Citrus Sinensis ID: 034326

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MATPPVPVVASLAKVKLFSIMPSSSSSSRSRPSHSLKSKPALCAPVKQEVEVGIMCESCNGKGWLVCDFCGGQKTNVKAQNNRIYRRCPTCRAVSTPI
ccccccHHEEEEEEEEEEEEEcccccccccccccccccccccccccccEEEccEEEcccccccEEEEEccccccccEEccccEEEEcccccccccccc
cccccccEEEEHEEEEEEEEcccccccccccccccccccccccccHHHHcHcccEcccccccEEEEEEccccccccccccccEEEEccccccEEEccc
MATPPVPVVASLAKVKLFsimpssssssrsrpshslkskpalcapvkqeVEVGIMCescngkgwlvcdfcggqktnvkaqnnriyrrcptcravstpi
MATPPVPVVASLAKVKLFSIMPssssssrsrpshslkskpalcapVKQEVEVGIMCESCNGKGWLVCDFCGGQKtnvkaqnnriyrrcptcravstpi
MATPPVPVVASLAKVKLFSIMpssssssrsrpshslkskpALCAPVKQEVEVGIMCESCNGKGWLVCDFCGGQKTNVKAQNNRIYRRCPTCRAVSTPI
**************VKL************************LCAPVKQEVEVGIMCESCNGKGWLVCDFCGGQKTNVKAQNNRIYRRCPTCR******
***PPVPVVASLAKVKLFSIMP***************************VEVGIMCESCNGKGWLVCDFCGGQKT****Q**RIYRRCPTCRAVSTPI
MATPPVPVVASLAKVKLFSI*******************PALCAPVKQEVEVGIMCESCNGKGWLVCDFCGGQKTNVKAQNNRIYRRCPTCRAVSTPI
**TPPVPVVASLAKVKLFSIMPS**************SKPALCAPVKQEVEVGIMCESCNGKGWLVCDFCGGQKTNVKAQNNRIYRRCPTCRAVSTPI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATPPVPVVASLAKVKLFSIMPSSSSSSRSRPSHSLKSKPALCAPVKQEVEVGIMCESCNGKGWLVCDFCGGQKTNVKAQNNRIYRRCPTCRAVSTPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
225429842101 PREDICTED: uncharacterized protein LOC10 0.734 0.712 0.620 8e-20
357466565117 hypothetical protein MTR_3g109170 [Medic 0.704 0.589 0.571 2e-15
297821739126 hypothetical protein ARALYDRAFT_481294 [ 0.744 0.579 0.540 4e-15
449442018112 PREDICTED: uncharacterized protein LOC10 0.551 0.482 0.690 5e-15
30682394132 chaperone protein dnaJ-related protein [ 0.581 0.431 0.588 9e-15
116782334116 unknown [Picea sitchensis] 0.765 0.646 0.545 2e-14
224121432121 predicted protein [Populus trichocarpa] 0.775 0.628 0.5 6e-14
351723979132 uncharacterized protein LOC100527416 [Gl 0.663 0.492 0.539 1e-12
168042224145 predicted protein [Physcomitrella patens 0.561 0.379 0.563 3e-12
218201473140 hypothetical protein OsI_29919 [Oryza sa 0.357 0.25 0.714 5e-08
>gi|225429842|ref|XP_002283165.1| PREDICTED: uncharacterized protein LOC100249288 isoform 1 [Vitis vinifera] gi|296081792|emb|CBI20797.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  100 bits (250), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 7/79 (8%)

Query: 20 IMPSSSSSSRSRPSHSLKSKPALCAPVKQ---EVEVGIMCESCNGKGWLVCDFCGGQKTN 76
          ++PSSSSS+          KP  CAP++Q   +++VGIMCE CNGKGWL+CDFC GQKTN
Sbjct: 1  MLPSSSSSTMGMRF----LKPPHCAPLQQIQEQIDVGIMCEPCNGKGWLLCDFCKGQKTN 56

Query: 77 VKAQNNRIYRRCPTCRAVS 95
          VKA+NNRIYRRCP+CRA+ 
Sbjct: 57 VKAENNRIYRRCPSCRAIG 75

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357466565|ref|XP_003603567.1| hypothetical protein MTR_3g109170 [Medicago truncatula] gi|355492615|gb|AES73818.1| hypothetical protein MTR_3g109170 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297821739|ref|XP_002878752.1| hypothetical protein ARALYDRAFT_481294 [Arabidopsis lyrata subsp. lyrata] gi|297324591|gb|EFH55011.1| hypothetical protein ARALYDRAFT_481294 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449442018|ref|XP_004138779.1| PREDICTED: uncharacterized protein LOC101209431 [Cucumis sativus] gi|449499504|ref|XP_004160834.1| PREDICTED: uncharacterized LOC101209431 [Cucumis sativus] Back     alignment and taxonomy information
>gi|30682394|ref|NP_850052.1| chaperone protein dnaJ-related protein [Arabidopsis thaliana] gi|44917527|gb|AAS49088.1| At2g24395 [Arabidopsis thaliana] gi|62321035|dbj|BAD94100.1| hypothetical protein [Arabidopsis thaliana] gi|330252477|gb|AEC07571.1| chaperone protein dnaJ-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|116782334|gb|ABK22469.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|224121432|ref|XP_002330826.1| predicted protein [Populus trichocarpa] gi|222872628|gb|EEF09759.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351723979|ref|NP_001235762.1| uncharacterized protein LOC100527416 [Glycine max] gi|255632296|gb|ACU16506.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|168042224|ref|XP_001773589.1| predicted protein [Physcomitrella patens subsp. patens] gi|162675128|gb|EDQ61627.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|218201473|gb|EEC83900.1| hypothetical protein OsI_29919 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
TAIR|locus:504955942132 AT2G24395 "AT2G24395" [Arabido 0.418 0.310 0.829 2e-17
TAIR|locus:504955942 AT2G24395 "AT2G24395" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 213 (80.0 bits), Expect = 2.0e-17, P = 2.0e-17
 Identities = 34/41 (82%), Positives = 39/41 (95%)

Query:    54 IMCESCNGKGWLVCDFCGGQKTNVKAQNNRIYRRCPTCRAV 94
             I+CE CNGKGWL+CDFC GQKTNVK++NNRIYRRCPTC+AV
Sbjct:    65 ILCEDCNGKGWLLCDFCKGQKTNVKSENNRIYRRCPTCKAV 105


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.324   0.135   0.444    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       98        79   0.00091  102 3  11 22  0.36    29
                                                     29  0.39    30


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  548 (58 KB)
  Total size of DFA:  110 KB (2073 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  7.30u 0.16s 7.46t   Elapsed:  00:00:00
  Total cpu time:  7.30u 0.16s 7.46t   Elapsed:  00:00:00
  Start:  Fri May 10 21:14:15 2013   End:  Fri May 10 21:14:15 2013
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 0.003
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 0.004
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information 
 Score = 34.6 bits (80), Expect = 0.003
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 13/66 (19%)

Query: 46  VKQEVEV--GIMCESCNGKGW------LVCDFCGGQKTNVKAQ-----NNRIYRRCPTCR 92
           V ++V V   ++C+ C+GKG       + CD CGG+      Q          R CPTCR
Sbjct: 130 VTKQVTVDTAVLCDRCHGKGTAGDSKPVTCDTCGGRGEVQTVQRSFLGQVMTSRPCPTCR 189

Query: 93  AVSTPI 98
            V   I
Sbjct: 190 GVGEVI 195

Length = 378
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 98.34
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 97.29
PLN03165111 chaperone protein dnaJ-related; Provisional 96.84
PRK10767 371 chaperone protein DnaJ; Provisional 96.55
PRK14300 372 chaperone protein DnaJ; Provisional 96.48
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 96.42
PRK14277 386 chaperone protein DnaJ; Provisional 96.4
PRK14282 369 chaperone protein DnaJ; Provisional 96.37
PRK14279 392 chaperone protein DnaJ; Provisional 96.37
PRK14298 377 chaperone protein DnaJ; Provisional 96.34
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 96.29
PRK14295 389 chaperone protein DnaJ; Provisional 96.29
PRK14288 369 chaperone protein DnaJ; Provisional 96.25
PRK14289 386 chaperone protein DnaJ; Provisional 96.21
PRK14285 365 chaperone protein DnaJ; Provisional 96.19
PRK14280 376 chaperone protein DnaJ; Provisional 96.16
PRK14293 374 chaperone protein DnaJ; Provisional 96.07
PRK14278 378 chaperone protein DnaJ; Provisional 96.07
PRK10767 371 chaperone protein DnaJ; Provisional 96.04
PRK14294 366 chaperone protein DnaJ; Provisional 96.04
PRK14281 397 chaperone protein DnaJ; Provisional 96.0
PRK14286 372 chaperone protein DnaJ; Provisional 95.97
PRK14285 365 chaperone protein DnaJ; Provisional 95.96
PRK14276 380 chaperone protein DnaJ; Provisional 95.94
PRK14286 372 chaperone protein DnaJ; Provisional 95.92
KOG2824281 consensus Glutaredoxin-related protein [Posttransl 95.9
PRK14283 378 chaperone protein DnaJ; Provisional 95.88
PRK14284 391 chaperone protein DnaJ; Provisional 95.84
PRK14284 391 chaperone protein DnaJ; Provisional 95.82
PRK14296 372 chaperone protein DnaJ; Provisional 95.82
PRK14294 366 chaperone protein DnaJ; Provisional 95.81
PRK14301 373 chaperone protein DnaJ; Provisional 95.78
PRK14300 372 chaperone protein DnaJ; Provisional 95.77
PRK14292 371 chaperone protein DnaJ; Provisional 95.74
PRK14290 365 chaperone protein DnaJ; Provisional 95.73
PRK14279 392 chaperone protein DnaJ; Provisional 95.71
PRK14301 373 chaperone protein DnaJ; Provisional 95.64
PRK14290 365 chaperone protein DnaJ; Provisional 95.58
PRK14297 380 chaperone protein DnaJ; Provisional 95.54
PRK14298 377 chaperone protein DnaJ; Provisional 95.52
PRK14295 389 chaperone protein DnaJ; Provisional 95.49
PRK14283 378 chaperone protein DnaJ; Provisional 95.45
PRK14291 382 chaperone protein DnaJ; Provisional 95.39
PRK14287 371 chaperone protein DnaJ; Provisional 95.23
PRK14296 372 chaperone protein DnaJ; Provisional 95.16
PRK14288 369 chaperone protein DnaJ; Provisional 95.15
PRK14287 371 chaperone protein DnaJ; Provisional 95.13
PRK14282 369 chaperone protein DnaJ; Provisional 95.11
PRK14291 382 chaperone protein DnaJ; Provisional 95.04
PRK14280 376 chaperone protein DnaJ; Provisional 95.03
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 95.03
PRK14276 380 chaperone protein DnaJ; Provisional 95.02
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 94.85
PRK14297 380 chaperone protein DnaJ; Provisional 94.84
PTZ00037 421 DnaJ_C chaperone protein; Provisional 94.68
PRK14277 386 chaperone protein DnaJ; Provisional 94.36
PTZ00037 421 DnaJ_C chaperone protein; Provisional 94.32
PRK14281 397 chaperone protein DnaJ; Provisional 94.23
PRK14278 378 chaperone protein DnaJ; Provisional 94.04
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 93.94
PRK14289 386 chaperone protein DnaJ; Provisional 93.82
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 93.71
PRK14293 374 chaperone protein DnaJ; Provisional 93.46
PF13901202 DUF4206: Domain of unknown function (DUF4206) 93.37
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 93.26
PRK0971064 lar restriction alleviation and modification prote 92.88
KOG2813 406 consensus Predicted molecular chaperone, contains 92.18
PRK14292 371 chaperone protein DnaJ; Provisional 90.66
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 89.21
PLN03165111 chaperone protein dnaJ-related; Provisional 88.69
PF1435461 Lar_restr_allev: Restriction alleviation protein L 88.62
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 87.94
KOG4218 475 consensus Nuclear hormone receptor betaFTZ-F1 [Tra 87.44
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 87.41
PRK00464 154 nrdR transcriptional regulator NrdR; Validated 86.87
PF1340858 Zn_ribbon_recom: Recombinase zinc beta ribbon doma 86.66
KOG2813 406 consensus Predicted molecular chaperone, contains 85.49
PF08996188 zf-DNA_Pol: DNA Polymerase alpha zinc finger; Inte 82.82
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 82.5
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information 
Probab=98.34  E-value=3.6e-07  Score=65.52  Aligned_cols=45  Identities=27%  Similarity=0.664  Sum_probs=40.2

Q ss_pred             ccccccCCCcceEEcccCCCcccceeccc--cceeccCCCccccccc
Q 034326           53 GIMCESCNGKGWLVCDFCGGQKTNVKAQN--NRIYRRCPTCRAVSTP   97 (98)
Q Consensus        53 gi~Ce~CnG~GWllCdfCkG~KtNVKse~--~RiYRRCPtCkAvG~i   97 (98)
                      +..|+.|.|.+|+.|+.|.|.+..+.++.  ....+|||.|-..|.|
T Consensus        99 ~~~C~~Cgg~rfv~C~~C~Gs~k~~~~~~~~~~~~~rC~~Cnengl~  145 (147)
T cd03031          99 GGVCEGCGGARFVPCSECNGSCKVFAENATAAGGFLRCPECNENGLV  145 (147)
T ss_pred             CCCCCCCCCcCeEECCCCCCcceEEeccCcccccEEECCCCCccccc
Confidence            45699999999999999999999998874  5678999999999976

This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive.
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>KOG4218 consensus Nuclear hormone receptor betaFTZ-F1 [Transcription] Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF13408 Zn_ribbon_recom: Recombinase zinc beta ribbon domain Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08996 zf-DNA_Pol: DNA Polymerase alpha zinc finger; InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 39.1 bits (90), Expect = 7e-05
 Identities = 18/87 (20%), Positives = 33/87 (37%), Gaps = 14/87 (16%)

Query: 16  KLFSIMPSSSSSSRSRPSHSLKSKPALCAPVKQEVEVGI--M--CESCNGKGWLVCDFCG 71
           +L++     +  + SR    LK + AL   ++    V I  +       GK W+  D C 
Sbjct: 118 RLYNDNQVFAKYNVSRLQPYLKLRQALLE-LRPAKNVLIDGVLGS----GKTWVALDVCL 172

Query: 72  GQKTNVKAQNNRIY----RRCPTCRAV 94
             K      + +I+    + C +   V
Sbjct: 173 SYKV-QCKMDFKIFWLNLKNCNSPETV 198

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.5
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 97.25
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.08
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 97.06
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 96.23
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 95.97
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 94.76
1k81_A36 EIF-2-beta, probable translation initiation factor 90.72
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 90.7
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 89.45
2d74_B148 Translation initiation factor 2 beta subunit; prot 82.8
3cw2_K139 Translation initiation factor 2 subunit beta; AIF2 80.59
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
Probab=97.50  E-value=6.4e-05  Score=45.59  Aligned_cols=12  Identities=17%  Similarity=0.515  Sum_probs=6.5

Q ss_pred             ccCCCccccccc
Q 034326           86 RRCPTCRAVSTP   97 (98)
Q Consensus        86 RRCPtCkAvG~i   97 (98)
                      .+|++|.+.|++
T Consensus        65 ~~C~~C~G~G~~   76 (79)
T 1exk_A           65 DPCNKCHGHGRV   76 (79)
T ss_dssp             SBCGGGTTSSEE
T ss_pred             CcCCCCCCeEEE
Confidence            356666555543
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2d74_B Translation initiation factor 2 beta subunit; protein complex; 2.80A {Pyrococcus furiosus} PDB: 2dcu_B* Back     alignment and structure
>3cw2_K Translation initiation factor 2 subunit beta; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2nxu_A 2qmu_C* 3v11_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 97.21
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 97.14
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 96.89
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 96.85
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: DnaJ/Hsp40 cysteine-rich domain
superfamily: DnaJ/Hsp40 cysteine-rich domain
family: DnaJ/Hsp40 cysteine-rich domain
domain: Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.21  E-value=7.2e-05  Score=45.15  Aligned_cols=11  Identities=27%  Similarity=0.827  Sum_probs=5.4

Q ss_pred             cCCCccccccc
Q 034326           87 RCPTCRAVSTP   97 (98)
Q Consensus        87 RCPtCkAvG~i   97 (98)
                      +|+.|++.|+|
T Consensus        62 ~C~~C~G~g~v   72 (74)
T d1nlta3          62 RCKSCNGKKVE   72 (74)
T ss_dssp             BCSSSTTSCEE
T ss_pred             CCCCCCCeeEe
Confidence            35555555543
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure