Score = 89 (36.4 bits), Expect = 0.00089, P = 0.00089
Identities = 19/63 (30%), Positives = 32/63 (50%)
Query: 4 LTKWVPTPIAVIISAAVFALAHLTPGEFPQLFVLGIALGFSYAQTRNLLTPITIHAFWNS 63
L K++ + +S+ +F H P F L + G L + Y +T +L+P HA WN
Sbjct: 158 LKKYMGVVGGIAVSSLLFGAMHFDPYRFLPLSLGGAILAYLYEKTGTILSPFVAHATWN- 216
Query: 64 GVI 66
G++
Sbjct: 217 GIM 219
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.327 0.139 0.420 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 87 87 0.00091 102 3 11 22 0.38 29
29 0.48 30
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 8
No. of states in DFA: 522 (56 KB)
Total size of DFA: 101 KB (2071 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 8.75u 0.08s 8.83t Elapsed: 00:00:22
Total cpu time: 8.75u 0.08s 8.83t Elapsed: 00:00:22
Start: Thu May 9 23:01:16 2013 End: Thu May 9 23:01:38 2013
Score = 47.6 bits (114), Expect = 8e-09
Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 2/61 (3%)
Query: 4 LTKWVPTPIAVIISAAVFALAHL--TPGEFPQLFVLGIALGFSYAQTRNLLTPITIHAFW 61
L K +A++IS+ +F L HL P F F+LG+ LG+ Y +T +L I +HA
Sbjct: 31 LRKRFWPLLAILISSLLFGLLHLPNGPLAFLSAFLLGLVLGWLYLRTGSLWAAILLHALN 90
Query: 62 N 62
N
Sbjct: 91 N 91
Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity. Length = 93
>PF02517 Abi: CAAX protease self-immunity; InterPro: IPR003675 Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide is removed by one of the CAAX prenyl proteases)
The family contains the Q03530 from SWISSPROT CAAX prenyl protease []. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding []. While these proteins are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity []. This family also includes lysostaphin resistance protein A [].; GO: 0016020 membrane
>COG1266 Predicted metal-dependent membrane protease [General function prediction only]
The CAAX prenyl protease, in eukaryotes, catalyzes three covalent modifications, including cleavage and acylation, at the C-terminus of certain proteins in a process connected to protein sorting. This family describes a bacterial protein family homologous to one domain of the CAAX-processing enzyme. Members of this protein family are found in genomes that carry a predicted protein sorting system, PEP-CTERM/exosortase, usually in the vicinity of the EpsH homolog that is the hallmark of the system. The function of this protein is unknown, but it may relate to protein motification.
>KOG4130 consensus Prenyl protein protease [Posttranslational modification, protein turnover, chaperones]
>PF05437 AzlD: Branched-chain amino acid transport protein (AzlD); InterPro: IPR008407 This family consists of a number of bacterial and archaeal branched-chain amino acid transport proteins
AzlD, a member of this group, has been shown by mutational analysis to be involved in branched-chain amino acid transport, and to be involved in conferring resistance to 4-azaleucine []. However, its exact role in these processes is not yet clear []. Based on its hydropathy profile, it has been suggested to be a membrane protein [].
