols=17  Identities=41%  Similarity=0.331  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -.||.|.-||||||+||
T Consensus       145 siii~G~t~sGKTt~ln  161 (312)
T COG0630         145 SIIICGGTASGKTTLLN  161 (312)
T ss_pred             cEEEECCCCCCHHHHHH
Confidence            36889999999999986

>PLN03140 ABC transporter G family member; Provisional

Probab=89.05  E-value=0.11  Score=50.49  Aligned_cols=17  Identities=35%  Similarity=0.427  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||||
T Consensus       908 l~aL~G~sGaGKTTLL~  924 (1470)
T PLN03140        908 LTALMGVSGAGKTTLMD  924 (1470)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999985

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein

Probab=89.02  E-value=0.11  Score=49.88  Aligned_cols=17  Identities=35%  Similarity=0.366  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||||
T Consensus       791 ~~aI~G~sGaGKSTLL~  807 (1394)
T TIGR00956       791 LTALMGASGAGKTTLLN  807 (1394)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999985

>PRK12288 GTPase RsgA; Reviewed

Probab=88.99  E-value=0.095  Score=43.42  Aligned_cols=17  Identities=29%  Similarity=0.372  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      +.++.|..|.||+||+|
T Consensus       207 i~~~vG~sgVGKSTLiN  223 (347)
T PRK12288        207 ISIFVGQSGVGKSSLIN  223 (347)
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            58999999999999987

>smart00053 DYNc Dynamin, GTPase

Probab=88.94  E-value=0.12  Score=41.01  Aligned_cols=22  Identities=23%  Similarity=0.326  Sum_probs=19.6

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .-..|..+|.|.-|+||||||+
T Consensus        23 ~i~~p~i~vvG~~~~GKSt~l~   44 (240)
T smart00053       23 DLDLPQIAVVGGQSAGKSSVLE   44 (240)
T ss_pred             CCCCCeEEEEcCCCccHHHHHH
Confidence            4678999999999999999975

Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and plasma membrane following an exocytic event.

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda

Probab=88.90  E-value=0.14  Score=37.28  Aligned_cols=20  Identities=25%  Similarity=0.059  Sum_probs=16.6

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ..-+.++|+|.-|+|||+|+
T Consensus        36 ~~~~~lll~G~~G~GKT~la   55 (226)
T TIGR03420        36 KGDRFLYLWGESGSGKSHLL   55 (226)
T ss_pred             CCCCeEEEECCCCCCHHHHH
Confidence            34567889999999999984

Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase

Probab=88.87  E-value=0.11  Score=42.96  Aligned_cols=18  Identities=44%  Similarity=0.418  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      --++|+|..||||||||+
T Consensus       179 ~~ili~G~tGsGKTTll~  196 (340)
T TIGR03819       179 LAFLISGGTGSGKTTLLS  196 (340)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            378999999999999874

Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.

>PRK14974 cell division protein FtsY; Provisional

Probab=88.85  E-value=0.16  Score=42.21  Aligned_cols=20  Identities=25%  Similarity=0.401  Sum_probs=16.6

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+--+++++|..|+||||++
T Consensus       138 ~~~~vi~~~G~~GvGKTTti  157 (336)
T PRK14974        138 GKPVVIVFVGVNGTGKTTTI  157 (336)
T ss_pred             CCCeEEEEEcCCCCCHHHHH
Confidence            34568999999999999964

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter

Probab=88.66  E-value=0.11  Score=45.21  Aligned_cols=17  Identities=47%  Similarity=0.587  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+-|+|..|||||||++
T Consensus       502 ~vaIvG~SGsGKSTLlk  518 (708)
T TIGR01193       502 KTTIVGMSGSGKSTLAK  518 (708)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            45789999999999963

This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]

Probab=88.65  E-value=0.24  Score=47.74  Aligned_cols=20  Identities=50%  Similarity=0.627  Sum_probs=17.5

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      +.=||+||.|..||||||=+
T Consensus       269 n~n~vvIIcGeTGsGKTTQv  288 (1172)
T KOG0926|consen  269 NENPVVIICGETGSGKTTQV  288 (1172)
T ss_pred             hcCCeEEEecCCCCCccccc
Confidence            45699999999999999953

>TIGR01448 recD_rel helicase, putative, RecD/TraA family

Probab=88.63  E-value=0.12  Score=46.43  Aligned_cols=17  Identities=41%  Similarity=0.507  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++.||||.-|+||||++
T Consensus       339 ~~~iitGgpGTGKTt~l  355 (720)
T TIGR01448       339 KVVILTGGPGTGKTTIT  355 (720)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            59999999999999986

This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD.

>PRK06067 flagellar accessory protein FlaH; Validated

Probab=88.61  E-value=0.17  Score=37.87  Aligned_cols=17  Identities=35%  Similarity=0.434  Sum_probs=15.0

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      =+++|+|..|+|||+|.
T Consensus        26 ~~~~i~G~~GsGKt~l~   42 (234)
T PRK06067         26 SLILIEGDHGTGKSVLS   42 (234)
T ss_pred             cEEEEECCCCCChHHHH
Confidence            38999999999999983

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]

Probab=88.45  E-value=0.2  Score=41.42  Aligned_cols=17  Identities=35%  Similarity=0.235  Sum_probs=15.3

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -|+=|.|.+|+||||+|
T Consensus        29 ei~GlLG~NGAGKTT~L   45 (245)
T COG4555          29 EITGLLGENGAGKTTLL   45 (245)
T ss_pred             eEEEEEcCCCCCchhHH
Confidence            47889999999999997

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed

Probab=88.34  E-value=0.15  Score=40.55  Aligned_cols=20  Identities=25%  Similarity=0.331  Sum_probs=16.9

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ...+..+++|..|+|||+|+
T Consensus        49 ~~~~~~ll~GppG~GKT~la   68 (328)
T PRK00080         49 EALDHVLLYGPPGLGKTTLA   68 (328)
T ss_pred             CCCCcEEEECCCCccHHHHH
Confidence            34567899999999999985

>TIGR02881 spore_V_K stage V sporulation protein K

Probab=88.29  E-value=0.24  Score=38.13  Aligned_cols=20  Identities=30%  Similarity=0.446  Sum_probs=16.8

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+.+-.+++|..|+||||+.
T Consensus        40 ~~~~~vll~GppGtGKTtlA   59 (261)
T TIGR02881        40 KQVLHMIFKGNPGTGKTTVA   59 (261)
T ss_pred             CCcceEEEEcCCCCCHHHHH
Confidence            45677899999999999973

Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.

>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional

Probab=88.29  E-value=0.13  Score=45.08  Aligned_cols=17  Identities=41%  Similarity=0.405  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|+|..|+||||||+
T Consensus        36 ~~~l~G~nGsGKSTLl~   52 (648)
T PRK10535         36 MVAIVGASGSGKSTLMN   52 (648)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]

Probab=88.28  E-value=0.12  Score=45.50  Aligned_cols=16  Identities=38%  Similarity=0.343  Sum_probs=13.7

Q ss_pred             EEEecccCCCccCCCC
Q 033696           98 TIITGFLGSGKNTGSA  113 (113)
Q Consensus        98 TIiTGfLGsGKtTLLn  113 (113)
                      +-|.|.+|+||||||+
T Consensus       351 iaiiG~NG~GKSTLlk  366 (530)
T COG0488         351 IAIVGPNGAGKSTLLK  366 (530)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            3578999999999974

>PLN03073 ABC transporter F family; Provisional

Probab=88.27  E-value=0.13  Score=46.31  Aligned_cols=17  Identities=29%  Similarity=0.178  Sum_probs=14.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+-|.|..||||||||+
T Consensus       205 ~~gLvG~NGsGKSTLLr  221 (718)
T PLN03073        205 HYGLVGRNGTGKTTFLR  221 (718)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            36688999999999974

>PRK10416 signal recognition particle-docking protein FtsY; Provisional

Probab=88.14  E-value=0.19  Score=41.11  Aligned_cols=19  Identities=26%  Similarity=0.368  Sum_probs=16.3

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +--|+.+.|..|+||||++
T Consensus       113 ~~~vi~lvGpnGsGKTTt~  131 (318)
T PRK10416        113 KPFVILVVGVNGVGKTTTI  131 (318)
T ss_pred             CCeEEEEECCCCCcHHHHH
Confidence            4568889999999999974

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family

Probab=88.12  E-value=0.13  Score=44.68  Aligned_cols=17  Identities=41%  Similarity=0.315  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|+|..|||||||++
T Consensus       485 ~vaivG~sGsGKSTL~~  501 (694)
T TIGR01846       485 FIGIVGPSGSGKSTLTK  501 (694)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            56799999999999964

Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion.

>PRK04301 radA DNA repair and recombination protein RadA; Validated

Probab=88.04  E-value=0.21  Score=39.80  Aligned_cols=17  Identities=35%  Similarity=0.313  Sum_probs=15.1

Q ss_pred             CceEEEecccCCCccCC
Q 033696           95 IPATIITGFLGSGKNTG  111 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTL  111 (113)
                      ==||.|+|..|+|||+|
T Consensus       102 g~vtei~G~~GsGKT~l  118 (317)
T PRK04301        102 QSITEFYGEFGSGKTQI  118 (317)
T ss_pred             CcEEEEECCCCCCHhHH
Confidence            34899999999999997

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]

Probab=87.98  E-value=0.17  Score=43.50  Aligned_cols=16  Identities=31%  Similarity=0.306  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++-+.|..||||||||
T Consensus        30 ~vaLlGpSGaGKsTlL   45 (345)
T COG1118          30 LVALLGPSGAGKSTLL   45 (345)
T ss_pred             EEEEECCCCCcHHHHH
Confidence            5778999999999997

>PRK12289 GTPase RsgA; Reviewed

Probab=87.95  E-value=0.13  Score=42.81  Aligned_cols=17  Identities=29%  Similarity=0.403  Sum_probs=15.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++++.|..|.||+||+|
T Consensus       174 i~v~iG~SgVGKSSLIN  190 (352)
T PRK12289        174 ITVVAGPSGVGKSSLIN  190 (352)
T ss_pred             eEEEEeCCCCCHHHHHH
Confidence            58999999999999987

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]

Probab=87.93  E-value=0.11  Score=42.56  Aligned_cols=17  Identities=35%  Similarity=0.368  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+-|+|..||||+|||+
T Consensus        30 f~fl~GpSGAGKSTllk   46 (223)
T COG2884          30 FVFLTGPSGAGKSTLLK   46 (223)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57799999999999974

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases

Probab=87.87  E-value=0.16  Score=38.32  Aligned_cols=19  Identities=32%  Similarity=0.183  Sum_probs=16.1

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +--+++|+|..|+|||||+
T Consensus        29 ~g~~~~i~g~~G~GKT~l~   47 (271)
T cd01122          29 KGELIILTAGTGVGKTTFL   47 (271)
T ss_pred             CCcEEEEEcCCCCCHHHHH
Confidence            3448999999999999974

Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.

>TIGR00630 uvra excinuclease ABC, A subunit

Probab=87.86  E-value=0.15  Score=47.74  Aligned_cols=17  Identities=53%  Similarity=0.505  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|||..|||||||++
T Consensus       635 iv~VtGvsGSGKSTLl~  651 (924)
T TIGR00630       635 FTCITGVSGSGKSTLIN  651 (924)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78999999999999963

This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).

>PLN03025 replication factor C subunit; Provisional

Probab=87.85  E-value=0.24  Score=39.27  Aligned_cols=21  Identities=38%  Similarity=0.670  Sum_probs=18.0

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      ..++|-.++.|..|+||||+.
T Consensus        31 ~~~~~~lll~Gp~G~GKTtla   51 (319)
T PLN03025         31 DGNMPNLILSGPPGTGKTTSI   51 (319)
T ss_pred             cCCCceEEEECCCCCCHHHHH
Confidence            356788999999999999974

>PLN03046 D-glycerate 3-kinase; Provisional

Probab=87.83  E-value=0.18  Score=44.74  Aligned_cols=18  Identities=33%  Similarity=0.362  Sum_probs=15.2

Q ss_pred             CceEE-EecccCCCccCCC
Q 033696           95 IPATI-ITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTI-iTGfLGsGKtTLL  112 (113)
                      -|++| |.|.-|||||||.
T Consensus       211 ~PlIIGIsG~qGSGKSTLa  229 (460)
T PLN03046        211 PPLVIGFSAPQGCGKTTLV  229 (460)
T ss_pred             CCEEEEEECCCCCCHHHHH
Confidence            56665 9999999999984

>PLN02348 phosphoribulokinase

Probab=87.68  E-value=0.24  Score=42.75  Aligned_cols=17  Identities=24%  Similarity=0.077  Sum_probs=14.0

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .|+=|+|..|||||||.
T Consensus        50 ~IIGIaG~SGSGKSTfA   66 (395)
T PLN02348         50 VVIGLAADSGCGKSTFM   66 (395)
T ss_pred             EEEEEECCCCCCHHHHH
Confidence            44449999999999984

>PRK13342 recombination factor protein RarA; Reviewed

Probab=87.41  E-value=0.25  Score=40.78  Aligned_cols=21  Identities=33%  Similarity=0.476  Sum_probs=18.0

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      ..++|..|++|..|+|||||.
T Consensus        33 ~~~~~~ilL~GppGtGKTtLA   53 (413)
T PRK13342         33 AGRLSSMILWGPPGTGKTTLA   53 (413)
T ss_pred             cCCCceEEEECCCCCCHHHHH
Confidence            356788999999999999984

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional

Probab=87.40  E-value=0.17  Score=42.74  Aligned_cols=20  Identities=30%  Similarity=0.125  Sum_probs=17.4

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .-+..++|+|--|+|||||.
T Consensus       217 ~~~~~IvI~G~~gsGKTTL~  236 (399)
T PRK08099        217 FFVRTVAILGGESSGKSTLV  236 (399)
T ss_pred             CCCcEEEEEcCCCCCHHHHH
Confidence            34778999999999999985

>PLN02674 adenylate kinase

Probab=87.32  E-value=0.27  Score=39.31  Aligned_cols=18  Identities=39%  Similarity=0.372  Sum_probs=15.5

Q ss_pred             CCceEEEecccCCCccCC
Q 033696           94 RIPATIITGFLGSGKNTG  111 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTL  111 (113)
                      ..+..+|.|..||||+|+
T Consensus        30 ~~~~i~l~G~PGsGKgT~   47 (244)
T PLN02674         30 PDKRLILIGPPGSGKGTQ   47 (244)
T ss_pred             cCceEEEECCCCCCHHHH
Confidence            346789999999999996

>PF03215 Rad17: Rad17 cell cycle checkpoint protein

Probab=87.31  E-value=0.19  Score=44.06  Aligned_cols=18  Identities=33%  Similarity=0.392  Sum_probs=15.8

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -.|.|+||+-|+||||.+
T Consensus        45 ~~iLlLtGP~G~GKtttv   62 (519)
T PF03215_consen   45 KRILLLTGPSGCGKTTTV   62 (519)
T ss_pred             cceEEEECCCCCCHHHHH
Confidence            349999999999999974

>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription]

Probab=87.28  E-value=0.2  Score=42.09  Aligned_cols=16  Identities=31%  Similarity=0.418  Sum_probs=14.4

Q ss_pred             EEEecccCCCccCCCC
Q 033696           98 TIITGFLGSGKNTGSA  113 (113)
Q Consensus        98 TIiTGfLGsGKtTLLn  113 (113)
                      .++.|..|+||||||+
T Consensus        43 cLlVGaNGaGKtTlLK   58 (291)
T KOG2355|consen   43 CLLVGANGAGKTTLLK   58 (291)
T ss_pred             EEEEecCCCchhhhHH
Confidence            6889999999999974

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)

Probab=87.26  E-value=0.16  Score=48.88  Aligned_cols=17  Identities=29%  Similarity=0.329  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       454 ~~~I~G~~GsGKSTLl~  470 (1490)
T TIGR01271       454 LLAVAGSTGSGKSSLLM  470 (1490)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68999999999999974

The model describes the cystis fibrosis transmembrane conductor regulator (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se.

>PRK03003 GTP-binding protein Der; Reviewed

Probab=87.25  E-value=0.19  Score=42.32  Aligned_cols=21  Identities=24%  Similarity=0.324  Sum_probs=19.1

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+|.++|.|..|+|||||+|
T Consensus        36 ~~~~~V~IvG~~nvGKSSL~n   56 (472)
T PRK03003         36 GPLPVVAVVGRPNVGKSTLVN   56 (472)
T ss_pred             CCCCEEEEEcCCCCCHHHHHH
Confidence            568999999999999999976

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family

Probab=87.22  E-value=0.23  Score=37.80  Aligned_cols=17  Identities=24%  Similarity=0.315  Sum_probs=15.0

Q ss_pred             CceEEEecccCCCccCC
Q 033696           95 IPATIITGFLGSGKNTG  111 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTL  111 (113)
                      ==+++|+|..|+|||+|
T Consensus        21 gs~~lI~G~pGsGKT~l   37 (237)
T TIGR03877        21 RNVVLLSGGPGTGKSIF   37 (237)
T ss_pred             CeEEEEEcCCCCCHHHH
Confidence            34789999999999997

Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated

Probab=87.21  E-value=0.21  Score=44.04  Aligned_cols=15  Identities=40%  Similarity=0.623  Sum_probs=13.9

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      +++++|+-||||||+
T Consensus       394 ~Ivl~Gl~GSGKSTi  408 (568)
T PRK05537        394 TVFFTGLSGAGKSTI  408 (568)
T ss_pred             EEEEECCCCChHHHH
Confidence            778899999999997

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA

Probab=87.16  E-value=0.17  Score=45.77  Aligned_cols=18  Identities=28%  Similarity=0.423  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .+.||+|+-|.||||+|+
T Consensus       369 ~~~il~G~aGTGKTtll~  386 (744)
T TIGR02768       369 DIAVVVGRAGTGKSTMLK  386 (744)
T ss_pred             CEEEEEecCCCCHHHHHH
Confidence            589999999999999863

This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed

Probab=87.06  E-value=0.27  Score=39.42  Aligned_cols=23  Identities=26%  Similarity=0.257  Sum_probs=18.5

Q ss_pred             CCCCCCCceEEEecccCCCccCC
Q 033696           89 IPPDNRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        89 ~~~~~riPvTIiTGfLGsGKtTL  111 (113)
                      .+.-++-..++++|+.||||||+
T Consensus       127 ~~~~~~~~~I~l~G~~GsGKStv  149 (309)
T PRK08154        127 GRRAARRRRIALIGLRGAGKSTL  149 (309)
T ss_pred             hhhccCCCEEEEECCCCCCHHHH
Confidence            34455566899999999999997

>TIGR02928 orc1/cdc6 family replication initiation protein

Probab=87.06  E-value=0.2  Score=39.19  Aligned_cols=19  Identities=32%  Similarity=0.431  Sum_probs=16.3

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +-+..+|+|..|+|||+++
T Consensus        39 ~~~~i~I~G~~GtGKT~l~   57 (365)
T TIGR02928        39 RPSNVFIYGKTGTGKTAVT   57 (365)
T ss_pred             CCCcEEEECCCCCCHHHHH
Confidence            4467899999999999985

Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]

Probab=86.97  E-value=0.2  Score=49.09  Aligned_cols=18  Identities=44%  Similarity=0.553  Sum_probs=16.5

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -|.|+|-|..|+||||..
T Consensus        27 sPlTLIvG~NG~GKTTiI   44 (1294)
T KOG0962|consen   27 SPLTLIVGANGTGKTTII   44 (1294)
T ss_pred             CCeeeEecCCCCCchhHH
Confidence            599999999999999974

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]

Probab=86.77  E-value=0.2  Score=42.67  Aligned_cols=17  Identities=35%  Similarity=0.399  Sum_probs=15.1

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -.+++-|..||||||+|
T Consensus        28 ef~vliGpSGsGKTTtL   44 (309)
T COG1125          28 EFLVLIGPSGSGKTTTL   44 (309)
T ss_pred             eEEEEECCCCCcHHHHH
Confidence            36889999999999986

>PTZ00243 ABC transporter; Provisional

Probab=86.74  E-value=0.18  Score=48.99  Aligned_cols=17  Identities=41%  Similarity=0.481  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       688 ~~~IiG~nGsGKSTLL~  704 (1560)
T PTZ00243        688 LTVVLGATGSGKSTLLQ  704 (1560)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            68999999999999974

>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=86.67  E-value=0.22  Score=41.39  Aligned_cols=18  Identities=39%  Similarity=0.213  Sum_probs=15.8

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      =-||-+-|+.|+||+|||
T Consensus        27 g~iTs~IGPNGAGKSTLL   44 (252)
T COG4604          27 GGITSIIGPNGAGKSTLL   44 (252)
T ss_pred             CceeEEECCCCccHHHHH
Confidence            347889999999999996

>TIGR00416 sms DNA repair protein RadA

Probab=86.66  E-value=0.21  Score=42.71  Aligned_cols=16  Identities=38%  Similarity=0.318  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|.|..|+|||||+
T Consensus        96 vilI~G~pGsGKTTL~  111 (454)
T TIGR00416        96 LILIGGDPGIGKSTLL  111 (454)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            8999999999999985

The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).

>PTZ00035 Rad51 protein; Provisional

Probab=86.64  E-value=0.24  Score=40.72  Aligned_cols=18  Identities=22%  Similarity=0.126  Sum_probs=15.7

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -=+|.|+|..|+|||+|+
T Consensus       118 G~iteI~G~~GsGKT~l~  135 (337)
T PTZ00035        118 GSITELFGEFRTGKTQLC  135 (337)
T ss_pred             CeEEEEECCCCCchhHHH
Confidence            348999999999999984

>PRK09866 hypothetical protein; Provisional

Probab=86.56  E-value=0.19  Score=46.90  Aligned_cols=18  Identities=28%  Similarity=0.313  Sum_probs=17.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      |++.|.|..|+|||||+|
T Consensus        70 ~~valvG~sgaGKSTLiN   87 (741)
T PRK09866         70 MVLAIVGTMKAGKSTTIN   87 (741)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            999999999999999976

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed

Probab=86.44  E-value=0.22  Score=45.53  Aligned_cols=18  Identities=28%  Similarity=0.235  Sum_probs=16.2

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -.+.||||.+++||||+|
T Consensus       327 ~~~~iITGpN~gGKTt~l  344 (782)
T PRK00409        327 KTVLVITGPNTGGKTVTL  344 (782)
T ss_pred             ceEEEEECCCCCCcHHHH
Confidence            458999999999999986

>PLN02772 guanylate kinase

Probab=86.37  E-value=0.28  Score=42.44  Aligned_cols=32  Identities=22%  Similarity=0.251  Sum_probs=21.2

Q ss_pred             ccccccCCC--CCCCCceEEEecccCCCccCCCC
Q 033696           82 DSDLLTKIP--PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        82 ~s~~~~~~~--~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +++|.....  +..+.-+.||+|+.|+||+||++
T Consensus       120 ~~eV~~~~~~~~~~~~k~iVlsGPSGvGKsTL~~  153 (398)
T PLN02772        120 GTEVVAWSKGVRGNAEKPIVISGPSGVGKGTLIS  153 (398)
T ss_pred             cceeeecccCCCCCCCcEEEEECCCCCCHHHHHH
Confidence            444444432  33333478999999999999863

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]

Probab=86.35  E-value=0.18  Score=41.23  Aligned_cols=17  Identities=41%  Similarity=0.325  Sum_probs=14.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -..|||+.|+||+|||+
T Consensus        31 ~iaitGPSG~GKStllk   47 (223)
T COG4619          31 FIAITGPSGCGKSTLLK   47 (223)
T ss_pred             eEEEeCCCCccHHHHHH
Confidence            35789999999999963

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1

Probab=86.26  E-value=0.33  Score=39.67  Aligned_cols=15  Identities=27%  Similarity=0.215  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      ||.|+|..|+|||+|
T Consensus        98 iteI~G~~GsGKTql  112 (313)
T TIGR02238        98 ITEVFGEFRCGKTQL  112 (313)
T ss_pred             EEEEECCCCCCcCHH
Confidence            999999999999997

This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.

>PRK06851 hypothetical protein; Provisional

Probab=86.26  E-value=0.19  Score=42.55  Aligned_cols=18  Identities=33%  Similarity=0.276  Sum_probs=16.0

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -.+.||+|..|+|||||+
T Consensus        30 ~~~~il~G~pGtGKStl~   47 (367)
T PRK06851         30 NRIFILKGGPGTGKSTLM   47 (367)
T ss_pred             ceEEEEECCCCCCHHHHH
Confidence            357999999999999986

>cd01849 YlqF_related_GTPase YlqF-related GTPases

Probab=86.10  E-value=0.26  Score=34.66  Aligned_cols=21  Identities=14%  Similarity=0.213  Sum_probs=17.5

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+...+.+.|..|+||+||+|
T Consensus        98 ~~~~~~~~~G~~~~GKstlin  118 (155)
T cd01849          98 KKSITVGVIGYPNVGKSSVIN  118 (155)
T ss_pred             ccCcEEEEEccCCCCHHHHHH
Confidence            345667899999999999976

These proteins are found in bacteria, eukaryotes, and archaea. They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.

>PRK04863 mukB cell division protein MukB; Provisional

Probab=86.07  E-value=0.21  Score=49.05  Aligned_cols=18  Identities=39%  Similarity=0.431  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .+++|+|..|+||||+|+
T Consensus        28 ~~~~l~G~NGaGKSTll~   45 (1486)
T PRK04863         28 LVTTLSGGNGAGKSTTMA   45 (1486)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            599999999999999863

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family

Probab=86.00  E-value=0.3  Score=36.13  Aligned_cols=17  Identities=29%  Similarity=0.233  Sum_probs=14.9

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      =+++|.|..|+|||||.
T Consensus        21 ~~~~i~G~~G~GKT~l~   37 (229)
T TIGR03881        21 FFVAVTGEPGTGKTIFC   37 (229)
T ss_pred             eEEEEECCCCCChHHHH
Confidence            36899999999999973

Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.

>PLN02748 tRNA dimethylallyltransferase

Probab=85.95  E-value=0.48  Score=41.45  Aligned_cols=20  Identities=25%  Similarity=0.411  Sum_probs=17.2

Q ss_pred             CCCCceEEEecccCCCccCC
Q 033696           92 DNRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTL  111 (113)
                      ..+-++++|.|..|+|||+|
T Consensus        19 ~~~~~~i~i~GptgsGKs~l   38 (468)
T PLN02748         19 KGKAKVVVVMGPTGSGKSKL   38 (468)
T ss_pred             CCCCCEEEEECCCCCCHHHH
Confidence            45566899999999999998

>PRK05973 replicative DNA helicase; Provisional

Probab=85.82  E-value=0.28  Score=39.07  Aligned_cols=18  Identities=17%  Similarity=0.062  Sum_probs=15.5

Q ss_pred             CCceEEEecccCCCccCC
Q 033696           94 RIPATIITGFLGSGKNTG  111 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTL  111 (113)
                      +==+++|.|..|+|||+|
T Consensus        63 ~Gsl~LIaG~PG~GKT~l   80 (237)
T PRK05973         63 PGDLVLLGARPGHGKTLL   80 (237)
T ss_pred             CCCEEEEEeCCCCCHHHH
Confidence            334899999999999997

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit

Probab=85.78  E-value=0.21  Score=44.21  Aligned_cols=18  Identities=39%  Similarity=0.440  Sum_probs=16.1

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      =+++||+|..|+||||++
T Consensus       160 ~~~~vitGgpGTGKTt~v  177 (586)
T TIGR01447       160 SNFSLITGGPGTGKTTTV  177 (586)
T ss_pred             CCeEEEEcCCCCCHHHHH
Confidence            479999999999999964

This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. A related family in the Gram-positive bacteria separates in a phylogenetic tree, has an additional N-terminal extension of about 200 residues, and is not supported as a member of a RecBCD complex by neighboring genes. The related family is consequently described by a different model.

>TIGR02655 circ_KaiC circadian clock protein KaiC

Probab=85.76  E-value=0.29  Score=41.60  Aligned_cols=16  Identities=31%  Similarity=0.507  Sum_probs=14.6

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      =+++|+|..|+|||||
T Consensus        22 ~~~Li~G~pGsGKT~l   37 (484)
T TIGR02655        22 RSTLVSGTSGTGKTLF   37 (484)
T ss_pred             eEEEEEcCCCCCHHHH
Confidence            3789999999999998

Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.

>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]

Probab=85.73  E-value=0.17  Score=41.70  Aligned_cols=14  Identities=43%  Similarity=0.498  Sum_probs=12.3

Q ss_pred             EecccCCCccCCCC
Q 033696          100 ITGFLGSGKNTGSA  113 (113)
Q Consensus       100 iTGfLGsGKtTLLn  113 (113)
                      |-|.+||||||||+
T Consensus        58 iiG~NGaGKSTLlk   71 (249)
T COG1134          58 IIGHNGAGKSTLLK   71 (249)
T ss_pred             EECCCCCcHHHHHH
Confidence            56999999999974

>PLN02796 D-glycerate 3-kinase

Probab=85.72  E-value=0.21  Score=42.32  Aligned_cols=16  Identities=31%  Similarity=0.204  Sum_probs=13.7

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++-|.|.-|||||||+
T Consensus       102 iIGI~G~sGSGKSTLa  117 (347)
T PLN02796        102 VIGISAPQGCGKTTLV  117 (347)
T ss_pred             EEEEECCCCCcHHHHH
Confidence            5568899999999985

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional

Probab=85.65  E-value=0.27  Score=41.76  Aligned_cols=17  Identities=29%  Similarity=0.354  Sum_probs=15.4

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -++++.|..|+||||++
T Consensus       138 ~ii~lvGptGvGKTTti  154 (374)
T PRK14722        138 GVFALMGPTGVGKTTTT  154 (374)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            48999999999999985

>PRK04328 hypothetical protein; Provisional

Probab=85.64  E-value=0.31  Score=37.75  Aligned_cols=15  Identities=27%  Similarity=0.430  Sum_probs=14.2

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      +++|+|..|+|||+|
T Consensus        25 ~ili~G~pGsGKT~l   39 (249)
T PRK04328         25 VVLLSGGPGTGKSIF   39 (249)
T ss_pred             EEEEEcCCCCCHHHH
Confidence            799999999999997

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional

Probab=85.40  E-value=0.36  Score=40.34  Aligned_cols=16  Identities=31%  Similarity=0.100  Sum_probs=14.9

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      =||.|+|..|+|||+|
T Consensus       127 ~ItEI~G~~GsGKTql  142 (344)
T PLN03187        127 CITEAFGEFRSGKTQL  142 (344)
T ss_pred             eEEEEecCCCCChhHH
Confidence            4899999999999997

>PRK04220 2-phosphoglycerate kinase; Provisional

Probab=85.39  E-value=0.38  Score=40.02  Aligned_cols=18  Identities=33%  Similarity=0.469  Sum_probs=15.2

Q ss_pred             CCc-eEEEecccCCCccCC
Q 033696           94 RIP-ATIITGFLGSGKNTG  111 (113)
Q Consensus        94 riP-vTIiTGfLGsGKtTL  111 (113)
                      +.| +.+|+|..|+||||+
T Consensus        90 ~~p~iIlI~G~sgsGKStl  108 (301)
T PRK04220         90 KEPIIILIGGASGVGTSTI  108 (301)
T ss_pred             CCCEEEEEECCCCCCHHHH
Confidence            456 677899999999997

>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type

Probab=85.38  E-value=0.25  Score=40.25  Aligned_cols=19  Identities=26%  Similarity=0.230  Sum_probs=16.2

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      ...++|.|..|+|||||.|
T Consensus       162 ~~~~~~~G~~~~gkstl~~  180 (325)
T TIGR01526       162 VKTVAILGGESTGKSTLVN  180 (325)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            4578999999999999954

E. coli NadR has also been found to regulate the import of its substrate, nicotinamide ribonucleotide, but it is not known if the other members of this model share that activity.

>PRK09183 transposase/IS protein; Provisional

Probab=85.34  E-value=0.23  Score=39.05  Aligned_cols=17  Identities=24%  Similarity=0.319  Sum_probs=14.9

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ..++|.|..|+|||+|.
T Consensus       103 ~~v~l~Gp~GtGKThLa  119 (259)
T PRK09183        103 ENIVLLGPSGVGKTHLA  119 (259)
T ss_pred             CeEEEEeCCCCCHHHHH
Confidence            46889999999999984

>COG1162 Predicted GTPases [General function prediction only]

Probab=85.32  E-value=0.27  Score=41.18  Aligned_cols=17  Identities=35%  Similarity=0.403  Sum_probs=16.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++|+.|-.|.||+||+|
T Consensus       166 ~svl~GqSGVGKSSLiN  182 (301)
T COG1162         166 ITVLLGQSGVGKSTLIN  182 (301)
T ss_pred             eEEEECCCCCcHHHHHH
Confidence            89999999999999987

>PRK10875 recD exonuclease V subunit alpha; Provisional

Probab=85.28  E-value=0.27  Score=44.06  Aligned_cols=18  Identities=33%  Similarity=0.444  Sum_probs=16.2

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      =+++||||..|.||||++
T Consensus       167 ~~~~vItGgpGTGKTt~v  184 (615)
T PRK10875        167 RRISVISGGPGTGKTTTV  184 (615)
T ss_pred             CCeEEEEeCCCCCHHHHH
Confidence            479999999999999974

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]

Probab=85.13  E-value=0.36  Score=41.74  Aligned_cols=21  Identities=33%  Similarity=0.408  Sum_probs=17.4

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      +.+-..++|||..||||||-|
T Consensus       122 ~~~~GLILVTGpTGSGKSTTl  142 (353)
T COG2805         122 ESPRGLILVTGPTGSGKSTTL  142 (353)
T ss_pred             hCCCceEEEeCCCCCcHHHHH
Confidence            455678999999999999864

>TIGR00064 ftsY signal recognition particle-docking protein FtsY

Probab=85.00  E-value=0.35  Score=38.51  Aligned_cols=20  Identities=30%  Similarity=0.426  Sum_probs=15.9

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+.-+++++|..|+||||++
T Consensus        70 ~~~~vi~l~G~~G~GKTTt~   89 (272)
T TIGR00064        70 NKPNVILFVGVNGVGKTTTI   89 (272)
T ss_pred             CCCeEEEEECCCCCcHHHHH
Confidence            33457888899999999963

There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.

>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only]

Probab=84.99  E-value=0.41  Score=39.71  Aligned_cols=17  Identities=29%  Similarity=0.356  Sum_probs=14.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .=.|-|++|+||||++.
T Consensus        33 lr~lIGpNGAGKTT~mD   49 (249)
T COG4674          33 LRVLIGPNGAGKTTLMD   49 (249)
T ss_pred             EEEEECCCCCCceeeee
Confidence            34677999999999963

>cd01857 HSR1_MMR1 HSR1/MMR1

Probab=84.80  E-value=0.23  Score=34.49  Aligned_cols=17  Identities=18%  Similarity=0.253  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ..++.|..|+|||||+|
T Consensus        85 ~~~~~G~~~vGKstlin  101 (141)
T cd01857          85 TIGLVGYPNVGKSSLIN  101 (141)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57889999999999976

Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.

>PLN02318 phosphoribulokinase/uridine kinase

Probab=84.75  E-value=0.28  Score=45.17  Aligned_cols=20  Identities=25%  Similarity=0.262  Sum_probs=17.2

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+.-|+-|.|..|||||||.
T Consensus        63 ~~riIIGIaGpSGSGKTTLA   82 (656)
T PLN02318         63 DGIILVGVAGPSGAGKTVFT   82 (656)
T ss_pred             CCeEEEEEECCCCCcHHHHH
Confidence            45678889999999999985

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair

Probab=84.73  E-value=0.36  Score=39.29  Aligned_cols=20  Identities=25%  Similarity=0.275  Sum_probs=15.6

Q ss_pred             CCCCceEEEecccCCCccCC
Q 033696           92 DNRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTL  111 (113)
                      ...+|=.|+.|+.|.|||||
T Consensus        47 ~~~l~h~lf~GPPG~GKTTL   66 (233)
T PF05496_consen   47 GEALDHMLFYGPPGLGKTTL   66 (233)
T ss_dssp             TS---EEEEESSTTSSHHHH
T ss_pred             CCCcceEEEECCCccchhHH
Confidence            45689999999999999998

Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional

Probab=84.72  E-value=0.26  Score=42.38  Aligned_cols=17  Identities=29%  Similarity=0.360  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -++.+.|..|+||||+|
T Consensus       192 ~vi~lvGpnG~GKTTtl  208 (420)
T PRK14721        192 GVYALIGPTGVGKTTTT  208 (420)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            58999999999999986

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=84.67  E-value=0.32  Score=40.43  Aligned_cols=17  Identities=35%  Similarity=0.344  Sum_probs=15.3

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -||-+-|+.|+||+|||
T Consensus        34 ~VTAlIGPSGcGKST~L   50 (253)
T COG1117          34 KVTALIGPSGCGKSTLL   50 (253)
T ss_pred             ceEEEECCCCcCHHHHH
Confidence            47888999999999996

>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion]

Probab=84.66  E-value=0.24  Score=45.58  Aligned_cols=20  Identities=30%  Similarity=0.388  Sum_probs=17.4

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+.=|.|.|.-|+||||||+
T Consensus       435 d~ghT~I~G~tGaGKTvLl~  454 (796)
T COG3451         435 DVGHTLIIGPTGAGKTVLLS  454 (796)
T ss_pred             CCCCeEEECCCCCCHHHHHH
Confidence            44589999999999999974

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)

Probab=84.39  E-value=0.27  Score=47.42  Aligned_cols=17  Identities=24%  Similarity=0.401  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..||||||||+
T Consensus       666 ~v~IvG~~GsGKSTLl~  682 (1522)
T TIGR00957       666 LVAVVGQVGCGKSSLLS  682 (1522)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999974

This model describes multi drug resistance-associated protein (MRP) in eukaryotes. The multidrug resistance-associated protein is an integral membrane protein that causes multidrug resistance when overexpressed in mammalian cells. It belongs to ABC transporter superfamily. The protein topology and function was experimentally demonstrated by epitope tagging and immunofluorescence. Insertion of tags in the critical regions associated with drug efflux, abrogated its function. The C-terminal domain seem to highly conserved.

>TIGR02239 recomb_RAD51 DNA repair protein RAD51

Probab=84.38  E-value=0.46  Score=38.71  Aligned_cols=20  Identities=25%  Similarity=0.145  Sum_probs=16.7

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+-=||+|.|..|+|||+|.
T Consensus        94 ~~g~i~~i~G~~g~GKT~l~  113 (316)
T TIGR02239        94 ETGSITEIFGEFRTGKTQLC  113 (316)
T ss_pred             CCCeEEEEECCCCCCcCHHH
Confidence            33558999999999999984

This eukaryotic sequence family consists of RAD51, a protein involved in DNA homologous recombination and repair. It is similar in sequence the exclusively meiotic recombinase DMC1 (TIGR02238), to archaeal families RadA (TIGR02236) and RadB (TIGR02237), and to bacterial RecA (TIGR02012).

>PLN03232 ABC transporter C family member; Provisional

Probab=84.24  E-value=0.28  Score=47.28  Aligned_cols=17  Identities=29%  Similarity=0.307  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..||||||||+
T Consensus       645 ~vaIvG~sGSGKSTLl~  661 (1495)
T PLN03232        645 LVAIVGGTGEGKTSLIS  661 (1495)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            67899999999999974

>COG2262 HflX GTPases [General function prediction only]

Probab=84.22  E-value=0.31  Score=42.66  Aligned_cols=26  Identities=27%  Similarity=0.388  Sum_probs=22.8

Q ss_pred             CCCCCCCCceEEEecccCCCccCCCC
Q 033696           88 KIPPDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        88 ~~~~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+....+|..-+.||-.+||+||+|
T Consensus       185 ~~R~~~~~p~vaLvGYTNAGKSTL~N  210 (411)
T COG2262         185 KKRSRSGIPLVALVGYTNAGKSTLFN  210 (411)
T ss_pred             hhhcccCCCeEEEEeeccccHHHHHH
Confidence            44556789999999999999999987

>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair]

Probab=84.12  E-value=0.35  Score=41.41  Aligned_cols=17  Identities=24%  Similarity=0.309  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .++|++|.+|+|||.||
T Consensus        24 ~~nvl~G~NgqGKTNlL   40 (363)
T COG1195          24 GVNVLVGENGQGKTNLL   40 (363)
T ss_pred             CcEEEECCCCCchHHHH
Confidence            57999999999999886

>TIGR03348 VI_IcmF type VI secretion protein IcmF

Probab=84.11  E-value=0.34  Score=45.75  Aligned_cols=21  Identities=33%  Similarity=0.381  Sum_probs=18.8

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      -.+|-.+|.|.-||||||||+
T Consensus       109 Y~LPWYlviG~~gsGKtt~l~  129 (1169)
T TIGR03348       109 YDLPWYLVIGPPGSGKTTLLQ  129 (1169)
T ss_pred             hcCCCEEEECCCCCchhHHHH
Confidence            358999999999999999974

Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems.

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed

Probab=84.03  E-value=0.3  Score=45.86  Aligned_cols=17  Identities=47%  Similarity=0.487  Sum_probs=0.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|||..|||||||+.
T Consensus       637 ivgVtGvsGSGKSTLl~  653 (943)
T PRK00349        637 FTCVTGVSGSGKSTLIN  653 (943)
T ss_pred             EEEEEcCCCCCHHHHHH

>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes

Probab=83.97  E-value=0.37  Score=37.39  Aligned_cols=19  Identities=26%  Similarity=0.107  Sum_probs=16.7

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +-.+.+|||..|+||||||
T Consensus        29 ~~~~~~itG~n~~gKs~~l   47 (218)
T cd03286          29 SPRILVLTGPNMGGKSTLL   47 (218)
T ss_pred             CCcEEEEECCCCCchHHHH
Confidence            3468999999999999986

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c

>PRK13853 type IV secretion system protein VirB4; Provisional

Probab=83.72  E-value=0.35  Score=43.69  Aligned_cols=20  Identities=35%  Similarity=0.395  Sum_probs=17.5

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      .++-++|.|..|||||||+|
T Consensus       425 ~~g~~~I~G~tGsGKS~l~~  444 (789)
T PRK13853        425 DVGMTAIFGPIGRGKTTLMT  444 (789)
T ss_pred             CCCEEEEECCCCCCHHHHHH
Confidence            36779999999999999964

>PLN02459 probable adenylate kinase

Probab=83.55  E-value=0.62  Score=37.95  Aligned_cols=15  Identities=33%  Similarity=0.375  Sum_probs=13.1

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      ..||.|..||||+|+
T Consensus        31 ~ii~~G~PGsGK~T~   45 (261)
T PLN02459         31 NWVFLGCPGVGKGTY   45 (261)
T ss_pred             EEEEECCCCCCHHHH
Confidence            467789999999996

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase

Probab=83.43  E-value=0.44  Score=42.13  Aligned_cols=19  Identities=32%  Similarity=0.420  Sum_probs=16.6

Q ss_pred             CCCceEEEecccCCCccCC
Q 033696           93 NRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTL  111 (113)
                      .+--++|+.|+.||||||+
T Consensus       367 ~~p~LVil~G~pGSGKST~  385 (526)
T TIGR01663       367 APCEMVIAVGFPGAGKSHF  385 (526)
T ss_pred             CCceEEEEECCCCCCHHHH
Confidence            4456899999999999997

Note that the EC number for the kinase function is: 2.7.1.78

>PRK15494 era GTPase Era; Provisional

Probab=83.42  E-value=0.36  Score=39.24  Aligned_cols=21  Identities=29%  Similarity=0.232  Sum_probs=17.7

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ++..-++|.|..|+|||||+|
T Consensus        50 ~k~~kV~ivG~~nvGKSTLin   70 (339)
T PRK15494         50 QKTVSVCIIGRPNSGKSTLLN   70 (339)
T ss_pred             cceeEEEEEcCCCCCHHHHHH
Confidence            455578899999999999986

>PRK13898 type IV secretion system ATPase VirB4; Provisional

Probab=83.34  E-value=0.37  Score=43.31  Aligned_cols=20  Identities=30%  Similarity=0.376  Sum_probs=17.7

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+-++|.|..|+|||||+|
T Consensus       445 ~~~~~~i~G~tGsGKS~l~~  464 (800)
T PRK13898        445 DVGHTLIIGPTGAGKTVLMN  464 (800)
T ss_pred             CCCEEEEECCCCCcHHHHHH
Confidence            36889999999999999864

>PRK10536 hypothetical protein; Provisional

Probab=83.22  E-value=0.5  Score=38.87  Aligned_cols=17  Identities=29%  Similarity=0.180  Sum_probs=15.8

Q ss_pred             CceEEEecccCCCccCC
Q 033696           95 IPATIITGFLGSGKNTG  111 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTL  111 (113)
                      .++++++|.-|+|||+|
T Consensus        74 ~~lV~i~G~aGTGKT~L   90 (262)
T PRK10536         74 KQLIFATGEAGCGKTWI   90 (262)
T ss_pred             CCeEEEECCCCCCHHHH
Confidence            57999999999999987

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]

Probab=83.21  E-value=0.37  Score=40.27  Aligned_cols=17  Identities=29%  Similarity=0.286  Sum_probs=14.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ..+|-|-.||||+||||
T Consensus        34 FvtViGsNGAGKSTlln   50 (263)
T COG1101          34 FVTVIGSNGAGKSTLLN   50 (263)
T ss_pred             eEEEEcCCCccHHHHHH
Confidence            34566999999999987

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Length	Definition	E-value
Query	113
1nij_A	318	Hypothetical protein YJIA; structural genomics, P-	3e-07
1vt4_I	1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04

>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Length = 318

 Score = 46.0 bits (110), Expect = 3e-07
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 93  NRIPATIITGFLGSGKNT 110
           N I  T++TGFLG+GK T
Sbjct: 2   NPIAVTLLTGFLGAGKTT 19

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221

 Score = 37.1 bits (85), Expect = 5e-04
 Identities = 22/107 (20%), Positives = 36/107 (33%), Gaps = 24/107 (22%)

Query: 7   TEMATTFLSFTARPQNPF--AKIRTTVLPVLFKPRARNLSYKTMPSSTHSE---FIAFKV 61
            EM   F+    R    F  + I+T       +P      Y       +++   F  + V
Sbjct: 76  EEMVQKFVEEVLRINYKFLMSPIKTEQR----QPSMMTRMYIEQRDRLYNDNQVFAKYNV 131

Query: 62  PRPYRRFTASASAAATTASEDSDLLTKIPPDNRIPATIITGFLGSGK 108
            R  + +     A           L ++ P   +   +I G LGSGK
Sbjct: 132 SRL-QPYLKLRQA-----------LLELRPAKNV---LIDGVLGSGK 163

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	113
2wsm_A	221	Hydrogenase expression/formation protein (HYPB); m	97.2
2hf9_A	226	Probable hydrogenase nickel incorporation protein	96.97
2www_A	349	Methylmalonic aciduria type A protein, mitochondri	96.82
3lnc_A	231	Guanylate kinase, GMP kinase; ALS collaborative cr	96.47
2ehv_A	251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	96.42
4eun_A	200	Thermoresistant glucokinase; putative sugar kinase	96.37
1znw_A	207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	96.32
3pqc_A	195	Probable GTP-binding protein ENGB; rossmann fold,	96.3
1svi_A	195	GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro	96.24
1htw_A	158	HI0065; nucleotide-binding fold, structural genomi	96.21
3kta_A	182	Chromosome segregation protein SMC; structural mai	96.2
4a74_A	231	DNA repair and recombination protein RADA; hydrola	96.18
2pcj_A	224	ABC transporter, lipoprotein-releasing system ATP-	96.14
1pui_A	210	ENGB, probable GTP-binding protein ENGB; structura	96.12
3tif_A	235	Uncharacterized ABC transporter ATP-binding prote;	96.1
3c8u_A	208	Fructokinase; YP_612366.1, putative fructose trans	96.08
1ji0_A	240	ABC transporter; ATP binding protein, structural g	96.02
3b85_A	208	Phosphate starvation-inducible protein; PHOH2, ATP	96.0
2eyu_A	261	Twitching motility protein PILT; pilus retraction	96.0
1g6h_A	257	High-affinity branched-chain amino acid transport	95.96
3uie_A	200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	95.95
2cbz_A	237	Multidrug resistance-associated protein 1; ABC pro	95.94
1mv5_A	243	LMRA, multidrug resistance ABC transporter ATP-bin	95.92
1b0u_A	262	Histidine permease; ABC transporter, transport pro	95.88
2pze_A	229	Cystic fibrosis transmembrane conductance regulat;	95.88
2onk_A	240	Molybdate/tungstate ABC transporter, ATP-binding p	95.86
3qf7_A	365	RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.	95.85
1sgw_A	214	Putative ABC transporter; structural genomics, P p	95.84
2d2e_A	250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	95.82
1z6g_A	218	Guanylate kinase; structural genomics, SGC, struct	95.82
2olj_A	263	Amino acid ABC transporter; ABC domain, ATPase, hy	95.81
1f2t_A	149	RAD50 ABC-ATPase; DNA double-strand break repair,	95.81
2bbw_A	246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	95.8
2qi9_C	249	Vitamin B12 import ATP-binding protein BTUD; inner	95.79
2yz2_A	266	Putative ABC transporter ATP-binding protein TM_0;	95.78
2zu0_C	267	Probable ATP-dependent transporter SUFC; iron-sulf	95.78
2ff7_A	247	Alpha-hemolysin translocation ATP-binding protein	95.75
1vpl_A	256	ABC transporter, ATP-binding protein; TM0544, stru	95.75
2ixe_A	271	Antigen peptide transporter 1; ABC ATPase, hydrola	95.72
2ihy_A	279	ABC transporter, ATP-binding protein; ATPase, ABC	95.72
4dhe_A	223	Probable GTP-binding protein ENGB; melioidosis, RA	95.72
2qm8_A	337	GTPase/ATPase; G protein, G3E, metallochaperone, c	95.7
3gfo_A	275	Cobalt import ATP-binding protein CBIO 1; structur	95.69
3p32_A	355	Probable GTPase RV1496/MT1543; structural genomics	95.67
2w0m_A	235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	95.66
2nq2_C	253	Hypothetical ABC transporter ATP-binding protein H	95.66
2ghi_A	260	Transport protein; multidrug resistance protein, M	95.64
4g1u_C	266	Hemin import ATP-binding protein HMUV; membrane tr	95.63
3jvv_A	356	Twitching mobility protein; hexameric P-loop ATPas	95.63
3vaa_A	199	Shikimate kinase, SK; structural genomics, center	95.47
2jeo_A	245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	95.46
1p9r_A	418	General secretion pathway protein E; bacterial typ	95.38
2qt1_A	207	Nicotinamide riboside kinase 1; non-protein kinase	95.36
2pjz_A	263	Hypothetical protein ST1066; ATP binding protein,	95.36
3ec2_A	180	DNA replication protein DNAC; helicase loader, rep	95.32
3qks_A	203	DNA double-strand break repair RAD50 ATPase; RECA-	95.31
1oix_A	191	RAS-related protein RAB-11A; small G protein, intr	95.3
2gza_A	361	Type IV secretion system protein VIRB11; ATPase, h	95.28
4aby_A	415	DNA repair protein RECN; hydrolase, double strand	95.26
2qpt_A	550	EH domain-containing protein-2; protein-nucleotide	95.26
2ewv_A	372	Twitching motility protein PILT; pilus retraction	95.22
2pt7_A	330	CAG-ALFA; ATPase, protein-protein complex, type IV	95.2
1rz3_A	201	Hypothetical protein rbstp0775; MCSG, structural g	95.2
1e69_A	322	Chromosome segregation SMC protein; structural mai	95.16
2ged_A	193	SR-beta, signal recognition particle receptor beta	95.15
1cr0_A	296	DNA primase/helicase; RECA-type protein fold, tran	95.06
4e22_A	252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	95.05
2bbs_A	290	Cystic fibrosis transmembrane conductance regulato	95.04
3auy_A	371	DNA double-strand break repair RAD50 ATPase; DNA r	95.03
2p67_A	341	LAO/AO transport system kinase; ARGK, structural G	95.01
2kjq_A	149	DNAA-related protein; solution structure, NESG, st	94.9
2oap_1	511	GSPE-2, type II secretion system protein; hexameri	94.89
1p5z_B	263	DCK, deoxycytidine kinase; nucleoside kinase, P-lo	94.89
3l0i_B	199	RAS-related protein RAB-1A; GEF-GDF-RAB complex, G	94.85
1z47_A	355	CYSA, putative ABC-transporter ATP-binding protein	94.8
2qtf_A	364	Protein HFLX, GTP-binding protein; beta-alpha-barr	94.79
3qkt_A	339	DNA double-strand break repair RAD50 ATPase; RECA-	94.77
1n0w_A	243	DNA repair protein RAD51 homolog 1; DNA repair, ho	94.76
2cvh_A	220	DNA repair and recombination protein RADB; filamen	94.74
1uj2_A	252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	94.69
1g29_1	372	MALK, maltose transport protein MALK; ATPase, acti	94.68
2oil_A	193	CATX-8, RAS-related protein RAB-25; G-protein, GDP	94.61
2yyz_A	359	Sugar ABC transporter, ATP-binding protein; sugar	94.6
2it1_A	362	362AA long hypothetical maltose/maltodextrin trans	94.59
1jwy_B	315	Dynamin A GTPase domain; dynamin, GTPase, GDP, myo	94.58
1gvn_B	287	Zeta; postsegregational killing system, plasmid; 1	94.54
3fvq_A	359	Fe(3+) IONS import ATP-binding protein FBPC; nucle	94.54
1v43_A	372	Sugar-binding transport ATP-binding protein; ATPas	94.54
1in4_A	334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	94.52
2p5t_B	253	PEZT; postsegregational killing system, phosphoryl	94.48
1sq5_A	308	Pantothenate kinase; P-loop, transferase; HET: PAU	94.44
2vp4_A	230	Deoxynucleoside kinase; ATP-binding, DNA synthesis	94.42
2cdn_A	201	Adenylate kinase; phosphoryl transfer, associative	94.41
2e87_A	357	Hypothetical protein PH1320; GTP-binding, GTPase,	94.35
3aez_A	312	Pantothenate kinase; transferase, homodimer, COA b	94.35
3d31_A	348	Sulfate/molybdate ABC transporter, ATP-binding pro	94.33
3lxx_A	239	GTPase IMAP family member 4; structural genomics c	94.29
1oxx_K	353	GLCV, glucose, ABC transporter, ATP binding protei	94.23
1nlf_A	279	Regulatory protein REPA; replicative DNA helicase	94.22
2yv5_A	302	YJEQ protein; hydrolase, GTPase, permutation, stru	94.21
1sxj_E	354	Activator 1 40 kDa subunit; clamp loader, processi	94.21
2h17_A	181	ADP-ribosylation factor-like protein 5A; GDP, GTPa	94.2
3umf_A	217	Adenylate kinase; rossmann fold, transferase; 2.05	94.19
1fnn_A	389	CDC6P, cell division control protein 6; ORC1, AAA	94.18
3rlf_A	381	Maltose/maltodextrin import ATP-binding protein M;	94.17
3szr_A	608	Interferon-induced GTP-binding protein MX1; interf	94.07
1m7g_A	211	Adenylylsulfate kinase; APS kinase, transferase, s	94.05
1wb9_A	800	DNA mismatch repair protein MUTS; DNA-binding, ATP	94.04
1ewq_A	765	DNA mismatch repair protein MUTS; multiple domains	93.96
1w1w_A	430	Structural maintenance of chromosome 1; cohesin, c	93.93
3tui_C	366	Methionine import ATP-binding protein METN; ABC-tr	93.91
3ux8_A	670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	93.89
3t34_A	360	Dynamin-related protein 1A, linker, dynamin-relat	93.88
3b9q_A	302	Chloroplast SRP receptor homolog, alpha subunit CP	93.83
2yc2_C	208	IFT27, small RAB-related GTPase; transport protein	93.81
3nwj_A	250	ATSK2; P loop, shikimate, nucleoside monophosphate	93.76
1njg_A	250	DNA polymerase III subunit gamma; rossman-like fol	93.76
2dr3_A	247	UPF0273 protein PH0284; RECA superfamily ATPase, h	93.74
2aka_B	299	Dynamin-1; fusion protein, GTPase domain, myosin,	93.71
1rj9_A	304	FTSY, signal recognition protein; SRP-GTPase domai	93.69
1z06_A	189	RAS-related protein RAB-33B; RAB GTPase, RAB33B GT	93.65
1u0l_A	301	Probable GTPase ENGC; permutation, OB-fold, zinc-f	93.61
2npi_A	460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	93.58
3nh6_A	306	ATP-binding cassette SUB-family B member 6, mitoc;	93.55
3thx_A	934	DNA mismatch repair protein MSH2; ABC family ATPas	93.54
3cbq_A	195	GTP-binding protein REM 2; FLJ38964A, structural g	93.52
1ixz_A	254	ATP-dependent metalloprotease FTSH; AAA domain fol	93.51
2fna_A	357	Conserved hypothetical protein; structural genomic	93.49
2v9p_A	305	Replication protein E1; AAA+ molecular motor, DNA	93.49
3thx_B	918	DNA mismatch repair protein MSH3; ABC family ATPas	93.42
3gd7_A	390	Fusion complex of cystic fibrosis transmembrane co	93.38
1jbk_A	195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	93.36
3con_A	190	GTPase NRAS; structural genomics consortium, SGC,	93.33
2o5v_A	359	DNA replication and repair protein RECF; ABC ATPas	93.32
3e70_C	328	DPA, signal recognition particle receptor; FTSY, S	93.27
1yqt_A	538	RNAse L inhibitor; ATP-binding cassette, ribosome	93.27
2o8b_B	1022	DNA mismatch repair protein MSH6; DNA damage respo	93.2
1tq4_A	413	IIGP1, interferon-inducible GTPase; interferon gam	93.19
4a82_A	578	Cystic fibrosis transmembrane conductance regulat;	93.16
3bos_A	242	Putative DNA replication factor; P-loop containing	93.16
1tf7_A	525	KAIC; homohexamer, hexamer, circadian clock protei	93.02
2f6r_A	281	COA synthase, bifunctional coenzyme A synthase; 18	93.01
1lw7_A	365	Transcriptional regulator NADR; NMN, NMN adenylyl	93.01
2rcn_A	358	Probable GTPase ENGC; YJEQ, circularly permuted, G	92.98
2yl4_A	595	ATP-binding cassette SUB-family B member 10, mitoc	92.97
2qu8_A	228	Putative nucleolar GTP-binding protein 1; GTPase,	92.97
1odf_A	290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	92.93
1yqt_A	538	RNAse L inhibitor; ATP-binding cassette, ribosome	92.89
3b5x_A	582	Lipid A export ATP-binding/permease protein MSBA;	92.86
3tlx_A	243	Adenylate kinase 2; structural genomics, structura	92.85
2qen_A	350	Walker-type ATPase; unknown function; HET: ADP; 2.	92.81
1pzn_A	349	RAD51, DNA repair and recombination protein RAD51,	92.8
3dz8_A	191	RAS-related protein RAB-3B; GDP, GTPase, structura	92.78
3cr8_A	552	Sulfate adenylyltranferase, adenylylsulfate kinase	92.78
2chg_A	226	Replication factor C small subunit; DNA-binding pr	92.77
2h57_A	190	ADP-ribosylation factor-like protein 6; GTP, GTPas	92.7
3bk7_A	607	ABC transporter ATP-binding protein; ABC ATPase, i	92.7
2x8a_A	274	Nuclear valosin-containing protein-like; nuclear p	92.7
3llu_A	196	RAS-related GTP-binding protein C; structural geno	92.69
3bk7_A	607	ABC transporter ATP-binding protein; ABC ATPase, i	92.68
1iy2_A	278	ATP-dependent metalloprotease FTSH; AAA domain fol	92.63
4dcu_A	456	GTP-binding protein ENGA; GTPase, GDP, protein bin	92.6
1udx_A	416	The GTP-binding protein OBG; TGS domain, riken str	92.57
2og2_A	359	Putative signal recognition particle receptor; nuc	92.57
2f7s_A	217	C25KG, RAS-related protein RAB-27B; G-protein, str	92.55
3j16_B	608	RLI1P; ribosome recycling, translation, eukarya, r	92.54
3cph_A	213	RAS-related protein SEC4; RAB GTPase, prenylation,	92.52
3qf4_B	598	Uncharacterized ABC transporter ATP-binding prote	92.5
3ozx_A	538	RNAse L inhibitor; ATP binding cassette protein, h	92.49
3oes_A	201	GTPase rhebl1; small GTPase, structural genomics,	92.47
3zvl_A	416	Bifunctional polynucleotide phosphatase/kinase; hy	92.46
3ozx_A	538	RNAse L inhibitor; ATP binding cassette protein, h	92.46
2qag_B	427	Septin-6, protein NEDD5; cell cycle, cell division	92.43
2fg5_A	192	RAB-22B, RAS-related protein RAB-31; G-protein, GT	92.36
1sxj_C	340	Activator 1 40 kDa subunit; clamp loader, processi	92.32
3b60_A	582	Lipid A export ATP-binding/permease protein MSBA;	92.31
3euj_A	483	Chromosome partition protein MUKB, linker; MUKB, M	92.27
2il1_A	192	RAB12; G-protein, GDP, GTPase, predicted, structur	92.25
1t9h_A	307	YLOQ, probable GTPase ENGC; N-terminal beta-barrel	92.23
2a5j_A	191	RAS-related protein RAB-2B; GTPase, signal transdu	92.18
2zts_A	251	Putative uncharacterized protein PH0186; KAIC like	92.18
4ad8_A	517	DNA repair protein RECN; DNA binding protein, ATPa	92.16
2qby_A	386	CDC6 homolog 1, cell division control protein 6 ho	92.14
1zd9_A	188	ADP-ribosylation factor-like 10B; transport protei	92.1
2xtp_A	260	GTPase IMAP family member 2; immune system, G prot	92.08
3j16_B	608	RLI1P; ribosome recycling, translation, eukarya, r	92.07
2o52_A	200	RAS-related protein RAB-4B; G-protein, GDP, struct	92.02
2atv_A	196	RERG, RAS-like estrogen-regulated growth inhibitor	92.01
2gf9_A	189	RAS-related protein RAB-3D; G-protein, structural	92.0
3tqc_A	321	Pantothenate kinase; biosynthesis of cofactors, pr	91.98
3ux8_A	670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	91.94
3th5_A	204	RAS-related C3 botulinum toxin substrate 1; rossma	91.2
4eaq_A	229	DTMP kinase, thymidylate kinase; structural genomi	91.76
3reg_A	194	RHO-like small GTPase; cytoskeleton, nucleotide-bi	91.7
2yhs_A	503	FTSY, cell division protein FTSY; cell cycle, prot	91.64
3ihw_A	184	Centg3; RAS, centaurin, GTPase, structural genomic	91.61
3a8t_A	339	Adenylate isopentenyltransferase; rossmann fold pr	91.56
2w58_A	202	DNAI, primosome component (helicase loader); ATP-b	91.48
3qf4_A	587	ABC transporter, ATP-binding protein; multidrug tr	91.43
2p65_A	187	Hypothetical protein PF08_0063; CLPB, malaria, str	91.37
2g3y_A	211	GTP-binding protein GEM; small GTPase, GDP, inacti	91.34
1lv7_A	257	FTSH; alpha/beta domain, four helix bundle, hydrol	91.33
2x77_A	189	ADP-ribosylation factor; GTP-binding protein, smal	91.32
2px0_A	296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	91.23
1vma_A	306	Cell division protein FTSY; TM0570, structural gen	91.18
1m2o_B	190	GTP-binding protein SAR1, GTP binding protein; zin	91.1
1f6b_A	198	SAR1; gtpases, N-terminal helix, Mg-containing com	91.08
1tf7_A	525	KAIC; homohexamer, hexamer, circadian clock protei	91.07
3c5c_A	187	RAS-like protein 12; GDP, GTPase, structural genom	91.06
2p5s_A	199	RAS and EF-hand domain containing; G-protein, RAB,	91.06
2q3h_A	201	RAS homolog gene family, member U; GTPase, structu	91.0
2fv8_A	207	H6, RHO-related GTP-binding protein RHOB; GDP/GTP	90.99
2ew1_A	201	RAS-related protein RAB-30; G-protein, GTP analogu	90.99
2vf7_A	842	UVRA2, excinuclease ABC, subunit A.; DNA-binding p	90.97
3lda_A	400	DNA repair protein RAD51; DNA binding protein, ATP	90.87
3vkw_A	446	Replicase large subunit; alpha/beta domain, helica	90.87
2b6h_A	192	ADP-ribosylation factor 5; membrane trafficking, G	90.82
2v1u_A	387	Cell division control protein 6 homolog; DNA repli	90.71
1sxj_D	353	Activator 1 41 kDa subunit; clamp loader, processi	90.7
3llm_A	235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	90.66
1qhl_A	227	Protein (cell division protein MUKB); SMC, chromos	90.55
3qq5_A	423	Small GTP-binding protein; hydrogenase, H-cluster,	90.54
1l8q_A	324	Chromosomal replication initiator protein DNAA; AA	90.4
2gco_A	201	H9, RHO-related GTP-binding protein RHOC; GTPase,s	90.33
2j1l_A	214	RHO-related GTP-binding protein RHOD; GTPase, memb	90.15
1svm_A	377	Large T antigen; AAA+ fold, viral protein; HET: AT	90.11
3lxw_A	247	GTPase IMAP family member 1; immunity, structural	90.08
2iw3_A	986	Elongation factor 3A; acetylation, ATP-binding, pr	90.05
4gzl_A	204	RAS-related C3 botulinum toxin substrate 1; rossma	89.83
1gwn_A	205	RHO-related GTP-binding protein RHOE; GTPase, inac	89.79
2hup_A	201	RAS-related protein RAB-43; G-protein, GDP, struct	89.79
2ygr_A	993	Uvrabc system protein A; hydrolase, nucleotide exc	89.67
2x2e_A	353	Dynamin-1; nitration, hydrolase, membrane fission,	89.63
1lnz_A	342	SPO0B-associated GTP-binding protein; GTPase, OBG,	89.58
4ag6_A	392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	89.43
2obl_A	347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	89.37
3e1s_A	574	Exodeoxyribonuclease V, subunit RECD; alpha and be	89.34
2axn_A	520	6-phosphofructo-2-kinase/fructose-2,6- biphosphata	89.32
2ga8_A	359	Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn	89.28
2r6f_A	972	Excinuclease ABC subunit A; UVRA, nucleotide excis	89.02
2dpy_A	438	FLII, flagellum-specific ATP synthase; beta barrel	89.0
1bif_A	469	6-phosphofructo-2-kinase/ fructose-2,6-bisphospha;	88.91
1zu4_A	320	FTSY; GTPase, signal recognition particle, SRP, re	88.86
2iw3_A	986	Elongation factor 3A; acetylation, ATP-binding, pr	88.78
1mky_A	439	Probable GTP-binding protein ENGA; GTPase, DER, KH	88.78
3hr8_A	356	Protein RECA; alpha and beta proteins (A/B, A+B),	88.73
2qag_C	418	Septin-7; cell cycle, cell division, GTP-binding,	88.66
2zr9_A	349	Protein RECA, recombinase A; recombination, RECA m	88.56
2qby_B	384	CDC6 homolog 3, cell division control protein 6 ho	88.5
3upu_A	459	ATP-dependent DNA helicase DDA; RECA-like domain,	88.42
1v5w_A	343	DMC1, meiotic recombination protein DMC1/LIM15 hom	88.29
3q3j_B	214	RHO-related GTP-binding protein RHO6; RAS-binding	88.28
1w5s_A	412	Origin recognition complex subunit 2 ORC2; replica	88.27
4fcw_A	311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	88.04
2chq_A	319	Replication factor C small subunit; DNA-binding pr	87.84
3kl4_A	433	SRP54, signal recognition 54 kDa protein; signal r	87.82
1iqp_A	327	RFCS; clamp loader, extended AAA-ATPase domain, co	87.78
1g8f_A	511	Sulfate adenylyltransferase; alpha-beta protein, b	87.65
3def_A	262	T7I23.11 protein; chloroplast, TOC33, GTPase, hydr	87.57
2r6a_A	454	DNAB helicase, replicative helicase; replication,	87.53
1h65_A	270	Chloroplast outer envelope protein OEP34; GTPase,	87.51
3syl_A	309	Protein CBBX; photosynthesis, rubisco activase, AA	87.34
2qag_A	361	Septin-2, protein NEDD5; cell cycle, cell division	87.33
1sxj_B	323	Activator 1 37 kDa subunit; clamp loader, processi	87.25
2i1q_A	322	DNA repair and recombination protein RADA; ATPase,	87.23
1w36_D	608	RECD, exodeoxyribonuclease V alpha chain; recombin	87.21
3bh0_A	315	DNAB-like replicative helicase; ATPase, replicatio	87.19
1m8p_A	573	Sulfate adenylyltransferase; rossmann fold, phosph	87.07
2j37_W	504	Signal recognition particle 54 kDa protein (SRP54)	86.93
3b9p_A	297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	86.71
1z6t_A	591	APAF-1, apoptotic protease activating factor 1; ca	86.69
4b3f_X	646	DNA-binding protein smubp-2; hydrolase, helicase;	86.68
2z43_A	324	DNA repair and recombination protein RADA; archaea	86.58
2qz4_A	262	Paraplegin; AAA+, SPG7, protease, ADP, structural	86.51
3pih_A	916	Uvrabc system protein A; hydrolase, ABC ATPase, DN	86.46
3h4m_A	285	Proteasome-activating nucleotidase; ATPase, PAN, A	86.24
3pfi_A	338	Holliday junction ATP-dependent DNA helicase RUVB;	86.22
3dm5_A	443	SRP54, signal recognition 54 kDa protein; protein-	85.95
3v9p_A	227	DTMP kinase, thymidylate kinase; ssgcid, STRU geno	85.89
2qmh_A	205	HPR kinase/phosphorylase; V267F mutation, ATP-bind	85.8
3m6a_A	543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	85.73
1ni3_A	392	YCHF GTPase, YCHF GTP-binding protein; structural	85.68
1ls1_A	295	Signal recognition particle protein; FFH, SRP54, S	85.64
3pvs_A	447	Replication-associated recombination protein A; ma	85.47
2z4s_A	440	Chromosomal replication initiator protein DNAA; AA	85.4
1x6v_B	630	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	85.33
1j8m_F	297	SRP54, signal recognition 54 kDa protein; signalin	85.15
1jr3_A	373	DNA polymerase III subunit gamma; processivity, pr	85.06
3uk6_A	368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	85.03
2wkq_A	332	NPH1-1, RAS-related C3 botulinum toxin substrate 1	84.81
3cf0_A	301	Transitional endoplasmic reticulum ATPase; AAA, P9	84.64
2j9r_A	214	Thymidine kinase; TK1, DNK, lasso, transferase, AT	84.58
2v3c_C	432	SRP54, signal recognition 54 kDa protein; nucleoti	84.46
3ld9_A	223	DTMP kinase, thymidylate kinase; ssgcid, NIH, niai	84.45
1d2n_A	272	N-ethylmaleimide-sensitive fusion protein; hexamer	84.35
2gk6_A	624	Regulator of nonsense transcripts 1; UPF1, helicas	84.33
3n70_A	145	Transport activator; sigma-54, ntpase, PSI, MCSG,	84.14
3lv8_A	236	DTMP kinase, thymidylate kinase; structural genomi	84.06
1u94_A	356	RECA protein, recombinase A; homologous recombinat	83.97
3o47_A	329	ADP-ribosylation factor GTPase-activating protein	83.9
3e2i_A	219	Thymidine kinase; Zn-binding, ATP-binding, DNA syn	83.88
3geh_A	462	MNME, tRNA modification GTPase MNME; G protein, U3	83.84
1ofh_A	310	ATP-dependent HSL protease ATP-binding subunit HSL	83.5
3cnl_A	262	YLQF, putative uncharacterized protein; circular p	83.44
2q6t_A	444	DNAB replication FORK helicase; hydrolase; 2.90A {	83.08
3gee_A	476	MNME, tRNA modification GTPase MNME; G protein, cy	83.04
2vf7_A	842	UVRA2, excinuclease ABC, subunit A.; DNA-binding p	82.99
3t15_A	293	Ribulose bisphosphate carboxylase/oxygenase activ	82.76
1hqc_A	324	RUVB; extended AAA-ATPase domain, complex with nuc	82.74
1tue_A	212	Replication protein E1; helicase, replication, E1E	82.68
3g5u_A	1284	MCG1178, multidrug resistance protein 1A; P-glycop	82.38
3co5_A	143	Putative two-component system transcriptional RES	82.35
3dpu_A	535	RAB family protein; roccor, G-domain, COR, GTP-bin	82.18
2r62_A	268	Cell division protease FTSH homolog; ATPase domain	82.11
2ius_A	512	DNA translocase FTSK; nucleotide-binding, chromoso	81.94
1g8p_A	350	Magnesium-chelatase 38 kDa subunit; parallel beta	81.72
2gks_A	546	Bifunctional SAT/APS kinase; transferase, sulfuryl	81.45
2ohf_A	396	Protein OLA1, GTP-binding protein 9; ATPase, GTPas	81.43
1f5n_A	592	Interferon-induced guanylate-binding protein 1; GB	81.36
2wjy_A	800	Regulator of nonsense transcripts 1; nonsense medi	80.68
2a5y_B	549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	80.47
2vhj_A	331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	80.29
4f4c_A	1321	Multidrug resistance protein PGP-1; ABC transporte	80.11

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}

Probab=97.20  E-value=3.8e-05  Score=53.39  Aligned_cols=21  Identities=33%  Similarity=0.306  Sum_probs=18.9

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .++|+++|.|+.|+|||||+|
T Consensus        28 ~~~~~i~i~G~~g~GKTTl~~   48 (221)
T 2wsm_A           28 SGTVAVNIMGAIGSGKTLLIE   48 (221)
T ss_dssp             HTCEEEEEEECTTSCHHHHHH
T ss_pred             cCceEEEEEcCCCCCHHHHHH
Confidence            468999999999999999964

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*

Probab=96.97  E-value=9.1e-05  Score=51.64  Aligned_cols=21  Identities=29%  Similarity=0.271  Sum_probs=18.7

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .++++++|.|+.|+|||||+|
T Consensus        36 ~~~~~i~ivG~~gvGKTtl~~   56 (226)
T 2hf9_A           36 HGVVAFDFMGAIGSGKTLLIE   56 (226)
T ss_dssp             TTCEEEEEEESTTSSHHHHHH
T ss_pred             CCCeEEEEEcCCCCCHHHHHH
Confidence            468999999999999999964

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}

Probab=96.82  E-value=0.0002  Score=56.09  Aligned_cols=22  Identities=23%  Similarity=0.099  Sum_probs=19.7

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ....|++.|+|+.|+|||||||
T Consensus        71 ~~~~~~v~lvG~pgaGKSTLln   92 (349)
T 2www_A           71 KPLAFRVGLSGPPGAGKSTFIE   92 (349)
T ss_dssp             CCSCEEEEEECCTTSSHHHHHH
T ss_pred             ccCceEEEEEcCCCCCHHHHHH
Confidence            4568999999999999999986

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}

Probab=96.47  E-value=0.00045  Score=49.38  Aligned_cols=18  Identities=22%  Similarity=0.279  Sum_probs=11.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..|||||||++
T Consensus        28 ~ii~l~Gp~GsGKSTl~~   45 (231)
T 3lnc_A           28 VILVLSSPSGCGKTTVAN   45 (231)
T ss_dssp             CEEEEECSCC----CHHH
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999963

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}

Probab=96.37  E-value=0.00041  Score=48.73  Aligned_cols=19  Identities=32%  Similarity=0.443  Sum_probs=16.4

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +-.+++|+|+.|||||||+
T Consensus        28 ~g~~i~l~G~~GsGKSTl~   46 (200)
T 4eun_A           28 PTRHVVVMGVSGSGKTTIA   46 (200)
T ss_dssp             CCCEEEEECCTTSCHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHH
Confidence            3458999999999999985

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A

Probab=96.32  E-value=0.00046  Score=48.86  Aligned_cols=18  Identities=22%  Similarity=0.281  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|||||||+|
T Consensus        21 ei~~l~GpnGsGKSTLl~   38 (207)
T 1znw_A           21 RVVVLSGPSAVGKSTVVR   38 (207)
T ss_dssp             CEEEEECSTTSSHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            478999999999999974

>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A

Probab=96.30  E-value=0.00083  Score=44.61  Aligned_cols=24  Identities=17%  Similarity=0.048  Sum_probs=19.8

Q ss_pred             CCCCCCceEEEecccCCCccCCCC
Q 033696           90 PPDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        90 ~~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+....|-.+|.|..|+|||||+|
T Consensus        18 ~~~~~~~~i~v~G~~~~GKSsli~   41 (195)
T 3pqc_A           18 YPPPLKGEVAFVGRSNVGKSSLLN   41 (195)
T ss_dssp             CCCCTTCEEEEEEBTTSSHHHHHH
T ss_pred             CCCCCCeEEEEECCCCCCHHHHHH
Confidence            334567889999999999999975

>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A*

Probab=96.24  E-value=0.00069  Score=45.49  Aligned_cols=23  Identities=22%  Similarity=0.403  Sum_probs=19.8

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..+.+-.+|.|..|+|||||+|
T Consensus        19 ~~~~~~~i~v~G~~~~GKSsli~   41 (195)
T 1svi_A           19 PEGGLPEIALAGRSNVGKSSFIN   41 (195)
T ss_dssp             CCSCCCEEEEEEBTTSSHHHHHH
T ss_pred             CCCCCCEEEEECCCCCCHHHHHH
Confidence            34578889999999999999975

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A

Probab=96.21  E-value=0.00057  Score=48.49  Aligned_cols=17  Identities=35%  Similarity=0.491  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|.+|||||||++
T Consensus        35 ~v~L~G~nGaGKTTLlr   51 (158)
T 1htw_A           35 MVYLNGDLGAGKTTLTR   51 (158)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999963

>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*

Probab=96.20  E-value=0.00071  Score=46.06  Aligned_cols=16  Identities=44%  Similarity=0.430  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|..||||||||
T Consensus        28 ~~~i~G~NGsGKStll   43 (182)
T 3kta_A           28 FTAIVGANGSGKSNIG   43 (182)
T ss_dssp             EEEEEECTTSSHHHHH
T ss_pred             cEEEECCCCCCHHHHH
Confidence            8999999999999986

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*

Probab=96.18  E-value=0.00056  Score=47.27  Aligned_cols=17  Identities=35%  Similarity=0.385  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||++
T Consensus        27 ~~~l~G~nGsGKSTll~   43 (231)
T 4a74_A           27 ITEVFGEFGSGKTQLAH   43 (231)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            89999999999999963

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A

Probab=96.14  E-value=0.00061  Score=50.15  Aligned_cols=17  Identities=41%  Similarity=0.292  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~iiG~nGsGKSTLl~   48 (224)
T 2pcj_A           32 FVSIIGASGSGKSTLLY   48 (224)
T ss_dssp             EEEEEECTTSCHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8

Probab=96.12  E-value=0.0011  Score=45.31  Aligned_cols=21  Identities=14%  Similarity=0.142  Sum_probs=18.1

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+-..++|.|..|+|||||+|
T Consensus        24 ~~~~~v~lvG~~g~GKSTLl~   44 (210)
T 1pui_A           24 DTGIEVAFAGRSNAGKSSALN   44 (210)
T ss_dssp             SCSEEEEEEECTTSSHHHHHT
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            445679999999999999986

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*

Probab=96.10  E-value=0.0007  Score=50.31  Aligned_cols=18  Identities=39%  Similarity=0.290  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        32 e~~~iiG~nGsGKSTLl~   49 (235)
T 3tif_A           32 EFVSIMGPSGSGKSTMLN   49 (235)
T ss_dssp             CEEEEECSTTSSHHHHHH
T ss_pred             CEEEEECCCCCcHHHHHH
Confidence            378999999999999974

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}

Probab=96.08  E-value=0.00083  Score=47.55  Aligned_cols=21  Identities=33%  Similarity=0.308  Sum_probs=17.1

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ++--++.|.|..|||||||++
T Consensus        20 ~~g~~v~I~G~sGsGKSTl~~   40 (208)
T 3c8u_A           20 PGRQLVALSGAPGSGKSTLSN   40 (208)
T ss_dssp             CSCEEEEEECCTTSCTHHHHH
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            344578899999999999963

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12

Probab=96.02  E-value=0.00081  Score=49.99  Aligned_cols=17  Identities=29%  Similarity=0.403  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        34 ~~~l~G~nGsGKSTLl~   50 (240)
T 1ji0_A           34 IVTLIGANGAGKTTTLS   50 (240)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}

Probab=96.00  E-value=0.0011  Score=48.81  Aligned_cols=17  Identities=29%  Similarity=0.182  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        24 ~~~liG~nGsGKSTLl~   40 (208)
T 3b85_A           24 IVFGLGPAGSGKTYLAM   40 (208)
T ss_dssp             EEEEECCTTSSTTHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}

Probab=96.00  E-value=0.00084  Score=50.87  Aligned_cols=18  Identities=44%  Similarity=0.519  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus        26 ~~v~i~Gp~GsGKSTll~   43 (261)
T 2eyu_A           26 GLILVTGPTGSGKSTTIA   43 (261)
T ss_dssp             EEEEEECSTTCSHHHHHH
T ss_pred             CEEEEECCCCccHHHHHH
Confidence            379999999999999974

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*

Probab=95.96  E-value=0.00089  Score=50.22  Aligned_cols=17  Identities=47%  Similarity=0.474  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~liG~nGsGKSTLlk   51 (257)
T 1g6h_A           35 VTLIIGPNGSGKSTLIN   51 (257)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*

Probab=95.95  E-value=0.0009  Score=46.94  Aligned_cols=18  Identities=39%  Similarity=0.388  Sum_probs=15.8

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -.+++|+|+.|||||||+
T Consensus        25 g~~i~l~G~sGsGKSTl~   42 (200)
T 3uie_A           25 GCVIWVTGLSGSGKSTLA   42 (200)
T ss_dssp             CEEEEEECSTTSSHHHHH
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            358899999999999984

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}

Probab=95.94  E-value=0.00092  Score=49.72  Aligned_cols=17  Identities=24%  Similarity=0.401  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        33 ~~~i~G~nGsGKSTLl~   49 (237)
T 2cbz_A           33 LVAVVGQVGCGKSSLLS   49 (237)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12

Probab=95.92  E-value=0.00095  Score=49.56  Aligned_cols=17  Identities=29%  Similarity=0.278  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        30 ~~~i~G~nGsGKSTLl~   46 (243)
T 1mv5_A           30 IIAFAGPSGGGKSTIFS   46 (243)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12

Probab=95.88  E-value=0.001  Score=50.31  Aligned_cols=17  Identities=41%  Similarity=0.333  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        34 ~~~liG~nGsGKSTLlk   50 (262)
T 1b0u_A           34 VISIIGSSGSGKSTFLR   50 (262)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A

Probab=95.88  E-value=0.001  Score=49.12  Aligned_cols=17  Identities=24%  Similarity=0.300  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        36 ~~~i~G~nGsGKSTLl~   52 (229)
T 2pze_A           36 LLAVAGSTGAGKTSLLM   52 (229)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12

Probab=95.86  E-value=0.0011  Score=49.87  Aligned_cols=18  Identities=22%  Similarity=0.257  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++-|.|..||||||||+
T Consensus        25 e~~~liG~nGsGKSTLl~   42 (240)
T 2onk_A           25 DYCVLLGPTGAGKSVFLE   42 (240)
T ss_dssp             SEEEEECCTTSSHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHH
Confidence            588999999999999974

>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A*

Probab=95.85  E-value=0.001  Score=52.36  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      ++++|+|..||||||||+
T Consensus        24 g~~~i~G~NGaGKTTll~   41 (365)
T 3qf7_A           24 GITVVEGPNGAGKSSLFE   41 (365)
T ss_dssp             EEEEEECCTTSSHHHHHH
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            489999999999999973

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12

Probab=95.84  E-value=0.00096  Score=49.55  Aligned_cols=17  Identities=29%  Similarity=0.169  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        37 ~~~iiG~NGsGKSTLlk   53 (214)
T 1sgw_A           37 VVNFHGPNGIGKTTLLK   53 (214)
T ss_dssp             CEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*

Probab=95.82  E-value=0.0011  Score=49.50  Aligned_cols=17  Identities=29%  Similarity=0.345  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~~~l~G~nGsGKSTLlk   47 (250)
T 2d2e_A           31 VHALMGPNGAGKSTLGK   47 (250)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}

Probab=95.82  E-value=0.00098  Score=48.19  Aligned_cols=17  Identities=35%  Similarity=0.354  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||++
T Consensus        25 ~~~lvGpsGsGKSTLl~   41 (218)
T 1z6g_A           25 PLVICGPSGVGKGTLIK   41 (218)
T ss_dssp             CEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999964

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*

Probab=95.81  E-value=0.0011  Score=50.55  Aligned_cols=17  Identities=35%  Similarity=0.403  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        52 i~~liG~NGsGKSTLlk   68 (263)
T 2olj_A           52 VVVVIGPSGSGKSTFLR   68 (263)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEEcCCCCcHHHHHH
Confidence            78899999999999974

>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A*

Probab=95.81  E-value=0.0014  Score=45.50  Aligned_cols=17  Identities=35%  Similarity=0.389  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|+|..||||||||
T Consensus        24 g~~~I~G~NGsGKStil   40 (149)
T 1f2t_A           24 GINLIIGQNGSGKSSLL   40 (149)
T ss_dssp             EEEEEECCTTSSHHHHH
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            59999999999999986

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A

Probab=95.80  E-value=0.0013  Score=47.44  Aligned_cols=18  Identities=39%  Similarity=0.466  Sum_probs=16.1

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -.+++|.|..|||||||+
T Consensus        27 ~~~i~l~G~~GsGKSTl~   44 (246)
T 2bbw_A           27 LLRAVILGPPGSGKGTVC   44 (246)
T ss_dssp             CCEEEEECCTTSSHHHHH
T ss_pred             CcEEEEECCCCCCHHHHH
Confidence            358999999999999986

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C

Probab=95.79  E-value=0.0012  Score=49.98  Aligned_cols=17  Identities=35%  Similarity=0.298  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        28 ~~~liG~NGsGKSTLlk   44 (249)
T 2qi9_C           28 ILHLVGPNGAGKSTLLA   44 (249)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            68899999999999974

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}

Probab=95.78  E-value=0.0012  Score=49.90  Aligned_cols=17  Identities=35%  Similarity=0.456  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        35 ~~~liG~nGsGKSTLl~   51 (266)
T 2yz2_A           35 CLLVAGNTGSGKSTLLQ   51 (266)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A

Probab=95.78  E-value=0.0012  Score=50.04  Aligned_cols=17  Identities=53%  Similarity=0.479  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        48 ~~~l~G~NGsGKSTLlk   64 (267)
T 2zu0_C           48 VHAIMGPNGSGKSTLSA   64 (267)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*

Probab=95.75  E-value=0.0012  Score=49.44  Aligned_cols=17  Identities=41%  Similarity=0.374  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        37 ~~~i~G~nGsGKSTLl~   53 (247)
T 2ff7_A           37 VIGIVGRSGSGKSTLTK   53 (247)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12

Probab=95.75  E-value=0.0012  Score=50.04  Aligned_cols=17  Identities=29%  Similarity=0.221  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        43 i~~l~G~NGsGKSTLlk   59 (256)
T 1vpl_A           43 IFGLIGPNGAGKTTTLR   59 (256)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*

Probab=95.72  E-value=0.0013  Score=50.07  Aligned_cols=17  Identities=47%  Similarity=0.522  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        47 ~~~i~G~nGsGKSTLlk   63 (271)
T 2ixe_A           47 VTALVGPNGSGKSTVAA   63 (271)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}

Probab=95.72  E-value=0.0013  Score=50.50  Aligned_cols=17  Identities=35%  Similarity=0.399  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        49 ~~~liG~NGsGKSTLlk   65 (279)
T 2ihy_A           49 KWILYGLNGAGKTTLLN   65 (279)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            68899999999999974

>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis}

Probab=95.72  E-value=0.00083  Score=46.33  Aligned_cols=23  Identities=26%  Similarity=0.374  Sum_probs=19.6

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..+.|-++|.|..|+|||||+|
T Consensus        25 ~~~~~~~i~v~G~~~~GKSslin   47 (223)
T 4dhe_A           25 PPTVQPEIAFAGRSNAGKSTAIN   47 (223)
T ss_dssp             CCCCSCEEEEEESCHHHHHHHHH
T ss_pred             CCCCCCEEEEEcCCCCCHHHHHH
Confidence            34567889999999999999975

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*

Probab=95.70  E-value=0.0015  Score=51.01  Aligned_cols=22  Identities=36%  Similarity=0.351  Sum_probs=19.1

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+-.++.|+|+.|||||||||
T Consensus        52 ~~~g~~v~i~G~~GaGKSTLl~   73 (337)
T 2qm8_A           52 TGRAIRVGITGVPGVGKSTTID   73 (337)
T ss_dssp             CCCSEEEEEECCTTSCHHHHHH
T ss_pred             cCCCeEEEEECCCCCCHHHHHH
Confidence            3567899999999999999975

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}

Probab=95.69  E-value=0.0014  Score=50.53  Aligned_cols=17  Identities=41%  Similarity=0.282  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        36 ~~~iiGpnGsGKSTLl~   52 (275)
T 3gfo_A           36 VTAILGGNGVGKSTLFQ   52 (275)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*

Probab=95.67  E-value=0.0017  Score=50.43  Aligned_cols=22  Identities=32%  Similarity=0.344  Sum_probs=19.4

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+.++++|+|+.|+|||||+|
T Consensus        76 ~~~~~~I~i~G~~G~GKSTl~~   97 (355)
T 3p32_A           76 SGNAHRVGITGVPGVGKSTAIE   97 (355)
T ss_dssp             CCCSEEEEEECCTTSSHHHHHH
T ss_pred             cCCceEEEEECCCCCCHHHHHH
Confidence            4578999999999999999864

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}

Probab=95.66  E-value=0.0014  Score=44.93  Aligned_cols=16  Identities=38%  Similarity=0.351  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|.|..|+|||||+
T Consensus        25 ~~~i~G~~GsGKTtl~   40 (235)
T 2w0m_A           25 FIALTGEPGTGKTIFS   40 (235)
T ss_dssp             EEEEECSTTSSHHHHH
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            7999999999999985

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}

Probab=95.66  E-value=0.0014  Score=49.37  Aligned_cols=17  Identities=29%  Similarity=0.257  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        33 ~~~l~G~nGsGKSTLl~   49 (253)
T 2nq2_C           33 ILAVLGQNGCGKSTLLD   49 (253)
T ss_dssp             EEEEECCSSSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999974

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}

Probab=95.64  E-value=0.0014  Score=49.41  Aligned_cols=17  Identities=35%  Similarity=0.501  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        48 ~~~i~G~nGsGKSTLl~   64 (260)
T 2ghi_A           48 TCALVGHTGSGKSTIAK   64 (260)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}

Probab=95.63  E-value=0.0015  Score=49.77  Aligned_cols=17  Identities=35%  Similarity=0.305  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        39 ~~~liG~nGsGKSTLl~   55 (266)
T 4g1u_C           39 MVAIIGPNGAGKSTLLR   55 (266)
T ss_dssp             EEEEECCTTSCHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            68899999999999974

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*

Probab=95.63  E-value=0.0015  Score=52.13  Aligned_cols=17  Identities=47%  Similarity=0.587  Sum_probs=15.9

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      +++|+|..||||||||+
T Consensus       125 ~i~I~GptGSGKTTlL~  141 (356)
T 3jvv_A          125 LVLVTGPTGSGKSTTLA  141 (356)
T ss_dssp             EEEEECSTTSCHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            89999999999999974

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}

Probab=95.47  E-value=0.0033  Score=43.98  Aligned_cols=19  Identities=32%  Similarity=0.635  Sum_probs=16.3

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +..+++|.|+.||||||+.
T Consensus        24 ~~~~i~l~G~~GsGKsTl~   42 (199)
T 3vaa_A           24 AMVRIFLTGYMGAGKTTLG   42 (199)
T ss_dssp             CCCEEEEECCTTSCHHHHH
T ss_pred             CCCEEEEEcCCCCCHHHHH
Confidence            4568999999999999983

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*

Probab=95.46  E-value=0.0018  Score=46.99  Aligned_cols=18  Identities=28%  Similarity=0.137  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++-|+|..|||||||++
T Consensus        26 ~iigI~G~~GsGKSTl~k   43 (245)
T 2jeo_A           26 FLIGVSGGTASGKSTVCE   43 (245)
T ss_dssp             EEEEEECSTTSSHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHH
Confidence            378899999999999863

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*

Probab=95.38  E-value=0.0021  Score=52.55  Aligned_cols=18  Identities=39%  Similarity=0.436  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -+++|+|..||||||||+
T Consensus       168 gii~I~GpnGSGKTTlL~  185 (418)
T 1p9r_A          168 GIILVTGPTGSGKSTTLY  185 (418)
T ss_dssp             EEEEEECSTTSCHHHHHH
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            489999999999999974

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*

Probab=95.36  E-value=0.0026  Score=44.36  Aligned_cols=20  Identities=30%  Similarity=0.273  Sum_probs=16.5

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+.-++.|+|..|||||||+
T Consensus        19 ~~~~~i~i~G~~GsGKSTl~   38 (207)
T 2qt1_A           19 SKTFIIGISGVTNSGKTTLA   38 (207)
T ss_dssp             CCCEEEEEEESTTSSHHHHH
T ss_pred             CCCeEEEEECCCCCCHHHHH
Confidence            33457889999999999984

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}

Probab=95.36  E-value=0.0021  Score=49.09  Aligned_cols=17  Identities=47%  Similarity=0.405  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        32 ~~~i~G~NGsGKSTLlk   48 (263)
T 2pjz_A           32 KVIILGPNGSGKTTLLR   48 (263)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*

Probab=95.32  E-value=0.002  Score=44.02  Aligned_cols=17  Identities=24%  Similarity=0.253  Sum_probs=15.2

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|+|..|+|||||+
T Consensus        39 ~~~~l~G~~G~GKTtL~   55 (180)
T 3ec2_A           39 KGLTFVGSPGVGKTHLA   55 (180)
T ss_dssp             CEEEECCSSSSSHHHHH
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            46899999999999985

>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A*

Probab=95.31  E-value=0.0027  Score=45.82  Aligned_cols=17  Identities=35%  Similarity=0.389  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|+|..|+||||+|
T Consensus        24 ~~~~I~G~NgsGKStil   40 (203)
T 3qks_A           24 GINLIIGQNGSGKSSLL   40 (203)
T ss_dssp             EEEEEECCTTSSHHHHH
T ss_pred             CeEEEEcCCCCCHHHHH
Confidence            59999999999999986

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*

Probab=95.30  E-value=0.0019  Score=44.55  Aligned_cols=21  Identities=19%  Similarity=0.251  Sum_probs=17.5

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .....++|.|..|+|||||||
T Consensus        27 ~~~~kv~lvG~~g~GKSTLl~   47 (191)
T 1oix_A           27 DYLFKVVLIGDSGVGKSNLLS   47 (191)
T ss_dssp             SEEEEEEEEECTTSSHHHHHH
T ss_pred             CcceEEEEECcCCCCHHHHHH
Confidence            345678999999999999974

>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}

Probab=95.28  E-value=0.002  Score=50.70  Aligned_cols=17  Identities=35%  Similarity=0.454  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      +++|+|..|||||||||
T Consensus       177 ~i~ivG~sGsGKSTll~  193 (361)
T 2gza_A          177 VIVVAGETGSGKTTLMK  193 (361)
T ss_dssp             CEEEEESSSSCHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78999999999999974

>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans}

Probab=95.26  E-value=0.0013  Score=50.49  Aligned_cols=17  Identities=29%  Similarity=0.262  Sum_probs=15.9

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      +++|+|..||||||||+
T Consensus        62 ~~~lvG~NGaGKStLl~   78 (415)
T 4aby_A           62 FCAFTGETGAGKSIIVD   78 (415)
T ss_dssp             EEEEEESHHHHHHHHTH
T ss_pred             cEEEECCCCCCHHHHHH
Confidence            99999999999999973

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}

Probab=95.26  E-value=0.0034  Score=52.55  Aligned_cols=23  Identities=17%  Similarity=0.260  Sum_probs=20.5

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...++|.++|.|+.|+|||||+|
T Consensus        61 ~~~~~~~V~vvG~~n~GKSTLIN   83 (550)
T 2qpt_A           61 DFDGKPMVLVAGQYSTGKTSFIQ   83 (550)
T ss_dssp             TTSSCCEEEEEEBTTSCHHHHHH
T ss_pred             cccCCcEEEEECCCCCCHHHHHH
Confidence            35678999999999999999986

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*

Probab=95.22  E-value=0.0025  Score=50.53  Aligned_cols=18  Identities=44%  Similarity=0.519  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|+|..||||||||+
T Consensus       137 ~~i~ivG~~GsGKTTll~  154 (372)
T 2ewv_A          137 GLILVTGPTGSGKSTTIA  154 (372)
T ss_dssp             EEEEEECSSSSSHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            379999999999999974

>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A

Probab=95.20  E-value=0.0021  Score=50.19  Aligned_cols=17  Identities=41%  Similarity=0.429  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|+|..|||||||||
T Consensus       173 ~v~i~G~~GsGKTTll~  189 (330)
T 2pt7_A          173 NVIVCGGTGSGKTTYIK  189 (330)
T ss_dssp             CEEEEESTTSCHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78999999999999974

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6

Probab=95.20  E-value=0.0023  Score=45.14  Aligned_cols=20  Identities=30%  Similarity=0.160  Sum_probs=16.7

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+--++.|+|..|||||||+
T Consensus        20 ~~~~~i~i~G~~GsGKstl~   39 (201)
T 1rz3_A           20 AGRLVLGIDGLSRSGKTTLA   39 (201)
T ss_dssp             SSSEEEEEEECTTSSHHHHH
T ss_pred             CCCeEEEEECCCCCCHHHHH
Confidence            34458999999999999985

>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12

Probab=95.16  E-value=0.0043  Score=47.30  Aligned_cols=16  Identities=44%  Similarity=0.403  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|..||||||||
T Consensus        26 ~~~i~G~NGsGKS~ll   41 (322)
T 1e69_A           26 VTAIVGPNGSGKSNII   41 (322)
T ss_dssp             EEEEECCTTTCSTHHH
T ss_pred             cEEEECCCCCcHHHHH
Confidence            9999999999999986

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}

Probab=95.15  E-value=0.0033  Score=42.23  Aligned_cols=21  Identities=33%  Similarity=0.376  Sum_probs=18.4

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+.+-++|.|..|+|||||+|
T Consensus        46 ~~~~~i~vvG~~g~GKSsll~   66 (193)
T 2ged_A           46 SYQPSIIIAGPQNSGKTSLLT   66 (193)
T ss_dssp             CCCCEEEEECCTTSSHHHHHH
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            556789999999999999975

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*

Probab=95.06  E-value=0.0027  Score=46.87  Aligned_cols=16  Identities=31%  Similarity=0.270  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|.|..|+|||||+
T Consensus        37 ~~~i~G~~G~GKTTl~   52 (296)
T 1cr0_A           37 VIMVTSGSGMGKSTFV   52 (296)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEEeCCCCCHHHHH
Confidence            8999999999999996

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}

Probab=95.05  E-value=0.0036  Score=46.14  Aligned_cols=19  Identities=32%  Similarity=0.408  Sum_probs=16.5

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +-.++.|+|+.|||||||+
T Consensus        26 ~g~~I~I~G~~GsGKSTl~   44 (252)
T 4e22_A           26 IAPVITVDGPSGAGKGTLC   44 (252)
T ss_dssp             TSCEEEEECCTTSSHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHH
Confidence            4468999999999999985

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*

Probab=95.04  E-value=0.0028  Score=49.09  Aligned_cols=17  Identities=24%  Similarity=0.300  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        66 ~~~i~G~NGsGKSTLlk   82 (290)
T 2bbs_A           66 LLAVAGSTGAGKTSLLM   82 (290)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B*

Probab=95.03  E-value=0.0035  Score=48.84  Aligned_cols=17  Identities=35%  Similarity=0.268  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|+|..|+||||+|
T Consensus        26 gl~vi~G~NGaGKT~il   42 (371)
T 3auy_A           26 GIVAIIGENGSGKSSIF   42 (371)
T ss_dssp             EEEEEEECTTSSHHHHH
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            79999999999999986

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10

Probab=95.01  E-value=0.0032  Score=48.75  Aligned_cols=22  Identities=27%  Similarity=0.146  Sum_probs=19.2

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+.+++.|+|+.|+|||||+|
T Consensus        53 ~~~~~~i~i~G~~g~GKSTl~~   74 (341)
T 2p67_A           53 CGNTLRLGVTGTPGAGKSTFLE   74 (341)
T ss_dssp             CSCSEEEEEEECTTSCHHHHHH
T ss_pred             cCCCEEEEEEcCCCCCHHHHHH
Confidence            3578899999999999999964

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}

Probab=94.90  E-value=0.0046  Score=42.80  Aligned_cols=18  Identities=22%  Similarity=0.054  Sum_probs=15.8

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -.+++|.|..|+|||||+
T Consensus        36 g~~~~l~G~~G~GKTtL~   53 (149)
T 2kjq_A           36 GQFIYVWGEEGAGKSHLL   53 (149)
T ss_dssp             CSEEEEESSSTTTTCHHH
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            357889999999999986

>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1

Probab=94.89  E-value=0.003  Score=52.73  Aligned_cols=17  Identities=35%  Similarity=0.436  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      +++|+|..|||||||||
T Consensus       262 ~i~I~GptGSGKTTlL~  278 (511)
T 2oap_1          262 SAIVVGETASGKTTTLN  278 (511)
T ss_dssp             CEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            48999999999999974

>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ...

Probab=94.89  E-value=0.0049  Score=45.02  Aligned_cols=21  Identities=33%  Similarity=0.393  Sum_probs=17.0

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      .++...++|.|.-||||||+.
T Consensus        21 ~~~~~~I~ieG~~GsGKST~~   41 (263)
T 1p5z_B           21 GTRIKKISIEGNIAAGKSTFV   41 (263)
T ss_dssp             --CCEEEEEECSTTSSHHHHH
T ss_pred             ccCceEEEEECCCCCCHHHHH
Confidence            456678999999999999984

>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens}

Probab=94.85  E-value=0.014  Score=39.92  Aligned_cols=21  Identities=19%  Similarity=0.173  Sum_probs=17.2

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..-++|.|..|+|||||+|
T Consensus        31 ~~~~ki~vvG~~~~GKSsli~   51 (199)
T 3l0i_B           31 DYLFKLLLIGDSGVGKSCLLL   51 (199)
T ss_dssp             SEEEEEEEECCTTSCCTTTTT
T ss_pred             CcceEEEEECCCCCCHHHHHH
Confidence            344557889999999999986

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}

Probab=94.80  E-value=0.0038  Score=50.27  Aligned_cols=17  Identities=35%  Similarity=0.225  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        43 ~~~llGpnGsGKSTLLr   59 (355)
T 1z47_A           43 MVGLLGPSGSGKTTILR   59 (355)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A

Probab=94.79  E-value=0.0043  Score=49.29  Aligned_cols=23  Identities=35%  Similarity=0.466  Sum_probs=17.8

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ....+|++.|.|+.|+|||||||
T Consensus       175 ~~~~~~~V~lvG~~naGKSTLln  197 (364)
T 2qtf_A          175 KRNNIPSIGIVGYTNSGKTSLFN  197 (364)
T ss_dssp             ----CCEEEEECBTTSSHHHHHH
T ss_pred             hhcCCcEEEEECCCCCCHHHHHH
Confidence            34568989999999999999986

>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B

Probab=94.77  E-value=0.0047  Score=47.52  Aligned_cols=17  Identities=35%  Similarity=0.389  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|.|..||||||||
T Consensus        24 ~~~~i~G~NGsGKS~ll   40 (339)
T 3qkt_A           24 GINLIIGQNGSGKSSLL   40 (339)
T ss_dssp             EEEEEECCTTSSHHHHH
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            69999999999999986

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11

Probab=94.76  E-value=0.005  Score=42.94  Aligned_cols=16  Identities=25%  Similarity=0.218  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.|.|..|+|||||+
T Consensus        26 ~~~i~G~~GsGKTtl~   41 (243)
T 1n0w_A           26 ITEMFGEFRTGKTQIC   41 (243)
T ss_dssp             EEEEECCTTSSHHHHH
T ss_pred             EEEEECCCCCcHHHHH
Confidence            8999999999999985

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*

Probab=94.74  E-value=0.005  Score=42.27  Aligned_cols=17  Identities=35%  Similarity=0.272  Sum_probs=15.4

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -+++|.|..|+|||||+
T Consensus        21 ~~~~i~G~~GsGKTtl~   37 (220)
T 2cvh_A           21 VLTQVYGPYASGKTTLA   37 (220)
T ss_dssp             SEEEEECSTTSSHHHHH
T ss_pred             EEEEEECCCCCCHHHHH
Confidence            38999999999999985

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*

Probab=94.69  E-value=0.0069  Score=44.10  Aligned_cols=19  Identities=21%  Similarity=0.079  Sum_probs=15.8

Q ss_pred             CCCceEEEecccCCCccCC
Q 033696           93 NRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTL  111 (113)
                      .+..++.|+|.-||||||+
T Consensus        20 ~~~~iI~I~G~~GSGKST~   38 (252)
T 1uj2_A           20 GEPFLIGVSGGTASGKSSV   38 (252)
T ss_dssp             -CCEEEEEECSTTSSHHHH
T ss_pred             CCcEEEEEECCCCCCHHHH
Confidence            3445889999999999997

>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A

Probab=94.68  E-value=0.0043  Score=49.96  Aligned_cols=17  Identities=35%  Similarity=0.374  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~~~llGpnGsGKSTLLr   47 (372)
T 1g29_1           31 FMILLGPSGCGKTTTLR   47 (372)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCcHHHHHHH
Confidence            78899999999999974

>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens}

Probab=94.61  E-value=0.004  Score=41.97  Aligned_cols=21  Identities=24%  Similarity=0.262  Sum_probs=16.8

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..=++|.|..|+|||||+|
T Consensus        23 ~~~~ki~v~G~~~~GKSsLi~   43 (193)
T 2oil_A           23 NFVFKVVLIGESGVGKTNLLS   43 (193)
T ss_dssp             SEEEEEEEESSTTSSHHHHHH
T ss_pred             CcceEEEEECcCCCCHHHHHH
Confidence            344557888999999999975

>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima}

Probab=94.60  E-value=0.0046  Score=49.77  Aligned_cols=17  Identities=29%  Similarity=0.280  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~~~llGpnGsGKSTLLr   47 (359)
T 2yyz_A           31 FVALLGPSGCGKTTTLL   47 (359)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEEcCCCchHHHHHH
Confidence            78899999999999974

>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}

Probab=94.59  E-value=0.0046  Score=49.81  Aligned_cols=17  Identities=35%  Similarity=0.233  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~~~llGpnGsGKSTLLr   47 (362)
T 2it1_A           31 FMALLGPSGSGKSTLLY   47 (362)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCchHHHHHH
Confidence            78899999999999974

>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B*

Probab=94.58  E-value=0.0057  Score=44.98  Aligned_cols=22  Identities=23%  Similarity=0.356  Sum_probs=19.9

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..+|.++|.|..|+|||||||
T Consensus        21 ~~~~~~I~vvG~~~~GKSTlln   42 (315)
T 1jwy_B           21 PLDLPQIVVVGSQSSGKSSVLE   42 (315)
T ss_dssp             TTCCCEEEEEECSSSSHHHHHH
T ss_pred             CCCCCeEEEEcCCCCCHHHHHH
Confidence            4678999999999999999986

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*

Probab=94.54  E-value=0.0083  Score=45.61  Aligned_cols=16  Identities=38%  Similarity=0.474  Sum_probs=14.5

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      -++||.|+.|||||||
T Consensus        34 ~livl~G~sGsGKSTl   49 (287)
T 1gvn_B           34 TAFLLGGQPGSGKTSL   49 (287)
T ss_dssp             EEEEEECCTTSCTHHH
T ss_pred             eEEEEECCCCCCHHHH
Confidence            3788999999999997

>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}

Probab=94.54  E-value=0.0046  Score=50.07  Aligned_cols=18  Identities=33%  Similarity=0.305  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        31 e~~~llGpsGsGKSTLLr   48 (359)
T 3fvq_A           31 EILFIIGASGCGKTTLLR   48 (359)
T ss_dssp             CEEEEEESTTSSHHHHHH
T ss_pred             CEEEEECCCCchHHHHHH
Confidence            378899999999999974

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*

Probab=94.54  E-value=0.0048  Score=49.86  Aligned_cols=17  Identities=29%  Similarity=0.343  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        39 ~~~llGpnGsGKSTLLr   55 (372)
T 1v43_A           39 FLVLLGPSGCGKTTTLR   55 (372)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            78899999999999974

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*

Probab=94.52  E-value=0.0056  Score=46.74  Aligned_cols=19  Identities=26%  Similarity=0.352  Sum_probs=16.7

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      ....+++.|..|+|||||+
T Consensus        50 ~~~~~ll~Gp~G~GKTTLa   68 (334)
T 1in4_A           50 VLDHVLLAGPPGLGKTTLA   68 (334)
T ss_dssp             CCCCEEEESSTTSSHHHHH
T ss_pred             CCCeEEEECCCCCcHHHHH
Confidence            4567999999999999986

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}

Probab=94.48  E-value=0.0077  Score=44.13  Aligned_cols=16  Identities=38%  Similarity=0.451  Sum_probs=14.6

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      .+++|+|..||||||+
T Consensus        33 ~~i~l~G~~GsGKSTl   48 (253)
T 2p5t_B           33 IAILLGGQSGAGKTTI   48 (253)
T ss_dssp             EEEEEESCGGGTTHHH
T ss_pred             eEEEEECCCCCCHHHH
Confidence            4789999999999997

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*

Probab=94.44  E-value=0.0049  Score=46.96  Aligned_cols=18  Identities=28%  Similarity=0.298  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++-|+|..|||||||++
T Consensus        81 ~iigI~G~~GsGKSTl~~   98 (308)
T 1sq5_A           81 YIISIAGSVAVGKSTTAR   98 (308)
T ss_dssp             EEEEEEECTTSSHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHH
Confidence            478899999999999863

>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A*

Probab=94.42  E-value=0.0051  Score=44.34  Aligned_cols=18  Identities=39%  Similarity=0.464  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..|||||||++
T Consensus        21 ~~i~i~G~~GsGKSTl~~   38 (230)
T 2vp4_A           21 FTVLIEGNIGSGKTTYLN   38 (230)
T ss_dssp             EEEEEECSTTSCHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            478899999999999863

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A

Probab=94.41  E-value=0.0083  Score=41.60  Aligned_cols=16  Identities=31%  Similarity=0.443  Sum_probs=14.3

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      -+++|+|..||||||+
T Consensus        21 ~~I~l~G~~GsGKST~   36 (201)
T 2cdn_A           21 MRVLLLGPPGAGKGTQ   36 (201)
T ss_dssp             CEEEEECCTTSSHHHH
T ss_pred             eEEEEECCCCCCHHHH
Confidence            3688999999999997

>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii}

Probab=94.35  E-value=0.0071  Score=46.71  Aligned_cols=22  Identities=36%  Similarity=0.484  Sum_probs=19.4

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +.+.+.+++.|+.|+|||||+|
T Consensus       164 ~~~~~~v~lvG~~gvGKSTLin  185 (357)
T 2e87_A          164 DLEIPTVVIAGHPNVGKSTLLK  185 (357)
T ss_dssp             CSSSCEEEEECSTTSSHHHHHH
T ss_pred             CCCCCEEEEECCCCCCHHHHHH
Confidence            3578899999999999999975

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*

Probab=94.35  E-value=0.0056  Score=47.68  Aligned_cols=19  Identities=21%  Similarity=0.162  Sum_probs=16.0

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      --++-|.|..|||||||++
T Consensus        90 g~ivgI~G~sGsGKSTL~~  108 (312)
T 3aez_A           90 PFIIGVAGSVAVGKSTTAR  108 (312)
T ss_dssp             CEEEEEECCTTSCHHHHHH
T ss_pred             CEEEEEECCCCchHHHHHH
Confidence            3478899999999999963

>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12

Probab=94.33  E-value=0.0037  Score=50.01  Aligned_cols=17  Identities=29%  Similarity=0.243  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        28 ~~~llGpnGsGKSTLLr   44 (348)
T 3d31_A           28 YFVILGPTGAGKTLFLE   44 (348)
T ss_dssp             EEEEECCCTHHHHHHHH
T ss_pred             EEEEECCCCccHHHHHH
Confidence            78899999999999974

>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens}

Probab=94.29  E-value=0.0052  Score=43.88  Aligned_cols=22  Identities=23%  Similarity=0.362  Sum_probs=17.7

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+.+-++|.|..|+|||||+|
T Consensus        26 ~~~~~~i~lvG~~g~GKStlin   47 (239)
T 3lxx_A           26 RNSQLRIVLVGKTGAGKSATGN   47 (239)
T ss_dssp             --CEEEEEEECCTTSSHHHHHH
T ss_pred             CCCceEEEEECCCCCCHHHHHH
Confidence            4556778999999999999975

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*

Probab=94.23  E-value=0.0033  Score=50.15  Aligned_cols=17  Identities=35%  Similarity=0.186  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        33 ~~~llGpnGsGKSTLLr   49 (353)
T 1oxx_K           33 RFGILGPSGAGKTTFMR   49 (353)
T ss_dssp             EEEEECSCHHHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A

Probab=94.22  E-value=0.0074  Score=44.44  Aligned_cols=17  Identities=18%  Similarity=0.155  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      =+++|.|..|+|||||+
T Consensus        31 ~i~~i~G~~GsGKTtl~   47 (279)
T 1nlf_A           31 TVGALVSPGGAGKSMLA   47 (279)
T ss_dssp             SEEEEEESTTSSHHHHH
T ss_pred             CEEEEEcCCCCCHHHHH
Confidence            38999999999999985

>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus}

Probab=94.21  E-value=0.0062  Score=46.63  Aligned_cols=17  Identities=29%  Similarity=0.376  Sum_probs=15.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.+.|..|+|||||||
T Consensus       167 i~~l~G~sG~GKSTLln  183 (302)
T 2yv5_A          167 ICILAGPSGVGKSSILS  183 (302)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999986

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=94.21  E-value=0.0076  Score=44.74  Aligned_cols=21  Identities=29%  Similarity=0.499  Sum_probs=17.9

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      ..+.|..+++|..|+|||||+
T Consensus        33 ~~~~~~~ll~Gp~G~GKTtl~   53 (354)
T 1sxj_E           33 PRDLPHLLLYGPNGTGKKTRC   53 (354)
T ss_dssp             TTCCCCEEEECSTTSSHHHHH
T ss_pred             CCCCCeEEEECCCCCCHHHHH
Confidence            356777999999999999985

>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A*

Probab=94.20  E-value=0.0054  Score=41.17  Aligned_cols=26  Identities=27%  Similarity=0.310  Sum_probs=16.6

Q ss_pred             CCCCCCCCceEEEecccCCCccCCCC
Q 033696           88 KIPPDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        88 ~~~~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...+..+..-++|.|.-|+|||||+|
T Consensus        14 ~~~~~~~~~~i~v~G~~~~GKSsli~   39 (181)
T 2h17_A           14 LVPRGSQEHKVIIVGLDNAGKTTILY   39 (181)
T ss_dssp             -------CEEEEEEEETTSSHHHHHH
T ss_pred             ccCCCCceeEEEEECCCCCCHHHHHH
Confidence            33444555678899999999999975

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}

Probab=94.19  E-value=0.015  Score=43.54  Aligned_cols=23  Identities=26%  Similarity=0.209  Sum_probs=18.6

Q ss_pred             CCCCCCCceEEEecccCCCccCC
Q 033696           89 IPPDNRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        89 ~~~~~riPvTIiTGfLGsGKtTL  111 (113)
                      ..+.++-.|+||.|..||||+|.
T Consensus        23 ~~~~~k~kiI~llGpPGsGKgTq   45 (217)
T 3umf_A           23 DQKLAKAKVIFVLGGPGSGKGTQ   45 (217)
T ss_dssp             -CCTTSCEEEEEECCTTCCHHHH
T ss_pred             chhccCCcEEEEECCCCCCHHHH
Confidence            34456678999999999999995

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20

Probab=94.18  E-value=0.0069  Score=44.82  Aligned_cols=19  Identities=26%  Similarity=0.434  Sum_probs=16.8

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      ..|.++|+|..|+|||||+
T Consensus        43 ~~~~~li~G~~G~GKTtl~   61 (389)
T 1fnn_A           43 HYPRATLLGRPGTGKTVTL   61 (389)
T ss_dssp             SCCEEEEECCTTSSHHHHH
T ss_pred             CCCeEEEECCCCCCHHHHH
Confidence            3578999999999999985

>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A

Probab=94.17  E-value=0.0065  Score=49.63  Aligned_cols=17  Identities=29%  Similarity=0.301  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        31 ~~~llGpsGsGKSTLLr   47 (381)
T 3rlf_A           31 FVVFVGPSGCGKSTLLR   47 (381)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEEcCCCchHHHHHH
Confidence            78899999999999974

>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B

Probab=94.07  E-value=0.0059  Score=51.46  Aligned_cols=22  Identities=32%  Similarity=0.379  Sum_probs=19.4

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +-.+|.+.|.|..|||||||||
T Consensus        42 ~l~lp~iaIvG~nGsGKSTLL~   63 (608)
T 3szr_A           42 DLALPAIAVIGDQSSGKSSVLE   63 (608)
T ss_dssp             SCCCCCEECCCCTTSCHHHHHH
T ss_pred             cccCCeEEEECCCCChHHHHHH
Confidence            4568899999999999999974

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*

Probab=94.05  E-value=0.011  Score=41.69  Aligned_cols=17  Identities=35%  Similarity=0.399  Sum_probs=15.0

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|+|+.||||||+.
T Consensus        26 ~~i~~~G~~GsGKsT~~   42 (211)
T 1m7g_A           26 LTIWLTGLSASGKSTLA   42 (211)
T ss_dssp             EEEEEECSTTSSHHHHH
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            47889999999999974

>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A*

Probab=94.04  E-value=0.0073  Score=53.31  Aligned_cols=18  Identities=39%  Similarity=0.215  Sum_probs=16.3

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -+++|||..|+||||||+
T Consensus       608 ~i~~ItGpNGsGKSTlLr  625 (800)
T 1wb9_A          608 RMLIITGPNMGGKSTYMR  625 (800)
T ss_dssp             CEEEEECCTTSSHHHHHH
T ss_pred             cEEEEECCCCCChHHHHH
Confidence            489999999999999974

>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A*

Probab=93.96  E-value=0.0078  Score=52.95  Aligned_cols=18  Identities=33%  Similarity=0.193  Sum_probs=16.3

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -+++|+|..|+||||||+
T Consensus       577 ~i~~I~GpNGsGKSTlLr  594 (765)
T 1ewq_A          577 ELVLITGPNMAGKSTFLR  594 (765)
T ss_dssp             CEEEEESCSSSSHHHHHH
T ss_pred             cEEEEECCCCCChHHHHH
Confidence            489999999999999974

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12

Probab=93.93  E-value=0.008  Score=47.43  Aligned_cols=18  Identities=39%  Similarity=0.261  Sum_probs=16.3

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -.+++|.|..|+||||||
T Consensus        26 ~~~~~i~G~nG~GKstll   43 (430)
T 1w1w_A           26 SNFTSIIGPNGSGKSNMM   43 (430)
T ss_dssp             CSEEEEECSTTSSHHHHH
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            369999999999999986

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C

Probab=93.91  E-value=0.0078  Score=49.00  Aligned_cols=18  Identities=28%  Similarity=0.213  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++-|.|..||||||||+
T Consensus        55 ei~~IiGpnGaGKSTLlr   72 (366)
T 3tui_C           55 QIYGVIGASGAGKSTLIR   72 (366)
T ss_dssp             CEEEEECCTTSSHHHHHH
T ss_pred             CEEEEEcCCCchHHHHHH
Confidence            378899999999999964

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}

Probab=93.89  E-value=0.01  Score=49.75  Aligned_cols=17  Identities=41%  Similarity=0.460  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||||
T Consensus       350 ~vaIiGpnGsGKSTLl~  366 (670)
T 3ux8_A          350 FVAVTGVSGSGKSTLVN  366 (670)
T ss_dssp             EEEEECSTTSSHHHHHT
T ss_pred             EEEEEeeCCCCHHHHHH
Confidence            67899999999999975

>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A*

Probab=93.88  E-value=0.0094  Score=45.84  Aligned_cols=22  Identities=27%  Similarity=0.312  Sum_probs=19.4

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...+|-++|.|.-|+|||||||
T Consensus        31 ~~~lp~I~vvG~~~sGKSSLln   52 (360)
T 3t34_A           31 WDSLPAIAVVGGQSSGKSSVLE   52 (360)
T ss_dssp             -CCCCEEEEECBTTSSHHHHHH
T ss_pred             cccCCEEEEECCCCCcHHHHHH
Confidence            3579999999999999999975

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}

Probab=93.83  E-value=0.0081  Score=46.55  Aligned_cols=16  Identities=38%  Similarity=0.580  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      |+.+.|..|||||||+
T Consensus       102 vi~lvG~nGsGKTTll  117 (302)
T 3b9q_A          102 VIMIVGVNGGGKTTSL  117 (302)
T ss_dssp             EEEEECCTTSCHHHHH
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            8889999999999986

>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C

Probab=93.81  E-value=0.015  Score=38.97  Aligned_cols=18  Identities=17%  Similarity=0.084  Sum_probs=4.4

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .-++|.|.-|+|||||+|
T Consensus        21 ~~i~v~G~~~~GKssli~   38 (208)
T 2yc2_C           21 CKVAVVGEATVGKSALIS   38 (208)
T ss_dssp             EEEEEC------------
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            457889999999999986

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}

Probab=93.76  E-value=0.0078  Score=45.69  Aligned_cols=18  Identities=33%  Similarity=0.499  Sum_probs=15.7

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -.+++|+|+.||||||+.
T Consensus        48 g~~i~l~G~~GsGKSTl~   65 (250)
T 3nwj_A           48 GRSMYLVGMMGSGKTTVG   65 (250)
T ss_dssp             TCCEEEECSTTSCHHHHH
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            357899999999999984

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*

Probab=93.76  E-value=0.011  Score=39.35  Aligned_cols=17  Identities=29%  Similarity=0.411  Sum_probs=15.2

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++.+|+|.-|+|||||+
T Consensus        46 ~~~ll~G~~G~GKT~l~   62 (250)
T 1njg_A           46 HAYLFSGTRGVGKTSIA   62 (250)
T ss_dssp             SEEEEECSTTSCHHHHH
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            47899999999999985

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}

Probab=93.74  E-value=0.013  Score=40.80  Aligned_cols=16  Identities=31%  Similarity=0.441  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|.|..|+|||||+
T Consensus        25 ~~~i~G~~GsGKTtl~   40 (247)
T 2dr3_A           25 VVLLSGGPGTGKTIFS   40 (247)
T ss_dssp             EEEEEECTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            8999999999999983

>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A*

Probab=93.71  E-value=0.012  Score=42.73  Aligned_cols=23  Identities=22%  Similarity=0.316  Sum_probs=20.1

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +....|-.+|.|..|+|||||||
T Consensus        22 ~~~~~~~i~vvG~~~~GKSSLln   44 (299)
T 2aka_B           22 ADLDLPQIAVVGGQSAGKSSVLE   44 (299)
T ss_dssp             TTCCCCEEEEEEBTTSCHHHHHH
T ss_pred             CCCCCCeEEEEeCCCCCHHHHHH
Confidence            34678999999999999999976

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*

Probab=93.69  E-value=0.015  Score=45.23  Aligned_cols=19  Identities=32%  Similarity=0.391  Sum_probs=16.0

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      --++.|.|..|||||||++
T Consensus       102 g~vi~lvG~nGsGKTTll~  120 (304)
T 1rj9_A          102 GRVVLVVGVNGVGKTTTIA  120 (304)
T ss_dssp             SSEEEEECSTTSSHHHHHH
T ss_pred             CeEEEEECCCCCcHHHHHH
Confidence            3488889999999999863

>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B*

Probab=93.65  E-value=0.008  Score=40.47  Aligned_cols=22  Identities=27%  Similarity=0.231  Sum_probs=16.9

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+..-++|.|..|+|||||+|
T Consensus        17 ~~~~~ki~v~G~~~~GKSsli~   38 (189)
T 1z06_A           17 RSRIFKIIVIGDSNVGKTCLTY   38 (189)
T ss_dssp             --CEEEEEEECCTTSSHHHHHH
T ss_pred             CCceEEEEEECCCCCCHHHHHH
Confidence            3455667889999999999975

>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8

Probab=93.61  E-value=0.0094  Score=45.37  Aligned_cols=17  Identities=24%  Similarity=0.407  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.+.|..|+|||||||
T Consensus       171 iv~l~G~sG~GKSTll~  187 (301)
T 1u0l_A          171 ISTMAGLSGVGKSSLLN  187 (301)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             eEEEECCCCCcHHHHHH
Confidence            78899999999999976

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}

Probab=93.58  E-value=0.0086  Score=49.36  Aligned_cols=20  Identities=30%  Similarity=0.315  Sum_probs=17.3

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +=+++.|.|..||||||||+
T Consensus       137 ~Ge~v~IvGpnGsGKSTLlr  156 (460)
T 2npi_A          137 EGPRVVIVGGSQTGKTSLSR  156 (460)
T ss_dssp             SCCCEEEEESTTSSHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHH
Confidence            34789999999999999974

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*

Probab=93.55  E-value=0.0064  Score=47.77  Aligned_cols=17  Identities=29%  Similarity=0.309  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        82 ~vaivG~sGsGKSTLl~   98 (306)
T 3nh6_A           82 TLALVGPSGAGKSTILR   98 (306)
T ss_dssp             EEEEESSSCHHHHHHHH
T ss_pred             EEEEECCCCchHHHHHH
Confidence            67899999999999964

>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A*

Probab=93.54  E-value=0.01  Score=53.48  Aligned_cols=18  Identities=39%  Similarity=0.168  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -+++|||..|+||||||+
T Consensus       663 ~i~~ItGpNGsGKSTlLr  680 (934)
T 3thx_A          663 MFHIITGPNMGGKSTYIR  680 (934)
T ss_dssp             CEEEEECCTTSSHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            489999999999999974

>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens}

Probab=93.52  E-value=0.0088  Score=41.43  Aligned_cols=23  Identities=26%  Similarity=0.338  Sum_probs=17.2

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +.....-++|.|.-|+|||||+|
T Consensus        19 ~~~~~~ki~vvG~~~vGKSsLi~   41 (195)
T 3cbq_A           19 QKDGIFKVMLVGESGVGKSTLAG   41 (195)
T ss_dssp             ---CEEEEEEECSTTSSHHHHHH
T ss_pred             CCCcEEEEEEECCCCCCHHHHHH
Confidence            34455678899999999999974

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*

Probab=93.51  E-value=0.009  Score=42.87  Aligned_cols=15  Identities=27%  Similarity=0.410  Sum_probs=14.0

Q ss_pred             EEEecccCCCccCCC
Q 033696           98 TIITGFLGSGKNTGS  112 (113)
Q Consensus        98 TIiTGfLGsGKtTLL  112 (113)
                      ++|.|..|+|||||+
T Consensus        52 ~ll~G~~G~GKTtl~   66 (254)
T 1ixz_A           52 VLLVGPPGVGKTHLA   66 (254)
T ss_dssp             EEEECCTTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            789999999999985

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20

Probab=93.49  E-value=0.0099  Score=43.01  Aligned_cols=17  Identities=29%  Similarity=0.524  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|+|.-|.|||+|+
T Consensus        31 ~~v~i~G~~G~GKT~L~   47 (357)
T 2fna_A           31 PITLVLGLRRTGKSSII   47 (357)
T ss_dssp             SEEEEEESTTSSHHHHH
T ss_pred             CcEEEECCCCCCHHHHH
Confidence            79999999999999986

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*

Probab=93.49  E-value=0.01  Score=46.83  Aligned_cols=17  Identities=18%  Similarity=0.133  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       128 ~vaIvGpsGsGKSTLl~  144 (305)
T 2v9p_A          128 CLAFIGPPNTGKSMLCN  144 (305)
T ss_dssp             EEEEECSSSSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            68899999999999974

>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B*

Probab=93.42  E-value=0.0074  Score=54.35  Aligned_cols=18  Identities=33%  Similarity=0.220  Sum_probs=16.3

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -+++|||..|+||||||+
T Consensus       674 ~i~~ItGPNGaGKSTlLr  691 (918)
T 3thx_B          674 RVMIITGPNMGGKSSYIK  691 (918)
T ss_dssp             CEEEEESCCCHHHHHHHH
T ss_pred             eEEEEECCCCCchHHHHH
Confidence            489999999999999974

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}

Probab=93.38  E-value=0.01  Score=48.20  Aligned_cols=18  Identities=33%  Similarity=0.278  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        48 e~~~llGpsGsGKSTLLr   65 (390)
T 3gd7_A           48 QRVGLLGRTGSGKSTLLS   65 (390)
T ss_dssp             CEEEEEESTTSSHHHHHH
T ss_pred             CEEEEECCCCChHHHHHH
Confidence            368899999999999974

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20

Probab=93.36  E-value=0.011  Score=38.38  Aligned_cols=17  Identities=24%  Similarity=0.307  Sum_probs=14.6

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      +..+|+|.-|+|||+|+
T Consensus        44 ~~~ll~G~~G~GKT~l~   60 (195)
T 1jbk_A           44 NNPVLIGEPGVGKTAIV   60 (195)
T ss_dssp             CEEEEECCTTSCHHHHH
T ss_pred             CceEEECCCCCCHHHHH
Confidence            45689999999999984

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*

Probab=93.33  E-value=0.0082  Score=40.16  Aligned_cols=18  Identities=22%  Similarity=0.270  Sum_probs=15.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .-+++.|.-|+|||||+|
T Consensus        22 ~ki~vvG~~~~GKSsli~   39 (190)
T 3con_A           22 YKLVVVGAGGVGKSALTI   39 (190)
T ss_dssp             EEEEEECSTTSSHHHHHH
T ss_pred             eEEEEECcCCCCHHHHHH
Confidence            356788999999999974

>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans}

Probab=93.32  E-value=0.011  Score=47.30  Aligned_cols=16  Identities=38%  Similarity=0.250  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|.|..|+||||||
T Consensus        28 ~~~i~G~nG~GKttll   43 (359)
T 2o5v_A           28 VTGIYGENGAGKTNLL   43 (359)
T ss_dssp             EEEEECCTTSSHHHHH
T ss_pred             eEEEECCCCCChhHHH
Confidence            9999999999999986

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*

Probab=93.27  E-value=0.012  Score=46.49  Aligned_cols=18  Identities=39%  Similarity=0.493  Sum_probs=15.8

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      =-++.+.|..|||||||+
T Consensus       129 g~vi~lvG~nGaGKTTll  146 (328)
T 3e70_C          129 PYVIMFVGFNGSGKTTTI  146 (328)
T ss_dssp             SEEEEEECCTTSSHHHHH
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            348899999999999986

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}

Probab=93.27  E-value=0.012  Score=49.06  Aligned_cols=18  Identities=33%  Similarity=0.324  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        48 e~~~LvG~NGaGKSTLlk   65 (538)
T 1yqt_A           48 MVVGIVGPNGTGKSTAVK   65 (538)
T ss_dssp             SEEEEECCTTSSHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            378899999999999974

>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B*

Probab=93.20  E-value=0.012  Score=53.18  Aligned_cols=18  Identities=28%  Similarity=0.174  Sum_probs=16.4

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -+++|||..|+||||||+
T Consensus       790 ~i~~ItGpNgsGKSTlLr  807 (1022)
T 2o8b_B          790 YCVLVTGPNMGGKSTLMR  807 (1022)
T ss_dssp             CEEEEECCTTSSHHHHHH
T ss_pred             cEEEEECCCCCChHHHHH
Confidence            589999999999999974

>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A*

Probab=93.19  E-value=0.011  Score=48.47  Aligned_cols=20  Identities=30%  Similarity=0.338  Sum_probs=17.7

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +-+++-|.|..|+|||||||
T Consensus        68 ~~~~valvG~nGaGKSTLln   87 (413)
T 1tq4_A           68 SVLNVAVTGETGSGKSSFIN   87 (413)
T ss_dssp             CCEEEEEEECTTSSHHHHHH
T ss_pred             CCeEEEEECCCCCcHHHHHH
Confidence            45689999999999999976

>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A

Probab=93.16  E-value=0.016  Score=47.95  Aligned_cols=17  Identities=29%  Similarity=0.405  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       369 ~~~ivG~sGsGKSTll~  385 (578)
T 4a82_A          369 TVAFVGMSGGGKSTLIN  385 (578)
T ss_dssp             EEEEECSTTSSHHHHHT
T ss_pred             EEEEECCCCChHHHHHH
Confidence            67899999999999975

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A

Probab=93.16  E-value=0.016  Score=39.54  Aligned_cols=19  Identities=21%  Similarity=0.200  Sum_probs=16.3

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +-+..+|+|..|+|||||+
T Consensus        51 ~~~~~ll~G~~G~GKT~la   69 (242)
T 3bos_A           51 GVQAIYLWGPVKSGRTHLI   69 (242)
T ss_dssp             SCSEEEEECSTTSSHHHHH
T ss_pred             CCCeEEEECCCCCCHHHHH
Confidence            3467899999999999984

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*

Probab=93.02  E-value=0.013  Score=47.82  Aligned_cols=17  Identities=35%  Similarity=0.522  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||++
T Consensus        41 ~~~l~G~nGsGKSTL~~   57 (525)
T 1tf7_A           41 STLVSGTSGTGKTLFSI   57 (525)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHH
Confidence            79999999999999963

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}

Probab=93.01  E-value=0.023  Score=42.84  Aligned_cols=19  Identities=32%  Similarity=0.398  Sum_probs=15.9

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +.-+++|+|.-||||||+.
T Consensus        74 ~~~iI~I~G~~GSGKSTva   92 (281)
T 2f6r_A           74 GLYVLGLTGISGSGKSSVA   92 (281)
T ss_dssp             TCEEEEEEECTTSCHHHHH
T ss_pred             CCEEEEEECCCCCCHHHHH
Confidence            3457899999999999973

>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1

Probab=93.01  E-value=0.011  Score=45.67  Aligned_cols=17  Identities=29%  Similarity=0.173  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ...|.|..|||||||++
T Consensus       172 k~~IvG~nGsGKSTLlk  188 (365)
T 1lw7_A          172 TVAILGGESSGKSVLVN  188 (365)
T ss_dssp             EEEEECCTTSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            57899999999999964

>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V

Probab=92.98  E-value=0.014  Score=47.27  Aligned_cols=17  Identities=29%  Similarity=0.378  Sum_probs=15.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+|||||||
T Consensus       217 ~~~lvG~sG~GKSTLln  233 (358)
T 2rcn_A          217 ISIFAGQSGVGKSSLLN  233 (358)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCccHHHHHH
Confidence            78999999999999986

>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum}

Probab=92.97  E-value=0.016  Score=40.76  Aligned_cols=22  Identities=18%  Similarity=0.217  Sum_probs=18.6

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +.+.+-++|.|..|+|||||+|
T Consensus        26 ~~~~~kI~vvG~~~vGKSsLin   47 (228)
T 2qu8_A           26 NPHKKTIILSGAPNVGKSSFMN   47 (228)
T ss_dssp             CTTSEEEEEECSTTSSHHHHHH
T ss_pred             CCCCCEEEEECCCCCCHHHHHH
Confidence            3566788999999999999975

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6

Probab=92.93  E-value=0.019  Score=44.22  Aligned_cols=20  Identities=30%  Similarity=0.233  Sum_probs=16.8

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ++-.++.|.|..|||||||.
T Consensus        29 ~~~~ii~I~G~sGsGKSTla   48 (290)
T 1odf_A           29 KCPLFIFFSGPQGSGKSFTS   48 (290)
T ss_dssp             CSCEEEEEECCTTSSHHHHH
T ss_pred             CCCeEEEEECCCCCCHHHHH
Confidence            44568889999999999984

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}

Probab=92.89  E-value=0.014  Score=48.53  Aligned_cols=17  Identities=35%  Similarity=0.194  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus       314 ~~~i~G~NGsGKSTLlk  330 (538)
T 1yqt_A          314 VIGIVGPNGIGKTTFVK  330 (538)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}

Probab=92.86  E-value=0.017  Score=47.79  Aligned_cols=17  Identities=35%  Similarity=0.436  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       371 ~~~ivG~sGsGKSTll~  387 (582)
T 3b5x_A          371 TVALVGRSGSGKSTIAN  387 (582)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}

Probab=92.85  E-value=0.025  Score=41.40  Aligned_cols=16  Identities=44%  Similarity=0.461  Sum_probs=14.6

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      .+++|+|..||||||+
T Consensus        30 ~~I~l~G~~GsGKsT~   45 (243)
T 3tlx_A           30 GRYIFLGAPGSGKGTQ   45 (243)
T ss_dssp             EEEEEECCTTSSHHHH
T ss_pred             cEEEEECCCCCCHHHH
Confidence            4789999999999997

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}

Probab=92.81  E-value=0.015  Score=42.04  Aligned_cols=17  Identities=29%  Similarity=0.438  Sum_probs=16.0

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|+|.-|.|||||+
T Consensus        32 ~~v~i~G~~G~GKT~Ll   48 (350)
T 2qen_A           32 PLTLLLGIRRVGKSSLL   48 (350)
T ss_dssp             SEEEEECCTTSSHHHHH
T ss_pred             CeEEEECCCcCCHHHHH
Confidence            79999999999999986

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11

Probab=92.80  E-value=0.014  Score=45.72  Aligned_cols=17  Identities=35%  Similarity=0.407  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -+|.|.|..|||||||+
T Consensus       132 ~i~~I~G~~GsGKTTL~  148 (349)
T 1pzn_A          132 AITEVFGEFGSGKTQLA  148 (349)
T ss_dssp             EEEEEEESTTSSHHHHH
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            38999999999999985

>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=92.78  E-value=0.007  Score=40.95  Aligned_cols=21  Identities=19%  Similarity=0.107  Sum_probs=17.0

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +...=++|.|..|+|||||+|
T Consensus        21 ~~~~ki~v~G~~~~GKSsli~   41 (191)
T 3dz8_A           21 DYMFKLLIIGNSSVGKTSFLF   41 (191)
T ss_dssp             EECEEEEEEESTTSSHHHHHH
T ss_pred             CeeeEEEEECCCCcCHHHHHH
Confidence            345567889999999999975

>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}

Probab=92.78  E-value=0.0097  Score=50.40  Aligned_cols=17  Identities=35%  Similarity=0.499  Sum_probs=15.3

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -+++|+|+.|||||||+
T Consensus       370 ~iI~LiG~sGSGKSTLa  386 (552)
T 3cr8_A          370 FTVFFTGLSGAGKSTLA  386 (552)
T ss_dssp             EEEEEEESSCHHHHHHH
T ss_pred             eEEEEECCCCChHHHHH
Confidence            47899999999999985

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}

Probab=92.77  E-value=0.022  Score=37.75  Aligned_cols=19  Identities=32%  Similarity=0.607  Sum_probs=15.9

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +.|..+|+|.-|+|||+|+
T Consensus        37 ~~~~~ll~G~~G~GKT~l~   55 (226)
T 2chg_A           37 NIPHLLFSGPPGTGKTATA   55 (226)
T ss_dssp             CCCCEEEECSTTSSHHHHH
T ss_pred             CCCeEEEECCCCCCHHHHH
Confidence            4455899999999999974

>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens}

Probab=92.70  E-value=0.014  Score=39.26  Aligned_cols=22  Identities=23%  Similarity=0.187  Sum_probs=16.5

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+..-.+|.|.-|+|||||+|
T Consensus        18 ~~~~~ki~v~G~~~~GKSsli~   39 (190)
T 2h57_A           18 GSKEVHVLCLGLDNSGKTTIIN   39 (190)
T ss_dssp             ---CEEEEEEECTTSSHHHHHH
T ss_pred             CCCccEEEEECCCCCCHHHHHH
Confidence            3445667899999999999975

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*

Probab=92.70  E-value=0.016  Score=49.34  Aligned_cols=17  Identities=35%  Similarity=0.194  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       384 i~~i~G~NGsGKSTLlk  400 (607)
T 3bk7_A          384 VIGIVGPNGIGKTTFVK  400 (607)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999974

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}

Probab=92.70  E-value=0.014  Score=43.93  Aligned_cols=15  Identities=27%  Similarity=0.426  Sum_probs=14.0

Q ss_pred             EEEecccCCCccCCC
Q 033696           98 TIITGFLGSGKNTGS  112 (113)
Q Consensus        98 TIiTGfLGsGKtTLL  112 (113)
                      +++.|..|+|||||+
T Consensus        47 vlL~Gp~GtGKTtLa   61 (274)
T 2x8a_A           47 VLLAGPPGCGKTLLA   61 (274)
T ss_dssp             EEEESSTTSCHHHHH
T ss_pred             EEEECCCCCcHHHHH
Confidence            889999999999985

>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A*

Probab=92.69  E-value=0.016  Score=39.61  Aligned_cols=26  Identities=19%  Similarity=0.286  Sum_probs=16.4

Q ss_pred             CCCCCCCCceEEEecccCCCccCCCC
Q 033696           88 KIPPDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        88 ~~~~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...+.++..=.+|.|..|+|||||+|
T Consensus        13 ~~~~~~~~~ki~~vG~~~vGKTsLi~   38 (196)
T 3llu_A           13 NLYFQGSKPRILLMGLRRSGKSSIQK   38 (196)
T ss_dssp             -------CCEEEEEESTTSSHHHHHH
T ss_pred             CCcccCcceEEEEECCCCCCHHHHHH
Confidence            33445566677889999999999964

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*

Probab=92.68  E-value=0.016  Score=49.32  Aligned_cols=18  Identities=33%  Similarity=0.316  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus       118 e~~~LiG~NGsGKSTLlk  135 (607)
T 3bk7_A          118 MVVGIVGPNGTGKTTAVK  135 (607)
T ss_dssp             SEEEEECCTTSSHHHHHH
T ss_pred             CEEEEECCCCChHHHHHH
Confidence            378899999999999974

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20

Probab=92.63  E-value=0.015  Score=42.70  Aligned_cols=15  Identities=27%  Similarity=0.410  Sum_probs=13.9

Q ss_pred             EEEecccCCCccCCC
Q 033696           98 TIITGFLGSGKNTGS  112 (113)
Q Consensus        98 TIiTGfLGsGKtTLL  112 (113)
                      ++|.|..|+|||||+
T Consensus        76 vll~Gp~GtGKTtl~   90 (278)
T 1iy2_A           76 VLLVGPPGVGKTHLA   90 (278)
T ss_dssp             EEEECCTTSSHHHHH
T ss_pred             EEEECCCcChHHHHH
Confidence            789999999999985

>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A*

Probab=92.60  E-value=0.018  Score=45.96  Aligned_cols=26  Identities=23%  Similarity=0.103  Sum_probs=18.0

Q ss_pred             CCCCCCCCceEEEecccCCCccCCCC
Q 033696           88 KIPPDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        88 ~~~~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..+.-+.|.++|.|..|+|||||+|
T Consensus        16 ~~~~~m~~~~V~lvG~~nvGKSTL~n   41 (456)
T 4dcu_A           16 PRGSHMGKPVVAIVGRPNVGKSTIFN   41 (456)
T ss_dssp             -------CCEEEEECSSSSSHHHHHH
T ss_pred             CChhhcCCCEEEEECCCCCcHHHHHH
Confidence            44445668999999999999999975

>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1

Probab=92.57  E-value=0.016  Score=47.43  Aligned_cols=21  Identities=24%  Similarity=0.270  Sum_probs=18.5

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..+++.|.|+.|+|||||||
T Consensus       155 k~g~~VgLVG~~gAGKSTLL~  175 (416)
T 1udx_A          155 MLIADVGLVGYPNAGKSSLLA  175 (416)
T ss_dssp             CCSCSEEEECCGGGCHHHHHH
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            457889999999999999975

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}

Probab=92.57  E-value=0.017  Score=46.50  Aligned_cols=16  Identities=38%  Similarity=0.580  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      |+.|.|..|||||||+
T Consensus       159 vi~lvG~nGsGKTTll  174 (359)
T 2og2_A          159 VIMIVGVNGGGKTTSL  174 (359)
T ss_dssp             EEEEECCTTSCHHHHH
T ss_pred             EEEEEcCCCChHHHHH
Confidence            8889999999999986

>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A*

Probab=92.55  E-value=0.014  Score=40.09  Aligned_cols=21  Identities=24%  Similarity=0.137  Sum_probs=16.6

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ++..=++|.|..|+|||||+|
T Consensus        23 ~~~~ki~vvG~~~~GKSsLi~   43 (217)
T 2f7s_A           23 DYLIKLLALGDSGVGKTTFLY   43 (217)
T ss_dssp             SEEEEEEEESCTTSSHHHHHH
T ss_pred             ceeEEEEEECcCCCCHHHHHH
Confidence            334557888999999999975

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}

Probab=92.54  E-value=0.017  Score=49.34  Aligned_cols=17  Identities=29%  Similarity=0.286  Sum_probs=15.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus       105 i~~LvGpNGaGKSTLLk  121 (608)
T 3j16_B          105 VLGLVGTNGIGKSTALK  121 (608)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            78999999999999974

>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=92.52  E-value=0.016  Score=39.20  Aligned_cols=21  Identities=24%  Similarity=0.271  Sum_probs=16.5

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..-++|.|..|+|||||+|
T Consensus        18 ~~~~~i~v~G~~~~GKSsli~   38 (213)
T 3cph_A           18 DSIMKILLIGDSGVGKSCLLV   38 (213)
T ss_dssp             --CEEEEEECSTTSSHHHHHH
T ss_pred             CcceEEEEECCCCCCHHHHHH
Confidence            445678899999999999975

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}

Probab=92.50  E-value=0.022  Score=47.46  Aligned_cols=17  Identities=35%  Similarity=0.372  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       383 ~~~ivG~sGsGKSTll~  399 (598)
T 3qf4_B          383 KVALVGPTGSGKTTIVN  399 (598)
T ss_dssp             EEEEECCTTSSTTHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            68899999999999964

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}

Probab=92.49  E-value=0.018  Score=48.31  Aligned_cols=17  Identities=29%  Similarity=0.161  Sum_probs=15.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      |+-|.|..||||||||+
T Consensus        27 i~gLiGpNGaGKSTLlk   43 (538)
T 3ozx_A           27 ILGVLGKNGVGKTTVLK   43 (538)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens}

Probab=92.47  E-value=0.014  Score=39.85  Aligned_cols=21  Identities=24%  Similarity=0.327  Sum_probs=16.9

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..-++|.|.-|+|||||+|
T Consensus        22 ~~~~ki~vvG~~~~GKSsli~   42 (201)
T 3oes_A           22 VRYRKVVILGYRCVGKTSLAH   42 (201)
T ss_dssp             -CEEEEEEEESTTSSHHHHHH
T ss_pred             CCcEEEEEECCCCcCHHHHHH
Confidence            445567899999999999975

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*

Probab=92.46  E-value=0.055  Score=43.11  Aligned_cols=18  Identities=33%  Similarity=0.493  Sum_probs=15.8

Q ss_pred             CCceEEEecccCCCccCC
Q 033696           94 RIPATIITGFLGSGKNTG  111 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTL  111 (113)
                      +-.++||+|+.||||||+
T Consensus       257 ~~~lIil~G~pGSGKSTl  274 (416)
T 3zvl_A          257 NPEVVVAVGFPGAGKSTF  274 (416)
T ss_dssp             SCCEEEEESCTTSSHHHH
T ss_pred             CCEEEEEECCCCCCHHHH
Confidence            346889999999999997

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}

Probab=92.46  E-value=0.018  Score=48.27  Aligned_cols=17  Identities=35%  Similarity=0.188  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus       296 i~~i~G~nGsGKSTLl~  312 (538)
T 3ozx_A          296 IIGILGPNGIGKTTFAR  312 (538)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999964

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=92.43  E-value=0.021  Score=47.50  Aligned_cols=21  Identities=24%  Similarity=0.099  Sum_probs=17.2

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+|-+.|.|..|+|||||||
T Consensus        40 Gei~~vaLvG~nGaGKSTLln   60 (427)
T 2qag_B           40 GFCFNILCVGETGLGKSTLMD   60 (427)
T ss_dssp             CCEEEEEEECSTTSSSHHHHH
T ss_pred             CCeeEEEEECCCCCCHHHHHH
Confidence            334558899999999999975

>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8

Probab=92.36  E-value=0.013  Score=39.82  Aligned_cols=20  Identities=25%  Similarity=0.223  Sum_probs=15.9

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..=++|.|..|+|||||+|
T Consensus        22 ~~~ki~vvG~~~~GKSsli~   41 (192)
T 2fg5_A           22 RELKVCLLGDTGVGKSSIVC   41 (192)
T ss_dssp             EEEEEEEEECTTSSHHHHHH
T ss_pred             CceEEEEECcCCCCHHHHHH
Confidence            33456788999999999975

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=92.32  E-value=0.022  Score=42.95  Aligned_cols=20  Identities=25%  Similarity=0.514  Sum_probs=17.5

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .++|-.+++|..|+|||||+
T Consensus        44 g~~~~~ll~Gp~G~GKTtla   63 (340)
T 1sxj_C           44 GKLPHLLFYGPPGTGKTSTI   63 (340)
T ss_dssp             TCCCCEEEECSSSSSHHHHH
T ss_pred             CCCceEEEECCCCCCHHHHH
Confidence            46778999999999999984

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A

Probab=92.31  E-value=0.018  Score=47.62  Aligned_cols=17  Identities=35%  Similarity=0.464  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus       371 ~~~ivG~sGsGKSTLl~  387 (582)
T 3b60_A          371 TVALVGRSGSGKSTIAS  387 (582)
T ss_dssp             EEEEEECTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999964

>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A*

Probab=92.27  E-value=0.02  Score=48.25  Aligned_cols=18  Identities=39%  Similarity=0.431  Sum_probs=16.2

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        30 e~~~liG~nGsGKSTLl~   47 (483)
T 3euj_A           30 LVTTLSGGNGAGKSTTMA   47 (483)
T ss_dssp             SEEEEECCTTSSHHHHHH
T ss_pred             ceEEEECCCCCcHHHHHH
Confidence            688999999999999974

>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens}

Probab=92.25  E-value=0.016  Score=39.47  Aligned_cols=19  Identities=32%  Similarity=0.282  Sum_probs=15.5

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      ..=++|.|..|+|||||+|
T Consensus        26 ~~ki~vvG~~~~GKSsLi~   44 (192)
T 2il1_A           26 KLQVIIIGSRGVGKTSLME   44 (192)
T ss_dssp             EEEEEEECSTTSSHHHHHH
T ss_pred             ceEEEEECCCCCCHHHHHH
Confidence            3446788999999999975

>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8

Probab=92.23  E-value=0.009  Score=47.14  Aligned_cols=17  Identities=29%  Similarity=0.407  Sum_probs=16.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|+|||||||
T Consensus       175 ~~~lvG~sG~GKSTLln  191 (307)
T 1t9h_A          175 TTVFAGQSGVGKSSLLN  191 (307)
T ss_dssp             EEEEEESHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            89999999999999986

>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A*

Probab=92.18  E-value=0.017  Score=38.97  Aligned_cols=19  Identities=32%  Similarity=0.230  Sum_probs=15.5

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      .-=++|.|.-|+|||||+|
T Consensus        21 ~~ki~v~G~~~~GKSsli~   39 (191)
T 2a5j_A           21 LFKYIIIGDTGVGKSCLLL   39 (191)
T ss_dssp             EEEEEEESSTTSSHHHHHH
T ss_pred             ceEEEEECcCCCCHHHHHH
Confidence            3446788999999999974

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}

Probab=92.18  E-value=0.031  Score=38.77  Aligned_cols=15  Identities=40%  Similarity=0.545  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      +|+|+|..|+|||+|
T Consensus        32 l~~i~G~pG~GKT~l   46 (251)
T 2zts_A           32 TVLLTGGTGTGKTTF   46 (251)
T ss_dssp             EEEEECCTTSSHHHH
T ss_pred             EEEEEeCCCCCHHHH
Confidence            899999999999997

>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans}

Probab=92.16  E-value=0.015  Score=47.32  Aligned_cols=16  Identities=31%  Similarity=0.285  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|..||||||||
T Consensus        62 ~n~i~G~NGaGKS~ll   77 (517)
T 4ad8_A           62 FCAFTGETGAGKSIIV   77 (517)
T ss_dssp             EEEEEESHHHHHHHHT
T ss_pred             eEEEEcCCCCCHHHHH
Confidence            9999999999999997

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}

Probab=92.14  E-value=0.022  Score=41.63  Aligned_cols=19  Identities=26%  Similarity=0.412  Sum_probs=16.4

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      .-..++|+|.-|+|||||+
T Consensus        44 ~~~~vli~G~~G~GKTtl~   62 (386)
T 2qby_A           44 KPNNIFIYGLTGTGKTAVV   62 (386)
T ss_dssp             CCCCEEEEECTTSSHHHHH
T ss_pred             CCCeEEEECCCCCCHHHHH
Confidence            3457899999999999985

>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A*

Probab=92.10  E-value=0.018  Score=38.93  Aligned_cols=20  Identities=25%  Similarity=0.130  Sum_probs=16.1

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..-++|.|.-|+|||||+|
T Consensus        21 ~~~ki~v~G~~~~GKSsli~   40 (188)
T 1zd9_A           21 EEMELTLVGLQYSGKTTFVN   40 (188)
T ss_dssp             EEEEEEEECSTTSSHHHHHH
T ss_pred             CccEEEEECCCCCCHHHHHH
Confidence            34456889999999999975

>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A

Probab=92.08  E-value=0.02  Score=41.15  Aligned_cols=21  Identities=24%  Similarity=0.362  Sum_probs=17.1

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..-++|.|..|+|||||+|
T Consensus        20 ~~~~~I~lvG~~g~GKStl~n   40 (260)
T 2xtp_A           20 RSELRIILVGKTGTGKSAAGN   40 (260)
T ss_dssp             -CCEEEEEEECTTSCHHHHHH
T ss_pred             CCceEEEEECCCCCCHHHHHH
Confidence            445678899999999999975

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}

Probab=92.07  E-value=0.021  Score=48.77  Aligned_cols=18  Identities=28%  Similarity=0.305  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =|+.|.|..||||||||+
T Consensus       379 Eiv~iiG~NGsGKSTLlk  396 (608)
T 3j16_B          379 EILVMMGENGTGKTTLIK  396 (608)
T ss_dssp             CEEEEESCTTSSHHHHHH
T ss_pred             eEEEEECCCCCcHHHHHH
Confidence            368899999999999974

>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens}

Probab=92.02  E-value=0.018  Score=39.61  Aligned_cols=20  Identities=20%  Similarity=0.203  Sum_probs=16.0

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..=++|.|..|+|||||+|
T Consensus        24 ~~~ki~v~G~~~~GKSsLi~   43 (200)
T 2o52_A           24 FLFKFLVIGSAGTGKSCLLH   43 (200)
T ss_dssp             EEEEEEEEESTTSSHHHHHH
T ss_pred             cceEEEEECcCCCCHHHHHH
Confidence            34456788999999999975

>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=92.01  E-value=0.019  Score=38.96  Aligned_cols=18  Identities=28%  Similarity=0.211  Sum_probs=15.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .=++|.|..|+|||||+|
T Consensus        29 ~ki~v~G~~~vGKSsli~   46 (196)
T 2atv_A           29 VKLAIFGRAGVGKSALVV   46 (196)
T ss_dssp             EEEEEECCTTSSHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            346788999999999974

>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A*

Probab=92.00  E-value=0.022  Score=38.28  Aligned_cols=20  Identities=15%  Similarity=0.056  Sum_probs=16.3

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...-++|.|..|+|||||+|
T Consensus        21 ~~~ki~vvG~~~~GKSsli~   40 (189)
T 2gf9_A           21 YMFKLLLIGNSSVGKTSFLF   40 (189)
T ss_dssp             EEEEEEEECSTTSSHHHHHH
T ss_pred             ceeEEEEECCCCCCHHHHHH
Confidence            34557888999999999975

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}

Probab=91.98  E-value=0.022  Score=45.18  Aligned_cols=16  Identities=38%  Similarity=0.378  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      |+-|.|..|||||||+
T Consensus        94 iigI~GpsGSGKSTl~  109 (321)
T 3tqc_A           94 IIGIAGSVAVGKSTTS  109 (321)
T ss_dssp             EEEEECCTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            6789999999999985

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}

Probab=91.94  E-value=0.028  Score=47.17  Aligned_cols=17  Identities=35%  Similarity=0.604  Sum_probs=15.1

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -++-|.|..||||||||
T Consensus        45 e~~~liGpNGaGKSTLl   61 (670)
T 3ux8_A           45 KLVVLTGLSGSGKSSLA   61 (670)
T ss_dssp             SEEEEECSTTSSHHHHH
T ss_pred             CEEEEECCCCCCHHHHh
Confidence            37889999999999995

>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens}

Probab=91.20  E-value=0.029  Score=38.24  Aligned_cols=19  Identities=16%  Similarity=0.031  Sum_probs=15.5

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      .--++|.|.-|+|||||+|
T Consensus        30 ~~ki~v~G~~~~GKSsli~   48 (204)
T 3th5_A           30 AIKCVVVGDGAVGKTCLLI   48 (204)
Confidence            3346788999999999985

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A

Probab=91.76  E-value=0.034  Score=40.78  Aligned_cols=19  Identities=32%  Similarity=0.190  Sum_probs=15.8

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +--+++|.|..||||||++
T Consensus        25 ~g~~i~i~G~~GsGKsT~~   43 (229)
T 4eaq_A           25 MSAFITFEGPEGSGKTTVI   43 (229)
T ss_dssp             CCEEEEEECCTTSCHHHHH
T ss_pred             CCeEEEEEcCCCCCHHHHH
Confidence            3447889999999999984

>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A*

Probab=91.70  E-value=0.021  Score=38.48  Aligned_cols=20  Identities=15%  Similarity=0.071  Sum_probs=15.9

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +.-=++|.|..|+|||||+|
T Consensus        22 ~~~ki~~vG~~~~GKSsl~~   41 (194)
T 3reg_A           22 KALKIVVVGDGAVGKTCLLL   41 (194)
T ss_dssp             EEEEEEEECSTTSSHHHHHH
T ss_pred             eeeEEEEECcCCCCHHHHHH
Confidence            33446789999999999975

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A

Probab=91.64  E-value=0.026  Score=48.29  Aligned_cols=17  Identities=29%  Similarity=0.481  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      |+.|.|..||||||||+
T Consensus       295 VI~LVGpNGSGKTTLl~  311 (503)
T 2yhs_A          295 VILMVGVNGVGKTTTIG  311 (503)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCcccHHHHHH
Confidence            88899999999999863

>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0

Probab=91.61  E-value=0.022  Score=38.90  Aligned_cols=19  Identities=32%  Similarity=0.165  Sum_probs=15.5

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      --=++|.|..|+|||||+|
T Consensus        20 ~~ki~ivG~~~vGKSsL~~   38 (184)
T 3ihw_A           20 ELKVGIVGNLSSGKSALVH   38 (184)
T ss_dssp             EEEEEEECCTTSCHHHHHH
T ss_pred             eeEEEEECCCCCCHHHHHH
Confidence            3456788999999999974

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}

Probab=91.56  E-value=0.044  Score=44.48  Aligned_cols=18  Identities=22%  Similarity=0.361  Sum_probs=16.0

Q ss_pred             CCceEEEecccCCCccCC
Q 033696           94 RIPATIITGFLGSGKNTG  111 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTL  111 (113)
                      +-+++||.|+.|+|||||
T Consensus        39 ~~~lIvI~GPTgsGKTtL   56 (339)
T 3a8t_A           39 KEKLLVLMGATGTGKSRL   56 (339)
T ss_dssp             CCEEEEEECSTTSSHHHH
T ss_pred             CCceEEEECCCCCCHHHH
Confidence            446999999999999997

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}

Probab=91.48  E-value=0.035  Score=38.17  Aligned_cols=17  Identities=24%  Similarity=0.270  Sum_probs=14.7

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ..++|+|..|+|||+|+
T Consensus        55 ~~~~l~G~~GtGKT~la   71 (202)
T 2w58_A           55 KGLYLHGSFGVGKTYLL   71 (202)
T ss_dssp             CEEEEECSTTSSHHHHH
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            46788999999999984

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}

Probab=91.43  E-value=0.028  Score=46.87  Aligned_cols=17  Identities=35%  Similarity=0.337  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..|||||||++
T Consensus       371 ~~~ivG~sGsGKSTll~  387 (587)
T 3qf4_A          371 LVAVLGETGSGKSTLMN  387 (587)
T ss_dssp             EEEEECSSSSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999964

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}

Probab=91.37  E-value=0.046  Score=35.69  Aligned_cols=18  Identities=28%  Similarity=0.244  Sum_probs=14.9

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -+..+|+|.-|+|||+|+
T Consensus        43 ~~~vll~G~~G~GKT~la   60 (187)
T 2p65_A           43 KNNPILLGDPGVGKTAIV   60 (187)
T ss_dssp             SCEEEEESCGGGCHHHHH
T ss_pred             CCceEEECCCCCCHHHHH
Confidence            345599999999999974

>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8

Probab=91.34  E-value=0.027  Score=40.76  Aligned_cols=20  Identities=25%  Similarity=0.285  Sum_probs=16.4

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...=++|.|..|+|||||+|
T Consensus        36 ~~~kVvlvG~~~vGKSSLl~   55 (211)
T 2g3y_A           36 TYYRVVLIGEQGVGKSTLAN   55 (211)
T ss_dssp             CEEEEEEECCTTSSHHHHHH
T ss_pred             CceEEEEECCCCCCHHHHHH
Confidence            34457899999999999975

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20

Probab=91.33  E-value=0.025  Score=40.61  Aligned_cols=15  Identities=27%  Similarity=0.437  Sum_probs=13.6

Q ss_pred             EEEecccCCCccCCC
Q 033696           98 TIITGFLGSGKNTGS  112 (113)
Q Consensus        98 TIiTGfLGsGKtTLL  112 (113)
                      ++|+|..|+|||||+
T Consensus        48 vll~G~~GtGKT~la   62 (257)
T 1lv7_A           48 VLMVGPPGTGKTLLA   62 (257)
T ss_dssp             EEEECCTTSCHHHHH
T ss_pred             EEEECcCCCCHHHHH
Confidence            789999999999984

>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major}

Probab=91.32  E-value=0.022  Score=38.11  Aligned_cols=20  Identities=20%  Similarity=0.210  Sum_probs=16.3

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..-.+|.|.-|+|||||+|
T Consensus        21 ~~~~i~v~G~~~~GKssli~   40 (189)
T 2x77_A           21 RKIRVLMLGLDNAGKTSILY   40 (189)
T ss_dssp             SCEEEEEEEETTSSHHHHHH
T ss_pred             CceEEEEECCCCCCHHHHHH
Confidence            33457889999999999974

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*

Probab=91.23  E-value=0.035  Score=42.75  Aligned_cols=18  Identities=28%  Similarity=0.340  Sum_probs=15.7

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      --|+++.|..|+||||++
T Consensus       105 g~vi~lvG~~GsGKTTl~  122 (296)
T 2px0_A          105 SKYIVLFGSTGAGKTTTL  122 (296)
T ss_dssp             SSEEEEEESTTSSHHHHH
T ss_pred             CcEEEEECCCCCCHHHHH
Confidence            348999999999999984

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10

Probab=91.18  E-value=0.038  Score=43.17  Aligned_cols=17  Identities=29%  Similarity=0.518  Sum_probs=15.1

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -|+.|+|..|+||||++
T Consensus       105 ~vi~ivG~~GsGKTTl~  121 (306)
T 1vma_A          105 FVIMVVGVNGTGKTTSC  121 (306)
T ss_dssp             EEEEEECCTTSSHHHHH
T ss_pred             eEEEEEcCCCChHHHHH
Confidence            48889999999999984

>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B*

Probab=91.10  E-value=0.025  Score=38.66  Aligned_cols=18  Identities=22%  Similarity=0.202  Sum_probs=15.5

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .-+++.|..|+|||||+|
T Consensus        24 ~ki~~vG~~~vGKSsli~   41 (190)
T 1m2o_B           24 GKLLFLGLDNAGKTTLLH   41 (190)
T ss_dssp             CEEEEEESTTSSHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            457899999999999974

>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A*

Probab=91.08  E-value=0.025  Score=39.10  Aligned_cols=17  Identities=24%  Similarity=0.251  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -+++.|..|+|||||+|
T Consensus        27 ki~lvG~~~vGKSsLi~   43 (198)
T 1f6b_A           27 KLVFLGLDNAGKTTLLH   43 (198)
T ss_dssp             EEEEEEETTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46889999999999974

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*

Probab=91.07  E-value=0.03  Score=45.65  Aligned_cols=16  Identities=31%  Similarity=0.372  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.|.|..|+|||||+
T Consensus       283 i~~i~G~~GsGKSTLl  298 (525)
T 1tf7_A          283 IILATGATGTGKTLLV  298 (525)
T ss_dssp             EEEEEECTTSSHHHHH
T ss_pred             EEEEEeCCCCCHHHHH
Confidence            8999999999999996

>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens}

Probab=91.06  E-value=0.027  Score=38.28  Aligned_cols=17  Identities=29%  Similarity=0.348  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      =++|.|.-|+|||||+|
T Consensus        23 ki~vvG~~~vGKTsLi~   39 (187)
T 3c5c_A           23 NLAILGRRGAGKSALTV   39 (187)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            46788999999999974

>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens}

Probab=91.06  E-value=0.03  Score=38.18  Aligned_cols=21  Identities=14%  Similarity=0.154  Sum_probs=16.1

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ++..-++|.|.-|+|||||+|
T Consensus        26 ~~~~ki~v~G~~~~GKSsli~   46 (199)
T 2p5s_A           26 QKAYKIVLAGDAAVGKSSFLM   46 (199)
T ss_dssp             --CEEEEEESSTTSSHHHHHH
T ss_pred             CCCeEEEEECcCCCCHHHHHH
Confidence            344567889999999999975

>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens}

Probab=91.00  E-value=0.03  Score=37.79  Aligned_cols=21  Identities=19%  Similarity=0.121  Sum_probs=15.7

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..-++|.|.-|+|||||+|
T Consensus        18 ~~~~ki~~~G~~~~GKssl~~   38 (201)
T 2q3h_A           18 GRGVKCVLVGDGAVGKTSLVV   38 (201)
T ss_dssp             --CEEEEEECSTTSSHHHHHH
T ss_pred             CcceEEEEECCCCCCHHHHHH
Confidence            344557788999999999974

>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=90.99  E-value=0.026  Score=38.81  Aligned_cols=17  Identities=18%  Similarity=0.106  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -++|.|.-|+|||||+|
T Consensus        27 ki~vvG~~~~GKSsli~   43 (207)
T 2fv8_A           27 KLVVVGDGACGKTCLLI   43 (207)
T ss_dssp             EEEEEECTTSSHHHHHH
T ss_pred             EEEEECcCCCCHHHHHH
Confidence            46889999999999974

>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=90.99  E-value=0.025  Score=39.65  Aligned_cols=21  Identities=19%  Similarity=0.224  Sum_probs=17.2

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..-++|.|..|+|||||+|
T Consensus        24 ~~~~ki~lvG~~~vGKSsLi~   44 (201)
T 2ew1_A           24 DFLFKIVLIGNAGVGKTCLVR   44 (201)
T ss_dssp             SEEEEEEEEESTTSSHHHHHH
T ss_pred             ccceEEEEECcCCCCHHHHHH
Confidence            345567899999999999974

>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A*

Probab=90.97  E-value=0.053  Score=48.52  Aligned_cols=17  Identities=47%  Similarity=0.548  Sum_probs=15.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|+|..|||||||++
T Consensus       525 iv~I~G~nGSGKSTLl~  541 (842)
T 2vf7_A          525 MTSVTGVSGSGKSTLVS  541 (842)
T ss_dssp             EEEEECCTTSSHHHHCC
T ss_pred             EEEEEcCCCcCHHHHHH
Confidence            78899999999999985

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*

Probab=90.87  E-value=0.04  Score=44.72  Aligned_cols=16  Identities=25%  Similarity=0.235  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.|.|..|+|||||+
T Consensus       180 i~~I~G~sGsGKTTLl  195 (400)
T 3lda_A          180 ITELFGEFRTGKSQLC  195 (400)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEEcCCCCChHHHH
Confidence            8999999999999985

>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus}

Probab=90.87  E-value=0.051  Score=45.67  Aligned_cols=24  Identities=21%  Similarity=0.350  Sum_probs=20.8

Q ss_pred             CCCCCCCceEEEecccCCCccCCC
Q 033696           89 IPPDNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        89 ~~~~~riPvTIiTGfLGsGKtTLL  112 (113)
                      +..+....|++|.|+-|+||||++
T Consensus       155 ~~~~~~~~v~~I~G~aGsGKTt~I  178 (446)
T 3vkw_A          155 EPHVSSAKVVLVDGVPGCGKTKEI  178 (446)
T ss_dssp             BCCCCCSEEEEEEECTTSCHHHHH
T ss_pred             ccccccccEEEEEcCCCCCHHHHH
Confidence            355678899999999999999975

>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A*

Probab=90.82  E-value=0.028  Score=38.50  Aligned_cols=19  Identities=21%  Similarity=0.177  Sum_probs=15.8

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      ..-++|.|.-|+|||||+|
T Consensus        29 ~~ki~v~G~~~vGKSsLi~   47 (192)
T 2b6h_A           29 QMRILMVGLDAAGKTTILY   47 (192)
T ss_dssp             CEEEEEEESTTSSHHHHHH
T ss_pred             ccEEEEECCCCCCHHHHHH
Confidence            3457889999999999974

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}

Probab=90.71  E-value=0.039  Score=40.46  Aligned_cols=20  Identities=20%  Similarity=0.493  Sum_probs=16.7

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ..-+.++|+|..|+|||||+
T Consensus        42 ~~~~~vll~G~~G~GKT~l~   61 (387)
T 2v1u_A           42 EKPSNALLYGLTGTGKTAVA   61 (387)
T ss_dssp             CCCCCEEECBCTTSSHHHHH
T ss_pred             CCCCcEEEECCCCCCHHHHH
Confidence            34567899999999999985

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=90.70  E-value=0.042  Score=40.30  Aligned_cols=19  Identities=26%  Similarity=0.504  Sum_probs=16.2

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      ++|..+++|..|+|||||+
T Consensus        57 ~~~~~ll~G~~G~GKT~la   75 (353)
T 1sxj_D           57 NLPHMLFYGPPGTGKTSTI   75 (353)
T ss_dssp             TCCCEEEECSTTSSHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHH
Confidence            4566899999999999984

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}

Probab=90.66  E-value=0.045  Score=39.25  Aligned_cols=17  Identities=41%  Similarity=0.565  Sum_probs=14.7

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -.+++.|..||||||++
T Consensus        77 ~~~~i~g~TGsGKTt~~   93 (235)
T 3llm_A           77 SVVIIRGATGCGKTTQV   93 (235)
T ss_dssp             SEEEEECCTTSSHHHHH
T ss_pred             CEEEEEeCCCCCcHHhH
Confidence            37899999999999863

>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12

Probab=90.55  E-value=0.0055  Score=46.24  Aligned_cols=18  Identities=39%  Similarity=0.431  Sum_probs=15.4

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        28 ~~~~i~GpnGsGKSTll~   45 (227)
T 1qhl_A           28 LVTTLSGGNGAGKSTTMA   45 (227)
T ss_dssp             HHHHHHSCCSHHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            367899999999999963

>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana}

Probab=90.54  E-value=0.16  Score=41.46  Aligned_cols=23  Identities=13%  Similarity=0.043  Sum_probs=18.4

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +....+-.+|.|.-|+|||||+|
T Consensus        30 ~~~~~~kI~IvG~~~vGKSTLin   52 (423)
T 3qq5_A           30 DAGFRRYIVVAGRRNVGKSSFMN   52 (423)
T ss_dssp             --CCCEEEEEECSCSTTTTTTTT
T ss_pred             CCCCCEEEEEECCCCCCHHHHHH
Confidence            34556778899999999999986

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*

Probab=90.40  E-value=0.044  Score=40.75  Aligned_cols=19  Identities=26%  Similarity=0.286  Sum_probs=16.0

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      .-+..+|+|..|+|||||+
T Consensus        36 ~~~~lll~G~~GtGKT~la   54 (324)
T 1l8q_A           36 LYNPIFIYGSVGTGKTHLL   54 (324)
T ss_dssp             SCSSEEEECSSSSSHHHHH
T ss_pred             CCCeEEEECCCCCcHHHHH
Confidence            3456789999999999985

>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ...

Probab=90.33  E-value=0.033  Score=38.16  Aligned_cols=17  Identities=24%  Similarity=0.124  Sum_probs=14.4

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      =++|.|.-|+|||||+|
T Consensus        27 ki~vvG~~~~GKSsli~   43 (201)
T 2gco_A           27 KLVIVGDGACGKTCLLI   43 (201)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            35788999999999974

>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens}

Probab=90.15  E-value=0.035  Score=38.65  Aligned_cols=17  Identities=24%  Similarity=0.286  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -++|.|.-|+|||||+|
T Consensus        36 ki~vvG~~~vGKSsli~   52 (214)
T 2j1l_A           36 KVVLVGDGGCGKTSLLM   52 (214)
T ss_dssp             EEEEEECTTSSHHHHHH
T ss_pred             EEEEECcCCCCHHHHHH
Confidence            46788999999999974

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A

Probab=90.11  E-value=0.043  Score=44.31  Aligned_cols=16  Identities=31%  Similarity=0.327  Sum_probs=14.9

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.|.|..|+|||||+
T Consensus       171 ~i~l~G~~GsGKSTl~  186 (377)
T 1svm_A          171 YWLFKGPIDSGKTTLA  186 (377)
T ss_dssp             EEEEECSTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            8899999999999985

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A

Probab=90.05  E-value=0.045  Score=50.06  Aligned_cols=17  Identities=35%  Similarity=0.194  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       463 ~v~LiGpNGsGKSTLLk  479 (986)
T 2iw3_A          463 RYGICGPNGCGKSTLMR  479 (986)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A*

Probab=89.83  E-value=0.038  Score=38.17  Aligned_cols=17  Identities=18%  Similarity=0.065  Sum_probs=14.6

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      --++|.|..|+|||||+
T Consensus        31 ~ki~vvG~~~~GKSsLi   47 (204)
T 4gzl_A           31 IKCVVVGDGAVGKTCLL   47 (204)
T ss_dssp             EEEEEEESTTSSHHHHH
T ss_pred             EEEEEECcCCCCHHHHH
Confidence            34678999999999997

>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8

Probab=89.79  E-value=0.039  Score=38.66  Aligned_cols=18  Identities=17%  Similarity=0.091  Sum_probs=15.0

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -=++|.|.-|+|||||+|
T Consensus        29 ~ki~vvG~~~vGKSsLi~   46 (205)
T 1gwn_A           29 CKIVVVGDSQCGKTALLH   46 (205)
T ss_dssp             EEEEEEESTTSSHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            346788999999999974

>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens}

Probab=89.79  E-value=0.035  Score=38.30  Aligned_cols=21  Identities=14%  Similarity=0.126  Sum_probs=16.8

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..-++|.|.-|+|||||+|
T Consensus        27 ~~~~ki~vvG~~~vGKSsli~   47 (201)
T 2hup_A           27 DFLFKLVLVGDASVGKTCVVQ   47 (201)
T ss_dssp             CEEEEEEEEECTTSSHHHHHH
T ss_pred             ccceEEEEECcCCCCHHHHHH
Confidence            344567888999999999974

>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A

Probab=89.63  E-value=0.057  Score=41.55  Aligned_cols=22  Identities=23%  Similarity=0.326  Sum_probs=19.4

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +...|-++|.|.-|+|||||||
T Consensus        28 ~~~~~~I~vvG~~~~GKSSLln   49 (353)
T 2x2e_A           28 DLDLPQIAVVGGQSAGKSSVLE   49 (353)
T ss_dssp             GCCCCEEEEECBTTSSHHHHHH
T ss_pred             CCCCCeEEEECCCCCCHHHHHH
Confidence            4567999999999999999976

>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8

Probab=89.58  E-value=0.048  Score=43.08  Aligned_cols=20  Identities=25%  Similarity=0.295  Sum_probs=17.9

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      -+|-+.|.|+.++|||||||
T Consensus       157 ~la~V~lvG~~nvGKSTLln  176 (342)
T 1lnz_A          157 VLADVGLVGFPSVGKSTLLS  176 (342)
T ss_dssp             CCCCEEEESSTTSSHHHHHH
T ss_pred             hcCeeeeeCCCCCCHHHHHH
Confidence            37889999999999999975

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A

Probab=89.43  E-value=0.048  Score=42.13  Aligned_cols=20  Identities=20%  Similarity=0.109  Sum_probs=17.5

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      .-+-++|.|..|||||||++
T Consensus        34 ~~~~~~i~G~~G~GKs~~~~   53 (392)
T 4ag6_A           34 TNSNWTILAKPGAGKSFTAK   53 (392)
T ss_dssp             CCCCEEEECCTTSSHHHHHH
T ss_pred             ccCceEEEcCCCCCHHHHHH
Confidence            56789999999999999863

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*

Probab=89.37  E-value=0.05  Score=43.09  Aligned_cols=17  Identities=29%  Similarity=0.044  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..|+||||||+
T Consensus        73 ~~gIiG~nGaGKTTLl~   89 (347)
T 2obl_A           73 RIGIFAGSGVGKSTLLG   89 (347)
T ss_dssp             EEEEEECTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            56789999999999963

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*

Probab=89.34  E-value=0.055  Score=45.47  Aligned_cols=17  Identities=35%  Similarity=0.532  Sum_probs=15.8

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++.||+|..|+||||++
T Consensus       205 ~~~~I~G~pGTGKTt~i  221 (574)
T 3e1s_A          205 RLVVLTGGPGTGKSTTT  221 (574)
T ss_dssp             SEEEEECCTTSCHHHHH
T ss_pred             CEEEEEcCCCCCHHHHH
Confidence            79999999999999975

>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A*

Probab=89.32  E-value=0.08  Score=43.97  Aligned_cols=16  Identities=19%  Similarity=0.328  Sum_probs=14.4

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      -++|+.|+.||||||+
T Consensus        36 ~lIvlvGlpGSGKSTi   51 (520)
T 2axn_A           36 TVIVMVGLPARGKTYI   51 (520)
T ss_dssp             EEEEEECCTTSSHHHH
T ss_pred             eEEEEECCCCCCHHHH
Confidence            3788999999999996

>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A*

Probab=89.28  E-value=0.099  Score=42.88  Aligned_cols=20  Identities=40%  Similarity=0.421  Sum_probs=17.4

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ..+|.++|.|+.|+||||+.
T Consensus        22 g~~~~i~l~G~~G~GKTTl~   41 (359)
T 2ga8_A           22 NYRVCVILVGSPGSGKSTIA   41 (359)
T ss_dssp             CSCEEEEEECCTTSSHHHHH
T ss_pred             CCeeEEEEECCCCCcHHHHH
Confidence            45788999999999999973

>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A

Probab=89.02  E-value=0.064  Score=49.20  Aligned_cols=17  Identities=41%  Similarity=0.460  Sum_probs=15.5

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|+|..|||||||++
T Consensus       652 iv~I~G~nGSGKSTLl~  668 (972)
T 2r6f_A          652 FVAVTGVSGSGKSTLVN  668 (972)
T ss_dssp             EEECCBCTTSSHHHHHT
T ss_pred             EEEEEcCCCCCHHHHHH
Confidence            68899999999999975

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}

Probab=89.00  E-value=0.055  Score=44.20  Aligned_cols=17  Identities=18%  Similarity=-0.029  Sum_probs=14.9

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..|+||||||+
T Consensus       159 ~~~IvG~sGsGKSTLl~  175 (438)
T 2dpy_A          159 RMGLFAGSGVGKSVLLG  175 (438)
T ss_dssp             EEEEEECTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57789999999999974

>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A

Probab=88.91  E-value=0.09  Score=42.22  Aligned_cols=16  Identities=25%  Similarity=0.345  Sum_probs=14.3

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++|+.|+.||||||+.
T Consensus        41 ~IvlvGlpGsGKSTia   56 (469)
T 1bif_A           41 LIVMVGLPARGKTYIS   56 (469)
T ss_dssp             EEEEECCTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            6889999999999973

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A

Probab=88.86  E-value=0.076  Score=41.50  Aligned_cols=19  Identities=32%  Similarity=0.559  Sum_probs=15.9

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +--++.|+|..|+||||++
T Consensus       104 ~~~vI~ivG~~G~GKTT~~  122 (320)
T 1zu4_A          104 RLNIFMLVGVNGTGKTTSL  122 (320)
T ss_dssp             SCEEEEEESSTTSSHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHH
Confidence            3458889999999999974

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A

Probab=88.78  E-value=0.041  Score=50.33  Aligned_cols=17  Identities=29%  Similarity=0.290  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus       701 ivaIiGpNGSGKSTLLk  717 (986)
T 2iw3_A          701 RIAVIGPNGAGKSTLIN  717 (986)
T ss_dssp             EEEECSCCCHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            67899999999999974

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1

Probab=88.78  E-value=0.076  Score=42.17  Aligned_cols=21  Identities=24%  Similarity=0.094  Sum_probs=17.7

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...+-++|.|..|+|||||||
T Consensus       178 ~~~~kvaivG~~gvGKSTLln  198 (439)
T 1mky_A          178 TDAIKVAIVGRPNVGKSTLFN  198 (439)
T ss_dssp             CSCEEEEEECSTTSSHHHHHH
T ss_pred             ccCceEEEECCCCCCHHHHHH
Confidence            345678899999999999976

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}

Probab=88.73  E-value=0.074  Score=42.77  Aligned_cols=16  Identities=38%  Similarity=0.243  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.|.|..|+|||||+
T Consensus        63 i~~I~GppGsGKSTLa   78 (356)
T 3hr8_A           63 IVEIFGQESSGKTTLA   78 (356)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            9999999999999984

>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=88.66  E-value=0.054  Score=44.31  Aligned_cols=15  Identities=33%  Similarity=0.388  Sum_probs=13.7

Q ss_pred             EEecccCCCccCCCC
Q 033696           99 IITGFLGSGKNTGSA  113 (113)
Q Consensus        99 IiTGfLGsGKtTLLn  113 (113)
                      +|.|..|+|||||||
T Consensus        35 ~lvG~sGaGKSTLln   49 (418)
T 2qag_C           35 MVVGESGLGKSTLIN   49 (418)
T ss_dssp             EEECCTTSSHHHHHH
T ss_pred             EEECCCCCcHHHHHH
Confidence            788999999999975

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...

Probab=88.56  E-value=0.077  Score=41.82  Aligned_cols=17  Identities=35%  Similarity=0.222  Sum_probs=15.2

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      =+++|.|..|+|||||+
T Consensus        62 ~iv~I~G~pGsGKTtLa   78 (349)
T 2zr9_A           62 RVIEIYGPESSGKTTVA   78 (349)
T ss_dssp             SEEEEEESTTSSHHHHH
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            38999999999999983

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}

Probab=88.50  E-value=0.085  Score=39.14  Aligned_cols=18  Identities=28%  Similarity=0.383  Sum_probs=15.9

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -+..+|+|.-|.|||+|+
T Consensus        45 ~~~vll~G~~G~GKT~la   62 (384)
T 2qby_B           45 KFSNLFLGLTGTGKTFVS   62 (384)
T ss_dssp             CCEEEEEECTTSSHHHHH
T ss_pred             CCcEEEECCCCCCHHHHH
Confidence            458999999999999985

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}

Probab=88.42  E-value=0.087  Score=41.96  Aligned_cols=17  Identities=29%  Similarity=0.354  Sum_probs=15.3

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      +..+|+|.-|+||||++
T Consensus        46 ~~~li~G~aGTGKT~ll   62 (459)
T 3upu_A           46 HHVTINGPAGTGATTLT   62 (459)
T ss_dssp             CEEEEECCTTSCHHHHH
T ss_pred             CEEEEEeCCCCCHHHHH
Confidence            38999999999999985

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A

Probab=88.29  E-value=0.085  Score=40.88  Aligned_cols=16  Identities=31%  Similarity=0.196  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|..|+|||||+
T Consensus       124 i~~I~G~~GsGKTtla  139 (343)
T 1v5w_A          124 ITEAFGEFRTGKTQLS  139 (343)
T ss_dssp             EEEEECCTTCTHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            8999999999999984

>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A*

Probab=88.28  E-value=0.067  Score=37.44  Aligned_cols=19  Identities=16%  Similarity=0.121  Sum_probs=15.6

Q ss_pred             CceEEEecccCCCccCCCC
Q 033696           95 IPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLLn  113 (113)
                      .-=++|.|..|+|||||+|
T Consensus        27 ~~ki~vvG~~~vGKSsL~~   45 (214)
T 3q3j_B           27 RCKLVLVGDVQCGKTAMLQ   45 (214)
T ss_dssp             CEEEEEECSTTSSHHHHHH
T ss_pred             eEEEEEECcCCCCHHHHHH
Confidence            3446789999999999974

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*

Probab=88.27  E-value=0.057  Score=40.34  Aligned_cols=18  Identities=33%  Similarity=0.292  Sum_probs=15.6

Q ss_pred             CceEEE--ecccCCCccCCC
Q 033696           95 IPATII--TGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIi--TGfLGsGKtTLL  112 (113)
                      -...+|  +|.-|.|||||+
T Consensus        50 ~~~~li~i~G~~G~GKT~L~   69 (412)
T 1w5s_A           50 DVNMIYGSIGRVGIGKTTLA   69 (412)
T ss_dssp             CEEEEEECTTCCSSSHHHHH
T ss_pred             CCEEEEeCcCcCCCCHHHHH
Confidence            357888  999999999985

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*

Probab=88.04  E-value=0.16  Score=36.78  Aligned_cols=20  Identities=25%  Similarity=0.288  Sum_probs=16.0

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      +.....+++|..|+|||+|.
T Consensus        45 ~~~~~~ll~G~~GtGKt~la   64 (311)
T 4fcw_A           45 RPIGSFLFLGPTGVGKTELA   64 (311)
T ss_dssp             SCSEEEEEESCSSSSHHHHH
T ss_pred             CCceEEEEECCCCcCHHHHH
Confidence            33446899999999999973

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A

Probab=87.84  E-value=0.15  Score=36.61  Aligned_cols=20  Identities=30%  Similarity=0.591  Sum_probs=17.0

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+.|..+++|.-|+|||++.
T Consensus        36 ~~~~~~ll~G~~G~GKt~la   55 (319)
T 2chq_A           36 KNIPHLLFSGPPGTGKTATA   55 (319)
T ss_dssp             TCCCCEEEESSSSSSHHHHH
T ss_pred             CCCCeEEEECcCCcCHHHHH
Confidence            46677999999999999873

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A

Probab=87.82  E-value=0.12  Score=42.73  Aligned_cols=19  Identities=32%  Similarity=0.387  Sum_probs=16.1

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +-.|++++|..|+||||++
T Consensus        96 ~~~vI~lvG~~GsGKTTt~  114 (433)
T 3kl4_A           96 LPFIIMLVGVQGSGKTTTA  114 (433)
T ss_dssp             SSEEEEECCCTTSCHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHH
Confidence            3468899999999999974

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20

Probab=87.78  E-value=0.15  Score=36.72  Aligned_cols=19  Identities=32%  Similarity=0.574  Sum_probs=16.6

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      ++|-.+++|.-|.||||+.
T Consensus        45 ~~~~~ll~G~~G~GKT~la   63 (327)
T 1iqp_A           45 SMPHLLFAGPPGVGKTTAA   63 (327)
T ss_dssp             CCCEEEEESCTTSSHHHHH
T ss_pred             CCCeEEEECcCCCCHHHHH
Confidence            5677999999999999974

>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A*

Probab=87.65  E-value=0.11  Score=43.86  Aligned_cols=19  Identities=5%  Similarity=-0.025  Sum_probs=16.1

Q ss_pred             CCCceEEEecccCCCccCC
Q 033696           93 NRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTL  111 (113)
                      +.--+++++|+.||||||+
T Consensus       393 ~~~~~I~l~GlsGsGKSTI  411 (511)
T 1g8f_A          393 KQGFSIVLGNSLTVSREQL  411 (511)
T ss_dssp             GCCEEEEECTTCCSCHHHH
T ss_pred             ccceEEEecccCCCCHHHH
Confidence            3446889999999999997

>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A*

Probab=87.57  E-value=0.069  Score=39.11  Aligned_cols=20  Identities=20%  Similarity=0.262  Sum_probs=16.5

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +-.-++|.|.-|+|||||+|
T Consensus        35 ~~~~I~lvG~~g~GKSSLin   54 (262)
T 3def_A           35 NSMTVLVLGKGGVGKSSTVN   54 (262)
T ss_dssp             CEEEEEEEECTTSSHHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHHH
Confidence            34567889999999999975

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A

Probab=87.53  E-value=0.1  Score=41.71  Aligned_cols=16  Identities=19%  Similarity=0.150  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|.|..|+|||||+
T Consensus       205 liiI~G~pG~GKTtl~  220 (454)
T 2r6a_A          205 LIIVAARPSVGKTAFA  220 (454)
T ss_dssp             EEEEECCTTSCHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            8999999999999984

>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A*

Probab=87.51  E-value=0.082  Score=38.75  Aligned_cols=20  Identities=20%  Similarity=0.265  Sum_probs=16.7

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +-.-+++.|.-|+|||||+|
T Consensus        38 ~~~~I~vvG~~g~GKSSLin   57 (270)
T 1h65_A           38 NSLTILVMGKGGVGKSSTVN   57 (270)
T ss_dssp             CEEEEEEEESTTSSHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHH
Confidence            34567889999999999975

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*

Probab=87.34  E-value=0.19  Score=36.44  Aligned_cols=20  Identities=30%  Similarity=0.283  Sum_probs=16.2

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ....-.+++|..|+|||+|.
T Consensus        65 ~~~~~vll~G~~GtGKT~la   84 (309)
T 3syl_A           65 TPTLHMSFTGNPGTGKTTVA   84 (309)
T ss_dssp             CCCCEEEEEECTTSSHHHHH
T ss_pred             CCCceEEEECCCCCCHHHHH
Confidence            34456899999999999874

>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=87.33  E-value=0.073  Score=41.75  Aligned_cols=16  Identities=31%  Similarity=0.337  Sum_probs=14.0

Q ss_pred             EEEecccCCCccCCCC
Q 033696           98 TIITGFLGSGKNTGSA  113 (113)
Q Consensus        98 TIiTGfLGsGKtTLLn  113 (113)
                      ++|.|..|+|||||+|
T Consensus        40 I~vvG~~g~GKSTLln   55 (361)
T 2qag_A           40 LMVVGESGLGKSTLIN   55 (361)
T ss_dssp             EEECCCTTSCHHHHHH
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            3788999999999975

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=87.25  E-value=0.16  Score=36.54  Aligned_cols=20  Identities=40%  Similarity=0.697  Sum_probs=17.0

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .++|..+++|.-|.|||++.
T Consensus        40 ~~~~~~ll~G~~G~GKt~la   59 (323)
T 1sxj_B           40 GNMPHMIISGMPGIGKTTSV   59 (323)
T ss_dssp             CCCCCEEEECSTTSSHHHHH
T ss_pred             CCCCeEEEECcCCCCHHHHH
Confidence            45677999999999999974

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*

Probab=87.23  E-value=0.13  Score=38.69  Aligned_cols=17  Identities=35%  Similarity=0.468  Sum_probs=15.2

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -+++|+|..|+|||+|.
T Consensus        99 ~i~~i~G~~gsGKT~la  115 (322)
T 2i1q_A           99 SVTEFAGVFGSGKTQIM  115 (322)
T ss_dssp             EEEEEEESTTSSHHHHH
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            38999999999999973

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*

Probab=87.21  E-value=0.11  Score=43.49  Aligned_cols=18  Identities=33%  Similarity=0.444  Sum_probs=16.1

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      =++.||+|..|+||||++
T Consensus       164 ~~~~vi~G~pGTGKTt~l  181 (608)
T 1w36_D          164 RRISVISGGPGTGKTTTV  181 (608)
T ss_dssp             BSEEEEECCTTSTHHHHH
T ss_pred             CCCEEEEeCCCCCHHHHH
Confidence            479999999999999874

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}

Probab=87.19  E-value=0.13  Score=39.20  Aligned_cols=17  Identities=18%  Similarity=0.100  Sum_probs=15.3

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      =++||+|..|+|||||+
T Consensus        69 ~l~li~G~pG~GKTtl~   85 (315)
T 3bh0_A           69 NFVLIAARPSMGKTAFA   85 (315)
T ss_dssp             CEEEEECCTTSSHHHHH
T ss_pred             cEEEEEeCCCCCHHHHH
Confidence            38999999999999983

>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A*

Probab=87.07  E-value=0.18  Score=42.69  Aligned_cols=18  Identities=28%  Similarity=0.458  Sum_probs=15.1

Q ss_pred             CCceEEEecccCCCccCC
Q 033696           94 RIPATIITGFLGSGKNTG  111 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTL  111 (113)
                      +--+++|+|+-||||||+
T Consensus       395 ~~~~I~l~GlsGSGKSTi  412 (573)
T 1m8p_A          395 QGFTIFLTGYMNSGKDAI  412 (573)
T ss_dssp             CCEEEEEECSTTSSHHHH
T ss_pred             cceEEEeecCCCCCHHHH
Confidence            334688999999999997

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A

Probab=86.93  E-value=0.14  Score=42.99  Aligned_cols=21  Identities=29%  Similarity=0.509  Sum_probs=16.2

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+..+++|+|..|+|||||+|
T Consensus        99 ~~~~vI~ivG~~GvGKTTl~~  119 (504)
T 2j37_W           99 GKQNVIMFVGLQGSGKTTTCS  119 (504)
T ss_dssp             S--EEEEEECSTTSSHHHHHH
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            456688899999999999853

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}

Probab=86.71  E-value=0.14  Score=37.24  Aligned_cols=17  Identities=24%  Similarity=0.309  Sum_probs=14.8

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ...+|+|..|+|||||+
T Consensus        55 ~~vll~Gp~GtGKT~la   71 (297)
T 3b9p_A           55 KGLLLFGPPGNGKTLLA   71 (297)
T ss_dssp             SEEEEESSSSSCHHHHH
T ss_pred             CeEEEECcCCCCHHHHH
Confidence            46789999999999974

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}

Probab=86.69  E-value=0.17  Score=40.37  Aligned_cols=20  Identities=25%  Similarity=0.288  Sum_probs=17.4

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ...+++.|+|.-|.|||||.
T Consensus       145 ~~~~~v~I~G~~GiGKTtLa  164 (591)
T 1z6t_A          145 GEPGWVTIHGMAGCGKSVLA  164 (591)
T ss_dssp             TSCEEEEEECCTTSSHHHHH
T ss_pred             CCCceEEEEcCCCCCHHHHH
Confidence            35679999999999999984

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A

Probab=86.68  E-value=0.13  Score=42.91  Aligned_cols=17  Identities=41%  Similarity=0.487  Sum_probs=15.4

Q ss_pred             CceEEEecccCCCccCC
Q 033696           95 IPATIITGFLGSGKNTG  111 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTL  111 (113)
                      -|++||-|+.|+|||+.
T Consensus       205 ~~~~lI~GPPGTGKT~t  221 (646)
T 4b3f_X          205 KELAIIHGPPGTGKTTT  221 (646)
T ss_dssp             SSEEEEECCTTSCHHHH
T ss_pred             CCceEEECCCCCCHHHH
Confidence            47999999999999975

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*

Probab=86.58  E-value=0.14  Score=38.96  Aligned_cols=16  Identities=38%  Similarity=0.364  Sum_probs=14.9

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|..|+|||||+
T Consensus       109 i~~i~G~~GsGKT~la  124 (324)
T 2z43_A          109 MTEFFGEFGSGKTQLC  124 (324)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEECCCCCCHhHHH
Confidence            8999999999999983

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}

Probab=86.51  E-value=0.16  Score=35.69  Aligned_cols=17  Identities=24%  Similarity=0.348  Sum_probs=14.4

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      +-.+++|..|+|||+|.
T Consensus        40 ~~vll~G~~GtGKT~la   56 (262)
T 2qz4_A           40 KGALLLGPPGCGKTLLA   56 (262)
T ss_dssp             CEEEEESCTTSSHHHHH
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            34689999999999974

>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima}

Probab=86.46  E-value=0.13  Score=46.47  Aligned_cols=16  Identities=38%  Similarity=0.468  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.|+|..|||||||+
T Consensus       612 iv~I~G~SGSGKSTLl  627 (916)
T 3pih_A          612 FVCVTGVSGSGKSSLV  627 (916)
T ss_dssp             EEEEECSTTSSHHHHH
T ss_pred             EEEEEccCCCChhhhH
Confidence            6889999999999995

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}

Probab=86.24  E-value=0.15  Score=36.67  Aligned_cols=17  Identities=24%  Similarity=0.341  Sum_probs=14.5

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .-.+|+|..|+|||+|+
T Consensus        52 ~~~ll~G~~GtGKT~la   68 (285)
T 3h4m_A           52 KGILLYGPPGTGKTLLA   68 (285)
T ss_dssp             SEEEEESSSSSSHHHHH
T ss_pred             CeEEEECCCCCcHHHHH
Confidence            34789999999999984

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}

Probab=86.22  E-value=0.2  Score=37.09  Aligned_cols=19  Identities=26%  Similarity=0.342  Sum_probs=15.7

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      ..+..+|+|..|+|||+|+
T Consensus        54 ~~~~vll~G~~GtGKT~la   72 (338)
T 3pfi_A           54 CLDHILFSGPAGLGKTTLA   72 (338)
T ss_dssp             CCCCEEEECSTTSSHHHHH
T ss_pred             CCCeEEEECcCCCCHHHHH
Confidence            3455799999999999974

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}

Probab=85.95  E-value=0.17  Score=42.16  Aligned_cols=19  Identities=32%  Similarity=0.508  Sum_probs=16.4

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +-.|++++|..|+||||++
T Consensus        99 ~p~vIlivG~~G~GKTTt~  117 (443)
T 3dm5_A           99 KPTILLMVGIQGSGKTTTV  117 (443)
T ss_dssp             SSEEEEEECCTTSSHHHHH
T ss_pred             CCeEEEEECcCCCCHHHHH
Confidence            4568999999999999974

>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis}

Probab=85.89  E-value=0.14  Score=38.47  Aligned_cols=19  Identities=32%  Similarity=0.310  Sum_probs=12.6

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +=-.+++.|.-||||||+.
T Consensus        24 ~g~~I~~eG~~GsGKsT~~   42 (227)
T 3v9p_A           24 RGKFITFEGIDGAGKTTHL   42 (227)
T ss_dssp             CCCEEEEECCC---CHHHH
T ss_pred             CCeEEEEECCCCCCHHHHH
Confidence            3347888999999999974

>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A*

Probab=85.80  E-value=0.2  Score=38.59  Aligned_cols=15  Identities=40%  Similarity=0.554  Sum_probs=13.8

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      .++|+|..|+|||||
T Consensus        36 ~ilI~GpsGsGKStL   50 (205)
T 2qmh_A           36 GVLITGDSGVGKSET   50 (205)
T ss_dssp             EEEEECCCTTTTHHH
T ss_pred             EEEEECCCCCCHHHH
Confidence            578999999999997

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A

Probab=85.73  E-value=0.14  Score=42.39  Aligned_cols=19  Identities=26%  Similarity=0.363  Sum_probs=17.0

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +-+++++.|..|+|||||+
T Consensus       107 ~g~~vll~Gp~GtGKTtla  125 (543)
T 3m6a_A          107 KGPILCLAGPPGVGKTSLA  125 (543)
T ss_dssp             CSCEEEEESSSSSSHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHH
Confidence            5678999999999999984

>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2

Probab=85.68  E-value=0.11  Score=42.20  Aligned_cols=20  Identities=30%  Similarity=0.114  Sum_probs=16.9

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +-....|.|..|+|||||+|
T Consensus        19 ~g~~vgiVG~pnaGKSTL~n   38 (392)
T 1ni3_A           19 NNLKTGIVGMPNVGKSTFFR   38 (392)
T ss_dssp             SCCEEEEEECSSSSHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHH
Confidence            34678889999999999976

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*

Probab=85.64  E-value=0.15  Score=39.05  Aligned_cols=16  Identities=38%  Similarity=0.578  Sum_probs=14.0

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++.++|..|+||||++
T Consensus       100 ~i~i~g~~G~GKTT~~  115 (295)
T 1ls1_A          100 LWFLVGLQGSGKTTTA  115 (295)
T ss_dssp             EEEEECCTTTTHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            7778899999999974

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}

Probab=85.47  E-value=0.23  Score=40.43  Aligned_cols=20  Identities=30%  Similarity=0.411  Sum_probs=17.2

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .++|..|++|..|+|||||.
T Consensus        48 ~~~~~vLL~GppGtGKTtlA   67 (447)
T 3pvs_A           48 GHLHSMILWGPPGTGKTTLA   67 (447)
T ss_dssp             TCCCEEEEECSTTSSHHHHH
T ss_pred             CCCcEEEEECCCCCcHHHHH
Confidence            34588999999999999984

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*

Probab=85.40  E-value=0.12  Score=41.52  Aligned_cols=18  Identities=28%  Similarity=0.218  Sum_probs=16.0

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      .+-.+|+|..|+|||||+
T Consensus       130 ~~~lll~Gp~G~GKTtLa  147 (440)
T 2z4s_A          130 YNPLFIYGGVGLGKTHLL  147 (440)
T ss_dssp             SCCEEEECSSSSSHHHHH
T ss_pred             CCeEEEECCCCCCHHHHH
Confidence            567899999999999985

>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A*

Probab=85.33  E-value=0.19  Score=43.75  Aligned_cols=16  Identities=38%  Similarity=0.515  Sum_probs=14.5

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      -+++++|+-||||||+
T Consensus        53 ~lIvLtGlsGSGKSTl   68 (630)
T 1x6v_B           53 CTVWLTGLSGAGKTTV   68 (630)
T ss_dssp             EEEEEECSTTSSHHHH
T ss_pred             CEEEEEeCCCCCHHHH
Confidence            4789999999999997

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F

Probab=85.15  E-value=0.17  Score=39.04  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=14.9

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      --++++.|..|+||||++
T Consensus        98 ~~vi~i~G~~G~GKTT~~  115 (297)
T 1j8m_F           98 PYVIMLVGVQGTGKTTTA  115 (297)
T ss_dssp             SEEEEEECSSCSSTTHHH
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            347778899999999974

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*

Probab=85.06  E-value=0.17  Score=37.31  Aligned_cols=17  Identities=29%  Similarity=0.411  Sum_probs=14.9

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+.+++|.-|+|||||+
T Consensus        39 ~~~ll~G~~G~GKT~la   55 (373)
T 1jr3_A           39 HAYLFSGTRGVGKTSIA   55 (373)
T ss_dssp             SEEEEESCTTSSHHHHH
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            46799999999999984

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*

Probab=85.03  E-value=0.25  Score=36.75  Aligned_cols=16  Identities=38%  Similarity=0.565  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ..+++|..|.|||+|.
T Consensus        72 ~vLl~GppGtGKT~la   87 (368)
T 3uk6_A           72 AVLIAGQPGTGKTAIA   87 (368)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            7899999999999974

>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A*

Probab=84.81  E-value=0.12  Score=37.50  Aligned_cols=20  Identities=15%  Similarity=0.096  Sum_probs=16.1

Q ss_pred             CCceEEEecccCCCccCCCC
Q 033696           94 RIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLLn  113 (113)
                      +..-++|.|.-|+|||||+|
T Consensus       154 ~~~~i~i~G~~~~GKssli~  173 (332)
T 2wkq_A          154 ELIKCVVVGDGAVGKTCLLI  173 (332)
T ss_dssp             TCEEEEEEESTTSSHHHHHH
T ss_pred             ceeEEEEECCCCCChHHHHH
Confidence            34557889999999999973

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}

Probab=84.64  E-value=0.2  Score=37.45  Aligned_cols=16  Identities=25%  Similarity=0.320  Sum_probs=14.1

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      .++++|..|+|||+|.
T Consensus        51 ~vLL~Gp~GtGKT~la   66 (301)
T 3cf0_A           51 GVLFYGPPGCGKTLLA   66 (301)
T ss_dssp             EEEEECSSSSSHHHHH
T ss_pred             eEEEECCCCcCHHHHH
Confidence            5789999999999974

>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A*

Probab=84.58  E-value=0.18  Score=38.52  Aligned_cols=17  Identities=29%  Similarity=0.237  Sum_probs=15.1

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      -+.++||.-||||||.|
T Consensus        29 ~l~vitG~MgsGKTT~l   45 (214)
T 2j9r_A           29 WIEVICGSMFSGKSEEL   45 (214)
T ss_dssp             EEEEEECSTTSCHHHHH
T ss_pred             EEEEEECCCCCcHHHHH
Confidence            48899999999999964

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B

Probab=84.46  E-value=0.21  Score=40.82  Aligned_cols=19  Identities=32%  Similarity=0.573  Sum_probs=16.0

Q ss_pred             CCceEEEecccCCCccCCC
Q 033696           94 RIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTLL  112 (113)
                      +..+++++|..|+||||+.
T Consensus        98 ~~~vI~ivG~~GvGKTTla  116 (432)
T 2v3c_C           98 KQNVILLVGIQGSGKTTTA  116 (432)
T ss_dssp             SCCCEEEECCSSSSTTHHH
T ss_pred             CCeEEEEECCCCCCHHHHH
Confidence            3457889999999999984

>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis}

Probab=84.45  E-value=0.14  Score=38.44  Aligned_cols=18  Identities=39%  Similarity=0.364  Sum_probs=15.0

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      --++++.|.-||||||+.
T Consensus        21 ~~~i~~~G~~g~GKst~~   38 (223)
T 3ld9_A           21 SMFITFEGIDGSGKTTQS   38 (223)
T ss_dssp             CEEEEEECSTTSSHHHHH
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            347788999999999974

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*

Probab=84.35  E-value=0.25  Score=35.75  Aligned_cols=20  Identities=20%  Similarity=0.270  Sum_probs=16.3

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      ...+-.+++|..|+|||+|.
T Consensus        62 ~~~~~vLl~G~~GtGKT~la   81 (272)
T 1d2n_A           62 TPLVSVLLEGPPHSGKTALA   81 (272)
T ss_dssp             CSEEEEEEECSTTSSHHHHH
T ss_pred             CCCeEEEEECCCCCcHHHHH
Confidence            44557889999999999873

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A

Probab=84.33  E-value=0.19  Score=41.95  Aligned_cols=18  Identities=39%  Similarity=0.599  Sum_probs=15.8

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -|+++|.|..|+|||+++
T Consensus       195 ~~~~li~GppGTGKT~~~  212 (624)
T 2gk6_A          195 RPLSLIQGPPGTGKTVTS  212 (624)
T ss_dssp             CSEEEEECCTTSCHHHHH
T ss_pred             CCCeEEECCCCCCHHHHH
Confidence            378999999999999863

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}

Probab=84.14  E-value=0.22  Score=33.30  Aligned_cols=18  Identities=33%  Similarity=0.556  Sum_probs=14.7

Q ss_pred             CCCceEEEecccCCCccCC
Q 033696           93 NRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTL  111 (113)
                      ...|| +|+|..|+|||+|
T Consensus        23 ~~~~v-ll~G~~GtGKt~l   40 (145)
T 3n70_A           23 TDIAV-WLYGAPGTGRMTG   40 (145)
T ss_dssp             CCSCE-EEESSTTSSHHHH
T ss_pred             CCCCE-EEECCCCCCHHHH
Confidence            34565 7899999999987

>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A*

Probab=84.06  E-value=0.14  Score=38.57  Aligned_cols=16  Identities=38%  Similarity=0.615  Sum_probs=14.3

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++++.|.-||||||+.
T Consensus        29 ~i~~eG~~GsGKsT~~   44 (236)
T 3lv8_A           29 FIVIEGLEGAGKSTAI   44 (236)
T ss_dssp             EEEEEESTTSCHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            6788999999999974

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A

Probab=83.97  E-value=0.24  Score=39.40  Aligned_cols=16  Identities=38%  Similarity=0.183  Sum_probs=14.9

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      -+++|+|..|+|||||
T Consensus        64 ~ii~I~G~pGsGKTtL   79 (356)
T 1u94_A           64 RIVEIYGPESSGKTTL   79 (356)
T ss_dssp             SEEEEECSTTSSHHHH
T ss_pred             eEEEEECCCCCCHHHH
Confidence            3899999999999998

>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens}

Probab=83.90  E-value=0.2  Score=38.44  Aligned_cols=17  Identities=24%  Similarity=0.282  Sum_probs=14.9

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -++|.|..|+|||||+|
T Consensus       167 kI~ivG~~~vGKSsLl~  183 (329)
T 3o47_A          167 RILMVGLDAAGKTTILY  183 (329)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             eEEEECCCCccHHHHHH
Confidence            57888999999999974

>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus}

Probab=83.88  E-value=0.19  Score=38.93  Aligned_cols=17  Identities=35%  Similarity=0.167  Sum_probs=14.9

Q ss_pred             CceEEEecccCCCccCC
Q 033696           95 IPATIITGFLGSGKNTG  111 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTL  111 (113)
                      =-|.+|||.-||||||.
T Consensus        28 G~I~vitG~M~sGKTT~   44 (219)
T 3e2i_A           28 GWIECITGSMFSGKSEE   44 (219)
T ss_dssp             CEEEEEEECTTSCHHHH
T ss_pred             ceEEEEECCCCCCHHHH
Confidence            35899999999999993

>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP}

Probab=83.84  E-value=0.14  Score=42.07  Aligned_cols=16  Identities=25%  Similarity=0.191  Sum_probs=14.4

Q ss_pred             EEEecccCCCccCCCC
Q 033696           98 TIITGFLGSGKNTGSA  113 (113)
Q Consensus        98 TIiTGfLGsGKtTLLn  113 (113)
                      ++|.|..|+|||||||
T Consensus       227 V~ivG~~nvGKSSLln  242 (462)
T 3geh_A          227 VAIVGRPNVGKSSLLN  242 (462)
T ss_dssp             EEEEECTTSSHHHHHH
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6788999999999986

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*

Probab=83.50  E-value=0.24  Score=35.49  Aligned_cols=17  Identities=24%  Similarity=0.337  Sum_probs=14.2

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      +-.+++|..|+|||+|.
T Consensus        51 ~~vll~G~~GtGKT~la   67 (310)
T 1ofh_A           51 KNILMIGPTGVGKTEIA   67 (310)
T ss_dssp             CCEEEECCTTSSHHHHH
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            35678999999999874

>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A*

Probab=83.44  E-value=0.15  Score=38.52  Aligned_cols=18  Identities=28%  Similarity=0.361  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      .-+++.|..|+|||||+|
T Consensus       100 ~~v~~vG~~~vGKSslin  117 (262)
T 3cnl_A          100 ARVLIVGVPNTGKSTIIN  117 (262)
T ss_dssp             CEEEEEESTTSSHHHHHH
T ss_pred             hheEEeCCCCCCHHHHHH
Confidence            567888999999999976

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}

Probab=83.08  E-value=0.26  Score=39.30  Aligned_cols=17  Identities=24%  Similarity=0.182  Sum_probs=15.2

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      =++||+|..|+|||||+
T Consensus       201 ~l~ii~G~pg~GKT~la  217 (444)
T 2q6t_A          201 SLNIIAARPAMGKTAFA  217 (444)
T ss_dssp             CEEEEEECTTSCHHHHH
T ss_pred             cEEEEEeCCCCCHHHHH
Confidence            38999999999999983

>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A*

Probab=83.04  E-value=0.17  Score=41.78  Aligned_cols=16  Identities=38%  Similarity=0.399  Sum_probs=14.6

Q ss_pred             EEEecccCCCccCCCC
Q 033696           98 TIITGFLGSGKNTGSA  113 (113)
Q Consensus        98 TIiTGfLGsGKtTLLn  113 (113)
                      ++|.|..|+|||||||
T Consensus       236 V~ivG~~nvGKSSLln  251 (476)
T 3gee_A          236 TVIAGKPNAGKSTLLN  251 (476)
T ss_dssp             EEEECCTTSSHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6789999999999986

>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A*

Probab=82.99  E-value=0.27  Score=44.01  Aligned_cols=16  Identities=38%  Similarity=0.578  Sum_probs=14.7

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +|+|||-.||||+||.
T Consensus        38 l~viTGvSGSGKSSLa   53 (842)
T 2vf7_A           38 LVVFTGVSGSGKSSLA   53 (842)
T ss_dssp             EEEEESSTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            6999999999999984

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A

Probab=82.76  E-value=0.37  Score=36.16  Aligned_cols=19  Identities=32%  Similarity=0.319  Sum_probs=14.9

Q ss_pred             CCCc-eEEEecccCCCccCC
Q 033696           93 NRIP-ATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riP-vTIiTGfLGsGKtTL  111 (113)
                      .+.| ..++.|..|.|||+|
T Consensus        33 ~~~p~~lLl~GppGtGKT~l   52 (293)
T 3t15_A           33 IKVPLILGIWGGKGQGKSFQ   52 (293)
T ss_dssp             CCCCSEEEEEECTTSCHHHH
T ss_pred             CCCCeEEEEECCCCCCHHHH
Confidence            3445 566789999999987

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*

Probab=82.74  E-value=0.25  Score=35.95  Aligned_cols=17  Identities=29%  Similarity=0.301  Sum_probs=14.5

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      +..+|+|.-|.|||+|+
T Consensus        39 ~~vll~G~~GtGKT~la   55 (324)
T 1hqc_A           39 EHLLLFGPPGLGKTTLA   55 (324)
T ss_dssp             CCCEEECCTTCCCHHHH
T ss_pred             CcEEEECCCCCCHHHHH
Confidence            45788999999999974

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20

Probab=82.68  E-value=0.29  Score=37.82  Aligned_cols=18  Identities=22%  Similarity=0.296  Sum_probs=15.8

Q ss_pred             CCc---eEEEecccCCCccCC
Q 033696           94 RIP---ATIITGFLGSGKNTG  111 (113)
Q Consensus        94 riP---vTIiTGfLGsGKtTL  111 (113)
                      ++|   ..++.|..|+||||+
T Consensus        54 ~iPkkn~ili~GPPGtGKTt~   74 (212)
T 1tue_A           54 GTPKKNCLVFCGPANTGKSYF   74 (212)
T ss_dssp             TCTTCSEEEEESCGGGCHHHH
T ss_pred             cCCcccEEEEECCCCCCHHHH
Confidence            366   789999999999986

>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A*

Probab=82.38  E-value=0.21  Score=45.72  Aligned_cols=17  Identities=29%  Similarity=0.425  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..|||||||++
T Consensus       418 ~~~ivG~sGsGKSTl~~  434 (1284)
T 3g5u_A          418 TVALVGNSGCGKSTTVQ  434 (1284)
T ss_dssp             EEEEECCSSSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57799999999999963

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}

Probab=82.35  E-value=0.25  Score=33.03  Aligned_cols=17  Identities=35%  Similarity=0.343  Sum_probs=13.7

Q ss_pred             CCceEEEecccCCCccCC
Q 033696           94 RIPATIITGFLGSGKNTG  111 (113)
Q Consensus        94 riPvTIiTGfLGsGKtTL  111 (113)
                      ..| ++|+|..|+|||+|
T Consensus        27 ~~~-vll~G~~GtGKt~l   43 (143)
T 3co5_A           27 TSP-VFLTGEAGSPFETV   43 (143)
T ss_dssp             SSC-EEEEEETTCCHHHH
T ss_pred             CCc-EEEECCCCccHHHH
Confidence            345 46799999999986

>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum}

Probab=82.18  E-value=0.19  Score=40.81  Aligned_cols=17  Identities=18%  Similarity=-0.001  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      =+++.|+.|+|||||+|
T Consensus        43 kV~lvG~~~vGKSSLl~   59 (535)
T 3dpu_A           43 KVHLIGDGMAGKTSLLK   59 (535)
T ss_dssp             EEEEESSSCSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46788999999999975

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*

Probab=82.11  E-value=0.15  Score=36.42  Aligned_cols=15  Identities=27%  Similarity=0.443  Sum_probs=13.4

Q ss_pred             EEEecccCCCccCCC
Q 033696           98 TIITGFLGSGKNTGS  112 (113)
Q Consensus        98 TIiTGfLGsGKtTLL  112 (113)
                      .+++|..|+|||+|.
T Consensus        47 vll~G~~GtGKT~la   61 (268)
T 2r62_A           47 VLLVGPPGTGKTLLA   61 (268)
T ss_dssp             CCCBCSSCSSHHHHH
T ss_pred             EEEECCCCCcHHHHH
Confidence            679999999999974

>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A*

Probab=81.94  E-value=0.19  Score=42.61  Aligned_cols=21  Identities=29%  Similarity=0.654  Sum_probs=18.5

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+.|-.+|.|-.||||||+||
T Consensus       165 ~~~pHlLIaG~TGSGKSt~L~  185 (512)
T 2ius_A          165 AKMPHLLVAGTTGSGASVGVN  185 (512)
T ss_dssp             GGSCSEEEECCTTSSHHHHHH
T ss_pred             ccCceEEEECCCCCCHHHHHH
Confidence            357999999999999999874

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G

Probab=81.72  E-value=0.35  Score=35.47  Aligned_cols=15  Identities=33%  Similarity=0.543  Sum_probs=13.6

Q ss_pred             EEEecccCCCccCCC
Q 033696           98 TIITGFLGSGKNTGS  112 (113)
Q Consensus        98 TIiTGfLGsGKtTLL  112 (113)
                      .+++|..|+|||+|.
T Consensus        48 vLl~G~~GtGKT~la   62 (350)
T 1g8p_A           48 VLVFGDRGTGKSTAV   62 (350)
T ss_dssp             EEEECCGGGCTTHHH
T ss_pred             EEEECCCCccHHHHH
Confidence            789999999999874

>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus}

Probab=81.45  E-value=0.34  Score=40.64  Aligned_cols=16  Identities=31%  Similarity=0.299  Sum_probs=14.1

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      -+++++|+-||||||+
T Consensus       373 ~~I~l~G~~GsGKSTi  388 (546)
T 2gks_A          373 FCVWLTGLPCAGKSTI  388 (546)
T ss_dssp             EEEEEECSTTSSHHHH
T ss_pred             eEEEccCCCCCCHHHH
Confidence            4678899999999997

>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens}

Probab=81.43  E-value=0.21  Score=40.98  Aligned_cols=17  Identities=29%  Similarity=0.180  Sum_probs=14.9

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      -+.|.|..|+|||||+|
T Consensus        24 kvgIVG~pnvGKSTL~n   40 (396)
T 2ohf_A           24 KIGIVGLPNVGKSTFFN   40 (396)
T ss_dssp             CEEEECCSSSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46788999999999976

>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A*

Probab=81.36  E-value=0.2  Score=43.09  Aligned_cols=22  Identities=18%  Similarity=0.238  Sum_probs=19.6

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      +.+++++.|.|..|+||+||+|
T Consensus        35 ~~~~~~VaivG~pnvGKStLiN   56 (592)
T 1f5n_A           35 TQPMVVVAIVGLYRTGKSYLMN   56 (592)
T ss_dssp             CSBEEEEEEEEBTTSSHHHHHH
T ss_pred             cCCCcEEEEECCCCCCHHHHHH
Confidence            5678888999999999999986

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A

Probab=80.68  E-value=0.32  Score=42.70  Aligned_cols=18  Identities=39%  Similarity=0.599  Sum_probs=15.9

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      -|+++|.|..|+|||+++
T Consensus       371 ~~~~lI~GppGTGKT~ti  388 (800)
T 2wjy_A          371 RPLSLIQGPPGTGKTVTS  388 (800)
T ss_dssp             SSEEEEECCTTSCHHHHH
T ss_pred             CCeEEEEcCCCCCHHHHH
Confidence            379999999999999864

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*

Probab=80.47  E-value=0.44  Score=38.69  Aligned_cols=19  Identities=26%  Similarity=0.146  Sum_probs=17.1

Q ss_pred             CCCceEEEecccCCCccCC
Q 033696           93 NRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTL  111 (113)
                      ..+.|+.|.|.-|.|||||
T Consensus       150 ~~~~vv~I~G~gGvGKTtL  168 (549)
T 2a5y_B          150 LDSFFLFLHGRAGSGKSVI  168 (549)
T ss_dssp             SSSEEEEEECSTTSSHHHH
T ss_pred             CCceEEEEEcCCCCCHHHH
Confidence            4578999999999999998

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*

Probab=80.29  E-value=0.4  Score=39.08  Aligned_cols=17  Identities=35%  Similarity=0.272  Sum_probs=14.8

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+++|+|..|+|||+|.
T Consensus       124 sviLI~GpPGsGKTtLA  140 (331)
T 2vhj_A          124 GMVIVTGKGNSGKTPLV  140 (331)
T ss_dssp             EEEEEECSCSSSHHHHH
T ss_pred             cEEEEEcCCCCCHHHHH
Confidence            46899999999999983

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}

Probab=80.11  E-value=0.26  Score=45.18  Aligned_cols=17  Identities=29%  Similarity=0.374  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..|||||||++
T Consensus       446 ~vaivG~sGsGKSTll~  462 (1321)
T 4f4c_A          446 TVALVGSSGCGKSTIIS  462 (1321)
T ss_dssp             EEEEEECSSSCHHHHHH
T ss_pred             EEEEEecCCCcHHHHHH
Confidence            57799999999999963

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Length	Definition	E-value
Query	113
d1nija1	222	c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-t	1e-07

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 222

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Hypothetical protein YjiA, N-terminal domain
species: Escherichia coli [TaxId: 562]

 Score = 45.7 bits (107), Expect = 1e-07
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 93  NRIPATIITGFLGSGKNT 110
           N I  T++TGFLG+GK T
Sbjct: 1   NPIAVTLLTGFLGAGKTT 18

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	113
d1svia_	195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	97.07
d1qhla_	222	Cell division protein MukB {Escherichia coli [TaxI	96.77
g1ii8.1	369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	96.72
d1rz3a_	198	Hypothetical protein rbstp0775 {Bacillus stearothe	96.52
g1f2t.1	292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	96.34
g1xew.1	329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	96.16
d1e69a_	308	Smc head domain {Thermotoga maritima [TaxId: 2336]	95.94
d1sgwa_	200	Putative ABC transporter PF0895 {Pyrococcus furios	95.85
d1w1wa_	427	Smc head domain {Baker's yeast (Saccharomyces cere	95.79
d1n0wa_	242	DNA repair protein Rad51, catalytic domain {Human	95.64
d2fnaa2	283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	95.06
d1iqpa2	231	Replication factor C {Archaeon Pyrococcus furiosus	95.06
d1sxjd2	237	Replication factor C2 {Baker's yeast (Saccharomyce	95.03
d2qm8a1	323	Metallochaperone MeaB {Methylobacterium extorquens	94.88
d1szpa2	251	DNA repair protein Rad51, catalytic domain {Baker'	94.76
d2onka1	240	Molybdate/tungstate import ATP-binding protein Wtp	94.74
d1m7ga_	208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	94.55
d2p67a1	327	LAO/AO transport system kinase ArgK {Escherichia c	94.46
d1g6oa_	323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	94.46
d2awna2	232	Maltose transport protein MalK, N-terminal domain	94.44
d1l2ta_	230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	94.42
d1ji0a_	240	Branched chain aminoacid ABC transporter {Thermoto	94.34
d1r0wa_	281	Cystic fibrosis transmembrane conductance regulato	94.29
d1htwa_	158	Hypothetical protein HI0065 {Haemophilus influenza	94.26
d1sxjc2	227	Replication factor C3 {Baker's yeast (Saccharomyce	94.19
d2i1qa2	258	DNA repair protein Rad51, catalytic domain {Archae	94.1
d1fnna2	276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	94.08
d1in4a2	238	Holliday junction helicase RuvB {Thermotoga mariti	94.08
d1v43a3	239	Hypothetical protein PH0022, N-terminal domain {Py	94.08
d1g6ha_	254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	94.04
d1pzna2	254	DNA repair protein Rad51, catalytic domain {Archae	94.01
d3dhwc1	240	Methionine import ATP-binding protein MetN {Escher	94.0
d1sxjb2	224	Replication factor C4 {Baker's yeast (Saccharomyce	93.94
d1jj7a_	251	Peptide transporter Tap1, C-terminal ABC domain {H	93.86
d1gvnb_	273	Plasmid maintenance system epsilon/zeta, toxin zet	93.83
d2hyda1	255	Putative multidrug export ATP-binding/permease pro	93.79
d1sxje2	252	Replication factor C5 {Baker's yeast (Saccharomyce	93.65
d1l7vc_	231	ABC transporter involved in vitamin B12 uptake, Bt	93.49
d1tf7a1	242	Circadian clock protein KaiC {Synechococcus sp. st	93.49
d1mv5a_	242	Multidrug resistance ABC transporter LmrA, C-termi	93.39
d3b60a1	253	Multidrug resistance ABC transporter MsbA, C-termi	93.37
d1g2912	240	Maltose transport protein MalK, N-terminal domain	93.33
d3d31a2	229	Sulfate/molybdate ABC transporter, ATP-binding pro	93.24
d1wb9a2	234	DNA repair protein MutS, the C-terminal domain {Es	93.19
d1tf7a2	242	Circadian clock protein KaiC {Synechococcus sp. st	93.18
d1vpla_	238	Putative ABC transporter TM0544 {Thermotoga mariti	93.15
d1sxja2	253	Replication factor C1 {Baker's yeast (Saccharomyce	93.15
d2pmka1	241	Haemolysin B ATP-binding protein {Escherichia coli	93.12
d1odfa_	286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	93.04
d1p9ra_	401	Extracellular secretion NTPase EpsE {Vibrio choler	92.95
d1b0ua_	258	ATP-binding subunit of the histidine permease {Sal	92.95
d1ewqa2	224	DNA repair protein MutS, the C-terminal domain {Th	92.92
d1w36d1	359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	92.77
d1ixsb2	239	Holliday junction helicase RuvB {Thermus thermophi	92.75
d1v5wa_	258	Meiotic recombination protein DMC1/LIM15 homolog {	92.74
d1cr2a_	277	Gene 4 protein (g4p, DNA primase), helicase domain	92.72
d1oxxk2	242	Glucose transport protein GlcV, N-terminal domain	92.56
d1w5sa2	287	CDC6-like protein APE0152, N-terminal domain {Aero	92.56
d1sq5a_	308	Pantothenate kinase PanK {Escherichia coli [TaxId:	92.19
d1nlfa_	274	Hexameric replicative helicase repA {Escherichia c	91.48
d1u0la2	225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	90.61
d1pjra1	318	DEXX box DNA helicase {Bacillus stearothermophilus	89.19
d1t9ha2	231	Probable GTPase EngC (YjeQ), C-terminal domain {Ba	87.8
d2akab1	299	Dynamin G domain {Rat (Rattus norvegicus) [TaxId:	86.5
d1jwyb_	306	Dynamin G domain {Dictyostelium discoideum [TaxId:	86.29
d1h65a_	257	Chloroplast protein translocon GTPase Toc34 {Garde	85.22
d2a5yb3	277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	82.58
g1qhh.1	623	DEXX box DNA helicase {Bacillus stearothermophilus	82.07
d1d2na_	246	Hexamerization domain of N-ethylmalemide-sensitive	80.7

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngB
species: Bacillus subtilis [TaxId: 1423]

Probab=97.07  E-value=3.9e-05  Score=51.61  Aligned_cols=30  Identities=17%  Similarity=0.262  Sum_probs=24.7

Q ss_pred             ccccCCCCCCCCceEEEecccCCCccCCCC
Q 033696           84 DLLTKIPPDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        84 ~~~~~~~~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      .+....-|+..+|.+.|.|..|+|||||+|
T Consensus        12 ~~~~~~~p~~~~~~I~lvG~~n~GKSTLin   41 (195)
T d1svia_          12 AVKPEQYPEGGLPEIALAGRSNVGKSSFIN   41 (195)
T ss_dssp             ESSGGGSCCSCCCEEEEEEBTTSSHHHHHH
T ss_pred             cCChhHCCCCCCCEEEEECCCCCCHHHHHH
Confidence            344455667889999999999999999975

>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cell division protein MukB
species: Escherichia coli [TaxId: 562]

Probab=96.77  E-value=9.4e-06  Score=51.12  Aligned_cols=17  Identities=35%  Similarity=0.409  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++|||+|..||||||+|
T Consensus        25 ~~tvi~G~NGsGKStil   41 (222)
T d1qhla_          25 LVTTLSGGNGAGKSTTM   41 (222)
T ss_dssp             HHHHHHSCCSHHHHHHH
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            58999999999999986

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein rbstp0775
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=96.52  E-value=0.00028  Score=45.73  Aligned_cols=19  Identities=32%  Similarity=0.296  Sum_probs=16.4

Q ss_pred             CCceEE-EecccCCCccCCC
Q 033696           94 RIPATI-ITGFLGSGKNTGS  112 (113)
Q Consensus        94 riPvTI-iTGfLGsGKtTLL  112 (113)
                      +-|++| |+|.-|||||||.
T Consensus        20 ~~~~iIgI~G~~GSGKSTla   39 (198)
T d1rz3a_          20 AGRLVLGIDGLSRSGKTTLA   39 (198)
T ss_dssp             SSSEEEEEEECTTSSHHHHH
T ss_pred             CCCEEEEEECCCCCCHHHHH
Confidence            348888 9999999999983

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Thermotoga maritima [TaxId: 2336]

Probab=95.94  E-value=0.00075  Score=47.33  Aligned_cols=17  Identities=41%  Similarity=0.362  Sum_probs=15.7

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      +++||.|..||||||+|
T Consensus        25 ~lnvlvG~NgsGKS~iL   41 (308)
T d1e69a_          25 RVTAIVGPNGSGKSNII   41 (308)
T ss_dssp             SEEEEECCTTTCSTHHH
T ss_pred             CeEEEECCCCCcHHHHH
Confidence            49999999999999986

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter PF0895
species: Pyrococcus furiosus [TaxId: 2261]

Probab=95.85  E-value=0.00044  Score=49.26  Aligned_cols=17  Identities=29%  Similarity=0.169  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        29 i~~l~G~NGsGKSTLl~   45 (200)
T d1sgwa_          29 VVNFHGPNGIGKTTLLK   45 (200)
T ss_dssp             CEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            67899999999999974

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.79  E-value=0.0007  Score=48.52  Aligned_cols=16  Identities=44%  Similarity=0.349  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +|+|+|..|||||++|
T Consensus        27 l~~i~G~NGsGKS~il   42 (427)
T d1w1wa_          27 FTSIIGPNGSGKSNMM   42 (427)
T ss_dssp             EEEEECSTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            8999999999999985

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.64  E-value=0.0011  Score=41.52  Aligned_cols=16  Identities=25%  Similarity=0.218  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +|+|+|..|+|||+|.
T Consensus        25 v~~i~G~~GsGKT~l~   40 (242)
T d1n0wa_          25 ITEMFGEFRTGKTQIC   40 (242)
T ss_dssp             EEEEECCTTSSHHHHH
T ss_pred             EEEEEeCCCCCHHHHH
Confidence            8999999999999983

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Archaeal ATPase SSO1545
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=95.06  E-value=0.0013  Score=43.77  Aligned_cols=17  Identities=29%  Similarity=0.524  Sum_probs=15.4

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      ++++|+|..|+|||+|+
T Consensus        30 ~~i~i~G~~G~GKTsLl   46 (283)
T d2fnaa2          30 PITLVLGLRRTGKSSII   46 (283)
T ss_dssp             SEEEEEESTTSSHHHHH
T ss_pred             CEEEEEcCCCCcHHHHH
Confidence            57899999999999986

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=95.06  E-value=0.0026  Score=43.34  Aligned_cols=20  Identities=30%  Similarity=0.552  Sum_probs=17.6

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .++|-.|++|..|+|||||.
T Consensus        43 ~~~~~lll~Gp~G~GKTtla   62 (231)
T d1iqpa2          43 GSMPHLLFAGPPGVGKTTAA   62 (231)
T ss_dssp             TCCCEEEEESCTTSSHHHHH
T ss_pred             CCCCeEEEECCCCCcHHHHH
Confidence            46788999999999999974

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.03  E-value=0.0027  Score=42.73  Aligned_cols=21  Identities=24%  Similarity=0.460  Sum_probs=17.9

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      ..++|-.|++|..|+|||||+
T Consensus        30 ~~~~~~lll~Gp~G~GKTtl~   50 (237)
T d1sxjd2          30 SANLPHMLFYGPPGTGKTSTI   50 (237)
T ss_dssp             CTTCCCEEEECSTTSSHHHHH
T ss_pred             cCCCCeEEEECCCCCChHHHH
Confidence            356788999999999999974

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Metallochaperone MeaB
species: Methylobacterium extorquens [TaxId: 408]

Probab=94.88  E-value=0.0017  Score=49.49  Aligned_cols=23  Identities=35%  Similarity=0.333  Sum_probs=19.3

Q ss_pred             CCCCCceEEEecccCCCccCCCC
Q 033696           91 PDNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        91 ~~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ...+.+++=|||+.|+|||||++
T Consensus        47 ~~~~~~~igitG~pGaGKSTli~   69 (323)
T d2qm8a1          47 QTGRAIRVGITGVPGVGKSTTID   69 (323)
T ss_dssp             GCCCSEEEEEECCTTSCHHHHHH
T ss_pred             ccCCceEEeeeCCCCCCHHHHHH
Confidence            34578888999999999999963

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=94.76  E-value=0.0027  Score=41.75  Aligned_cols=15  Identities=27%  Similarity=0.248  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      +++|+|..|+|||||
T Consensus        36 ~~li~G~pGsGKT~l   50 (251)
T d1szpa2          36 ITELFGEFRTGKSQL   50 (251)
T ss_dssp             EEEEEESTTSSHHHH
T ss_pred             EEEEEcCCCCCHHHH
Confidence            899999999999998

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Molybdate/tungstate import ATP-binding protein WtpC (ModC)
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=94.74  E-value=0.0019  Score=48.42  Aligned_cols=18  Identities=22%  Similarity=0.257  Sum_probs=15.4

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -++.|.|..||||||||+
T Consensus        25 e~~~liGpnGaGKSTll~   42 (240)
T d2onka1          25 DYCVLLGPTGAGKSVFLE   42 (240)
T ss_dssp             SEEEEECCTTSSHHHHHH
T ss_pred             EEEEEECCCCChHHHHHH
Confidence            377788999999999963

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]

Probab=94.55  E-value=0.0034  Score=44.24  Aligned_cols=15  Identities=40%  Similarity=0.479  Sum_probs=14.0

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      |+.+||..|||||||
T Consensus        26 vIwltGlsGsGKTTi   40 (208)
T d1m7ga_          26 TIWLTGLSASGKSTL   40 (208)
T ss_dssp             EEEEECSTTSSHHHH
T ss_pred             EEEEECCCCCCHHHH
Confidence            788999999999997

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: LAO/AO transport system kinase ArgK
species: Escherichia coli [TaxId: 562]

Probab=94.46  E-value=0.0025  Score=48.70  Aligned_cols=22  Identities=27%  Similarity=0.146  Sum_probs=19.1

Q ss_pred             CCCCceEEEecccCCCccCCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLLn  113 (113)
                      ..+.+++=|||+.|+|||||+|
T Consensus        51 ~~~~~~IgitG~pGaGKSTLi~   72 (327)
T d2p67a1          51 CGNTLRLGVTGTPGAGKSTFLE   72 (327)
T ss_dssp             CSCSEEEEEEECTTSCHHHHHH
T ss_pred             cCCceEEEeeCCCCCCHHHHHH
Confidence            3568899999999999999964

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hexameric traffic ATPase, HP0525
species: Helicobacter pylori [TaxId: 210]

Probab=94.46  E-value=0.0021  Score=48.86  Aligned_cols=16  Identities=44%  Similarity=0.461  Sum_probs=14.5

Q ss_pred             EEEecccCCCccCCCC
Q 033696           98 TIITGFLGSGKNTGSA  113 (113)
Q Consensus        98 TIiTGfLGsGKtTLLn  113 (113)
                      .+|+|.-|||||||||
T Consensus       169 ili~G~tgSGKTT~l~  184 (323)
T d1g6oa_         169 VIVCGGTGSGKTTYIK  184 (323)
T ss_dssp             EEEEESTTSSHHHHHH
T ss_pred             EEEEeeccccchHHHH
Confidence            5889999999999975

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=94.44  E-value=0.0024  Score=47.30  Aligned_cols=17  Identities=29%  Similarity=0.301  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|-|..||||||||+
T Consensus        28 i~~liGpsGsGKSTLl~   44 (232)
T d2awna2          28 FVVFVGPSGCGKSTLLR   44 (232)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            78899999999999974

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ0796
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=94.42  E-value=0.0025  Score=47.13  Aligned_cols=17  Identities=41%  Similarity=0.317  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        33 ~~~iiG~sGsGKSTLl~   49 (230)
T d1l2ta_          33 FVSIMGPSGSGKSTMLN   49 (230)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCcchhhH
Confidence            78899999999999974

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Branched chain aminoacid ABC transporter
species: Thermotoga maritima, TM1139 [TaxId: 2336]

Probab=94.34  E-value=0.0026  Score=46.65  Aligned_cols=17  Identities=29%  Similarity=0.403  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      |+-|.|..|||||||+|
T Consensus        34 i~~liGpnGaGKSTl~~   50 (240)
T d1ji0a_          34 IVTLIGANGAGKTTTLS   50 (240)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999964

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.29  E-value=0.0026  Score=47.67  Aligned_cols=17  Identities=41%  Similarity=0.386  Sum_probs=14.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|.|..||||||||+
T Consensus        64 ~vaivG~nGsGKSTLl~   80 (281)
T d1r0wa_          64 MLAITGSTGSGKTSLLM   80 (281)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            56788999999999974

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: YjeE-like
domain: Hypothetical protein HI0065
species: Haemophilus influenzae [TaxId: 727]

Probab=94.26  E-value=0.0044  Score=43.93  Aligned_cols=15  Identities=40%  Similarity=0.536  Sum_probs=13.6

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      |+.+.|-||||||||
T Consensus        35 ii~L~G~LGaGKTtf   49 (158)
T d1htwa_          35 MVYLNGDLGAGKTTL   49 (158)
T ss_dssp             EEEEECSTTSSHHHH
T ss_pred             EEEEecCCCccHHHH
Confidence            677899999999998

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C3
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=94.19  E-value=0.0055  Score=41.46  Aligned_cols=20  Identities=25%  Similarity=0.514  Sum_probs=17.6

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .++|-.|++|.-|+|||||+
T Consensus        33 ~~~~~lLl~Gp~G~GKttl~   52 (227)
T d1sxjc2          33 GKLPHLLFYGPPGTGKTSTI   52 (227)
T ss_dssp             TCCCCEEEECSSSSSHHHHH
T ss_pred             CCCCeEEEECCCCCChhHHH
Confidence            56788999999999999974

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Methanococcus voltae [TaxId: 2188]

Probab=94.10  E-value=0.0047  Score=40.27  Aligned_cols=15  Identities=40%  Similarity=0.552  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      +|+|+|..|+|||+|
T Consensus        36 l~~i~G~~G~GKT~~   50 (258)
T d2i1qa2          36 VTEFAGVFGSGKTQI   50 (258)
T ss_dssp             EEEEEESTTSSHHHH
T ss_pred             EEEEEeCCCCCHHHH
Confidence            899999999999997

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6, N-domain
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]

Probab=94.08  E-value=0.0044  Score=41.26  Aligned_cols=21  Identities=24%  Similarity=0.414  Sum_probs=17.7

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      ....+..+|+|..|.|||+++
T Consensus        40 ~~~~~~lll~GppGtGKT~l~   60 (276)
T d1fnna2          40 GHHYPRATLLGRPGTGKTVTL   60 (276)
T ss_dssp             TSSCCEEEEECCTTSSHHHHH
T ss_pred             CCCCCceEEECCCCCCHHHHH
Confidence            345678999999999999874

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermotoga maritima [TaxId: 2336]

Probab=94.08  E-value=0.0059  Score=41.59  Aligned_cols=19  Identities=26%  Similarity=0.349  Sum_probs=16.9

Q ss_pred             CCCceEEEecccCCCccCC
Q 033696           93 NRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTL  111 (113)
                      +..|-.+++|+.|.|||||
T Consensus        33 ~~~~~~L~~GPpGtGKT~l   51 (238)
T d1in4a2          33 EVLDHVLLAGPPGLGKTTL   51 (238)
T ss_dssp             CCCCCEEEESSTTSSHHHH
T ss_pred             CCCCeEEEECCCCCcHHHH
Confidence            4567899999999999997

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=94.08  E-value=0.0032  Score=46.90  Aligned_cols=17  Identities=29%  Similarity=0.343  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++.|-|..||||||||+
T Consensus        34 ~~~liGpsGaGKSTLl~   50 (239)
T d1v43a3          34 FLVLLGPSGCGKTTTLR   50 (239)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            68899999999999974

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ1267
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=94.04  E-value=0.0033  Score=46.26  Aligned_cols=18  Identities=44%  Similarity=0.434  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =|+-|.|..|||||||+|
T Consensus        31 ei~~liG~nGaGKSTLl~   48 (254)
T d1g6ha_          31 DVTLIIGPNGSGKSTLIN   48 (254)
T ss_dssp             CEEEEECSTTSSHHHHHH
T ss_pred             CEEEEECCCCCcHHHHHH
Confidence            377899999999999964

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=94.01  E-value=0.005  Score=41.24  Aligned_cols=15  Identities=40%  Similarity=0.430  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      +++|+|..|+|||||
T Consensus        38 ~~li~G~pGsGKT~~   52 (254)
T d1pzna2          38 ITEVFGEFGSGKTQL   52 (254)
T ss_dssp             EEEEEESTTSSHHHH
T ss_pred             EEEEEcCCCCCHHHH
Confidence            899999999999997

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Methionine import ATP-binding protein MetN
species: Escherichia coli [TaxId: 562]

Probab=94.00  E-value=0.0032  Score=46.84  Aligned_cols=17  Identities=29%  Similarity=0.229  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        33 ~~~iiG~sGsGKSTLl~   49 (240)
T d3dhwc1          33 IYGVIGASGAGKSTLIR   49 (240)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            78899999999999964

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=93.94  E-value=0.0064  Score=41.42  Aligned_cols=20  Identities=45%  Similarity=0.792  Sum_probs=17.6

Q ss_pred             CCCCceEEEecccCCCccCC
Q 033696           92 DNRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTL  111 (113)
                      ..++|-.|++|.-|+||||+
T Consensus        33 ~~~~~~~ll~Gp~G~GKTt~   52 (224)
T d1sxjb2          33 DGNMPHMIISGMPGIGKTTS   52 (224)
T ss_dssp             SCCCCCEEEECSTTSSHHHH
T ss_pred             cCCCCeEEEECCCCCCchhh
Confidence            35678899999999999997

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Peptide transporter Tap1, C-terminal ABC domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.86  E-value=0.0038  Score=46.07  Aligned_cols=17  Identities=47%  Similarity=0.522  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        42 ~vaivG~sGsGKSTLl~   58 (251)
T d1jj7a_          42 VTALVGPNGSGKSTVAA   58 (251)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            67899999999999963

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
domain: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
species: Streptococcus pyogenes [TaxId: 1314]

Probab=93.83  E-value=0.012  Score=39.77  Aligned_cols=20  Identities=30%  Similarity=0.410  Sum_probs=15.7

Q ss_pred             CCCCce-EEEecccCCCccCC
Q 033696           92 DNRIPA-TIITGFLGSGKNTG  111 (113)
Q Consensus        92 ~~riPv-TIiTGfLGsGKtTL  111 (113)
                      +...|. +++.|..|+|||||
T Consensus        28 ~~~~P~~ilL~GpPGtGKT~l   48 (273)
T d1gvnb_          28 AVESPTAFLLGGQPGSGKTSL   48 (273)
T ss_dssp             CCSSCEEEEEECCTTSCTHHH
T ss_pred             CCCCCEEEEEECCCCCCHHHH
Confidence            344555 66999999999997

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

Probab=93.79  E-value=0.0053  Score=45.65  Aligned_cols=17  Identities=29%  Similarity=0.405  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+.|.|..||||||||+
T Consensus        46 ~vaivG~sGsGKSTLl~   62 (255)
T d2hyda1          46 TVAFVGMSGGGKSTLIN   62 (255)
T ss_dssp             EEEEECSTTSSHHHHHT
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            67899999999999974

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=93.65  E-value=0.0088  Score=40.47  Aligned_cols=20  Identities=30%  Similarity=0.522  Sum_probs=17.2

Q ss_pred             CCCCceEEEecccCCCccCC
Q 033696           92 DNRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTL  111 (113)
                      ....|-.|++|..|+||||+
T Consensus        30 ~~~~~~lll~Gp~G~GKTt~   49 (252)
T d1sxje2          30 PRDLPHLLLYGPNGTGKKTR   49 (252)
T ss_dssp             TTCCCCEEEECSTTSSHHHH
T ss_pred             CCCCCeEEEECCCCCCHHHH
Confidence            34577899999999999997

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ABC transporter involved in vitamin B12 uptake, BtuD
species: Escherichia coli [TaxId: 562]

Probab=93.49  E-value=0.0039  Score=45.13  Aligned_cols=17  Identities=35%  Similarity=0.298  Sum_probs=15.0

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|-|..||||||||+
T Consensus        27 i~~iiG~nGaGKSTLl~   43 (231)
T d1l7vc_          27 ILHLVGPNGAGKSTLLA   43 (231)
T ss_dssp             EEECBCCTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            67788999999999974

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=93.49  E-value=0.007  Score=39.45  Aligned_cols=16  Identities=31%  Similarity=0.507  Sum_probs=14.7

Q ss_pred             ceEEEecccCCCccCC
Q 033696           96 PATIITGFLGSGKNTG  111 (113)
Q Consensus        96 PvTIiTGfLGsGKtTL  111 (113)
                      =+++|+|..|+|||+|
T Consensus        27 ~~~~I~G~~G~GKT~l   42 (242)
T d1tf7a1          27 RSTLVSGTSGTGKTLF   42 (242)
T ss_dssp             SEEEEEESTTSSHHHH
T ss_pred             eEEEEEeCCCCCHHHH
Confidence            3899999999999987

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Multidrug resistance ABC transporter LmrA, C-terminal domain
species: Lactococcus lactis [TaxId: 1358]

Probab=93.39  E-value=0.005  Score=45.14  Aligned_cols=17  Identities=29%  Similarity=0.278  Sum_probs=14.7

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..|||||||++
T Consensus        30 ~vaivG~sGsGKSTLl~   46 (242)
T d1mv5a_          30 IIAFAGPSGGGKSTIFS   46 (242)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            56789999999999963

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Multidrug resistance ABC transporter MsbA, C-terminal domain
species: Salmonella typhimurium [TaxId: 90371]

Probab=93.37  E-value=0.0048  Score=45.51  Aligned_cols=17  Identities=35%  Similarity=0.464  Sum_probs=14.9

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..|||||||++
T Consensus        43 ~iaivG~sGsGKSTLl~   59 (253)
T d3b60a1          43 TVALVGRSGSGKSTIAS   59 (253)
T ss_dssp             EEEEEECTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            57889999999999963

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]

Probab=93.33  E-value=0.0052  Score=45.65  Aligned_cols=17  Identities=35%  Similarity=0.374  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        31 ~~~liG~sGaGKSTll~   47 (240)
T d1g2912          31 FMILLGPSGCGKTTTLR   47 (240)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            67899999999999964

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Sulfate/molybdate ABC transporter, ATP-binding protein
species: Methanosarcina acetivorans [TaxId: 2214]

Probab=93.24  E-value=0.0035  Score=46.42  Aligned_cols=17  Identities=29%  Similarity=0.243  Sum_probs=15.3

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..||||||||+
T Consensus        28 ~~~liGpsGaGKSTll~   44 (229)
T d3d31a2          28 YFVILGPTGAGKTLFLE   44 (229)
T ss_dssp             EEEEECCCTHHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999974

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=93.19  E-value=0.0072  Score=43.87  Aligned_cols=17  Identities=41%  Similarity=0.239  Sum_probs=15.9

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      .+.||||...+||||+|
T Consensus        42 ~~~iiTGpN~~GKSt~l   58 (234)
T d1wb9a2          42 RMLIITGPNMGGKSTYM   58 (234)
T ss_dssp             CEEEEECCTTSSHHHHH
T ss_pred             eEEEEeccCchhhHHHH
Confidence            68999999999999986

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=93.18  E-value=0.0084  Score=40.48  Aligned_cols=16  Identities=31%  Similarity=0.372  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +|+|+|..|+|||+|.
T Consensus        28 l~li~G~pGsGKT~l~   43 (242)
T d1tf7a2          28 IILATGATGTGKTLLV   43 (242)
T ss_dssp             EEEEEECTTSSHHHHH
T ss_pred             EEEEEeCCCCCHHHHH
Confidence            8999999999999973

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter TM0544
species: Thermotoga maritima [TaxId: 2336]

Probab=93.15  E-value=0.0058  Score=44.81  Aligned_cols=17  Identities=29%  Similarity=0.221  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      |+=|-|..|||||||||
T Consensus        30 i~glvG~nGaGKSTLl~   46 (238)
T d1vpla_          30 IFGLIGPNGAGKTTTLR   46 (238)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            66788999999999974

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=93.15  E-value=0.014  Score=39.65  Aligned_cols=21  Identities=29%  Similarity=0.400  Sum_probs=17.9

Q ss_pred             CCCCceEEEecccCCCccCCC
Q 033696           92 DNRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        92 ~~riPvTIiTGfLGsGKtTLL  112 (113)
                      ....|..+++|..|+||||+.
T Consensus        49 ~~~~~~lll~GPpG~GKTt~a   69 (253)
T d1sxja2          49 SGVFRAAMLYGPPGIGKTTAA   69 (253)
T ss_dssp             TTSCSEEEEECSTTSSHHHHH
T ss_pred             CCCCceEEEECCCCCCHHHHH
Confidence            455689999999999999973

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Haemolysin B ATP-binding protein
species: Escherichia coli [TaxId: 562]

Probab=93.12  E-value=0.0059  Score=44.94  Aligned_cols=17  Identities=41%  Similarity=0.374  Sum_probs=14.6

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+-|.|..||||||||+
T Consensus        31 ~vaIvG~sGsGKSTLl~   47 (241)
T d2pmka1          31 VIGIVGRSGSGKSTLTK   47 (241)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            56789999999999963

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein Ygr205W
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=93.04  E-value=0.014  Score=44.33  Aligned_cols=20  Identities=40%  Similarity=0.561  Sum_probs=17.6

Q ss_pred             CCCCceEE-EecccCCCccCC
Q 033696           92 DNRIPATI-ITGFLGSGKNTG  111 (113)
Q Consensus        92 ~~riPvTI-iTGfLGsGKtTL  111 (113)
                      .++.|..| |+|.-|||||||
T Consensus        23 ~~~~P~iIGi~G~qGSGKSTl   43 (286)
T d1odfa_          23 GNKCPLFIFFSGPQGSGKSFT   43 (286)
T ss_dssp             TCCSCEEEEEECCTTSSHHHH
T ss_pred             CCCCCEEEEeECCCCCCHHHH
Confidence            46689888 999999999997

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Extracellular secretion NTPase EpsE
species: Vibrio cholerae [TaxId: 666]

Probab=92.95  E-value=0.0081  Score=46.25  Aligned_cols=20  Identities=35%  Similarity=0.383  Sum_probs=17.2

Q ss_pred             CCCceEEEecccCCCccCCC
Q 033696           93 NRIPATIITGFLGSGKNTGS  112 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLL  112 (113)
                      .+--++||||.-||||||.|
T Consensus       156 ~~~GliLvtGpTGSGKSTTl  175 (401)
T d1p9ra_         156 RPHGIILVTGPTGSGKSTTL  175 (401)
T ss_dssp             SSSEEEEEECSTTSCHHHHH
T ss_pred             hhhceEEEEcCCCCCccHHH
Confidence            34578999999999999975

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ATP-binding subunit of the histidine permease
species: Salmonella typhimurium [TaxId: 90371]

Probab=92.95  E-value=0.0065  Score=45.12  Aligned_cols=17  Identities=41%  Similarity=0.333  Sum_probs=15.1

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      ++-|.|..|||||||++
T Consensus        30 i~~iiG~sGsGKSTLl~   46 (258)
T d1b0ua_          30 VISIIGSSGSGKSTFLR   46 (258)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            78899999999999963

>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Thermus aquaticus [TaxId: 271]

Probab=92.92  E-value=0.0066  Score=44.01  Aligned_cols=16  Identities=38%  Similarity=0.239  Sum_probs=15.2

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      ++||||...+||||+|
T Consensus        37 ~~iiTGpN~~GKSt~l   52 (224)
T d1ewqa2          37 LVLITGPNMAGKSTFL   52 (224)
T ss_dssp             EEEEESCSSSSHHHHH
T ss_pred             EEEEECCCccccchhh
Confidence            8999999999999986

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]

Probab=92.77  E-value=0.0093  Score=45.68  Aligned_cols=18  Identities=33%  Similarity=0.444  Sum_probs=16.0

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      =+++||+|..|+||||++
T Consensus       163 ~~~~vI~G~pGTGKTt~i  180 (359)
T d1w36d1         163 RRISVISGGPGTGKTTTV  180 (359)
T ss_dssp             BSEEEEECCTTSTHHHHH
T ss_pred             CCeEEEEcCCCCCceehH
Confidence            489999999999999863

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermus thermophilus [TaxId: 274]

Probab=92.75  E-value=0.015  Score=39.69  Aligned_cols=19  Identities=26%  Similarity=0.300  Sum_probs=16.7

Q ss_pred             CCCceEEEecccCCCccCC
Q 033696           93 NRIPATIITGFLGSGKNTG  111 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTL  111 (113)
                      ..+|-.+++|+.|.|||||
T Consensus        33 ~~~~~~Ll~GPpG~GKTtl   51 (239)
T d1ixsb2          33 EPLEHLLLFGPPGLGKTTL   51 (239)
T ss_dssp             SCCCCEEEECCTTSCHHHH
T ss_pred             CCCCeEEEECCCCCCHHHH
Confidence            4577899999999999997

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Meiotic recombination protein DMC1/LIM15 homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.74  E-value=0.011  Score=39.14  Aligned_cols=15  Identities=27%  Similarity=0.160  Sum_probs=14.5

Q ss_pred             eEEEecccCCCccCC
Q 033696           97 ATIITGFLGSGKNTG  111 (113)
Q Consensus        97 vTIiTGfLGsGKtTL  111 (113)
                      +++|+|..|+|||+|
T Consensus        39 ~~~i~G~~GsGKT~l   53 (258)
T d1v5wa_          39 ITEAFGEFRTGKTQL   53 (258)
T ss_dssp             EEEEECCTTCTHHHH
T ss_pred             EEEEECCCCCCHHHH
Confidence            899999999999997

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]

Probab=92.72  E-value=0.0092  Score=41.47  Aligned_cols=17  Identities=29%  Similarity=0.245  Sum_probs=15.2

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      =++||+|..|+|||+|+
T Consensus        36 ~l~vi~G~~G~GKT~~~   52 (277)
T d1cr2a_          36 EVIMVTSGSGMGKSTFV   52 (277)
T ss_dssp             CEEEEECSTTSSHHHHH
T ss_pred             eEEEEEeCCCCCHHHHH
Confidence            38999999999999974

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Glucose transport protein GlcV, N-terminal domain
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=92.56  E-value=0.0042  Score=46.42  Aligned_cols=18  Identities=33%  Similarity=0.167  Sum_probs=15.6

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      =++.|.|..||||||||+
T Consensus        32 e~~~iiG~sGsGKSTll~   49 (242)
T d1oxxk2          32 ERFGILGPSGAGKTTFMR   49 (242)
T ss_dssp             CEEEEECSCHHHHHHHHH
T ss_pred             CEEEEECCCCCcHHHHHH
Confidence            378899999999999964

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6-like protein APE0152, N-terminal domain
species: Aeropyrum pernix [TaxId: 56636]

Probab=92.56  E-value=0.0047  Score=41.33  Aligned_cols=18  Identities=28%  Similarity=0.089  Sum_probs=14.7

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      .++.+++|..|.|||+++
T Consensus        46 ~~~l~l~GppGtGKT~l~   63 (287)
T d1w5sa2          46 NMIYGSIGRVGIGKTTLA   63 (287)
T ss_dssp             EEEEECTTCCSSSHHHHH
T ss_pred             ceEEEeECCCCCCHHHHH
Confidence            345678999999999974

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Pantothenate kinase PanK
species: Escherichia coli [TaxId: 562]

Probab=92.19  E-value=0.019  Score=43.79  Aligned_cols=22  Identities=41%  Similarity=0.596  Sum_probs=18.4

Q ss_pred             CCCCCCceEE-EecccCCCccCC
Q 033696           90 PPDNRIPATI-ITGFLGSGKNTG  111 (113)
Q Consensus        90 ~~~~riPvTI-iTGfLGsGKtTL  111 (113)
                      .+..+.|..| |.|.-|||||||
T Consensus        74 ~~~~k~P~iIGIaG~sgSGKSTl   96 (308)
T d1sq5a_          74 TNGQRIPYIISIAGSVAVGKSTT   96 (308)
T ss_dssp             CC-CCCCEEEEEEECTTSSHHHH
T ss_pred             ccCCCCCEEEEEeCCCCCCCcHH
Confidence            4457889888 999999999997

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hexameric replicative helicase repA
species: Escherichia coli [TaxId: 562]

Probab=91.48  E-value=0.015  Score=40.04  Aligned_cols=16  Identities=19%  Similarity=0.162  Sum_probs=14.8

Q ss_pred             eEEEecccCCCccCCC
Q 033696           97 ATIITGFLGSGKNTGS  112 (113)
Q Consensus        97 vTIiTGfLGsGKtTLL  112 (113)
                      +++|+|..|+|||||+
T Consensus        31 ~~~i~G~~G~GKS~l~   46 (274)
T d1nlfa_          31 VGALVSPGGAGKSMLA   46 (274)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEEeCCCCCHHHHH
Confidence            8999999999999983

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngC (YjeQ), C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=90.61  E-value=0.017  Score=42.67  Aligned_cols=17  Identities=24%  Similarity=0.407  Sum_probs=15.9

Q ss_pred             eEEEecccCCCccCCCC
Q 033696           97 ATIITGFLGSGKNTGSA  113 (113)
Q Consensus        97 vTIiTGfLGsGKtTLLn  113 (113)
                      .+++.|..|.||+||+|
T Consensus        97 t~~~~G~SGVGKSTLiN  113 (225)
T d1u0la2          97 ISTMAGLSGVGKSSLLN  113 (225)
T ss_dssp             EEEEECSTTSSHHHHHH
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            78999999999999986

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEXX box DNA helicase
species: Bacillus stearothermophilus, PcrA [TaxId: 1422]

Probab=89.19  E-value=0.028  Score=39.32  Aligned_cols=16  Identities=38%  Similarity=0.420  Sum_probs=12.3

Q ss_pred             ceEEEecccCCCccCCC
Q 033696           96 PATIITGFLGSGKNTGS  112 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLL  112 (113)
                      | ++|-|.-||||||.|
T Consensus        26 ~-~lV~g~aGSGKTt~l   41 (318)
T d1pjra1          26 P-LLIMAGAGSGKTRVL   41 (318)
T ss_dssp             C-EEEEECTTSCHHHHH
T ss_pred             C-EEEEecCCccHHHHH
Confidence            5 456688999999853

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngC (YjeQ), C-terminal domain
species: Bacillus subtilis [TaxId: 1423]

Probab=87.80  E-value=0.016  Score=43.00  Aligned_cols=18  Identities=28%  Similarity=0.374  Sum_probs=16.1

Q ss_pred             ceEEEecccCCCccCCCC
Q 033696           96 PATIITGFLGSGKNTGSA  113 (113)
Q Consensus        96 PvTIiTGfLGsGKtTLLn  113 (113)
                      -.+++.|..|.||+||+|
T Consensus        98 ~~~vl~G~SGVGKSSLiN  115 (231)
T d1t9ha2          98 KTTVFAGQSGVGKSSLLN  115 (231)
T ss_dssp             SEEEEEESHHHHHHHHHH
T ss_pred             ceEEEECCCCccHHHHHH
Confidence            378899999999999986

>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=86.50  E-value=0.049  Score=38.41  Aligned_cols=21  Identities=19%  Similarity=0.267  Sum_probs=18.6

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      -.+|-.+|.|--.+||+||||
T Consensus        24 ~~~P~ivvvG~~SsGKSsliN   44 (299)
T d2akab1          24 LDLPQIAVVGGQSAGKSSVLE   44 (299)
T ss_dssp             CCCCEEEEEEBTTSCHHHHHH
T ss_pred             CCCCeEEEEcCCCCCHHHHHH
Confidence            357889999999999999986

>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Dictyostelium discoideum [TaxId: 44689]

Probab=86.29  E-value=0.051  Score=38.65  Aligned_cols=21  Identities=24%  Similarity=0.384  Sum_probs=18.4

Q ss_pred             CCCceEEEecccCCCccCCCC
Q 033696           93 NRIPATIITGFLGSGKNTGSA  113 (113)
Q Consensus        93 ~riPvTIiTGfLGsGKtTLLn  113 (113)
                      -.+|-.+|.|--.+||+||||
T Consensus        22 ~~lP~ivVvG~~ssGKSSliN   42 (306)
T d1jwyb_          22 LDLPQIVVVGSQSSGKSSVLE   42 (306)
T ss_dssp             TCCCEEEEEECSSSSHHHHHH
T ss_pred             CCCCeEEEEeCCCCCHHHHHH
Confidence            346888999999999999986

>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Chloroplast protein translocon GTPase Toc34
species: Garden pea (Pisum sativum) [TaxId: 3888]

Probab=85.22  E-value=0.051  Score=38.80  Aligned_cols=16  Identities=25%  Similarity=0.397  Sum_probs=13.7

Q ss_pred             EEEecccCCCccCCCC
Q 033696           98 TIITGFLGSGKNTGSA  113 (113)
Q Consensus        98 TIiTGfLGsGKtTLLn  113 (113)
                      ++|.|-.|+||+||+|
T Consensus        35 I~LvG~tg~GKSSliN   50 (257)
T d1h65a_          35 ILVMGKGGVGKSSTVN   50 (257)
T ss_dssp             EEEEESTTSSHHHHHH
T ss_pred             EEEECCCCCcHHHHHH
Confidence            4567999999999976

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=82.58  E-value=0.16  Score=36.29  Aligned_cols=18  Identities=28%  Similarity=0.235  Sum_probs=15.5

Q ss_pred             CceEEEecccCCCccCCC
Q 033696           95 IPATIITGFLGSGKNTGS  112 (113)
Q Consensus        95 iPvTIiTGfLGsGKtTLL  112 (113)
                      .=+..|.|.-|.|||||.
T Consensus        44 ~~~v~I~GmgGiGKTtLA   61 (277)
T d2a5yb3          44 SFFLFLHGRAGSGKSVIA   61 (277)
T ss_dssp             SEEEEEECSTTSSHHHHH
T ss_pred             ceEEEEECCCCCCHHHHH
Confidence            447889999999999983

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein
species: Chinese hamster (Cricetulus griseus) [TaxId: 10029]

Probab=80.70  E-value=0.16  Score=36.12  Aligned_cols=15  Identities=27%  Similarity=0.321  Sum_probs=13.4

Q ss_pred             EEEecccCCCccCCC
Q 033696           98 TIITGFLGSGKNTGS  112 (113)
Q Consensus        98 TIiTGfLGsGKtTLL  112 (113)
                      +++.|..|+|||+|.
T Consensus        43 vLL~GppGtGKT~la   57 (246)
T d1d2na_          43 VLLEGPPHSGKTALA   57 (246)
T ss_dssp             EEEECSTTSSHHHHH
T ss_pred             EEEECcCCCCHHHHH
Confidence            789999999999873