Citrus Sinensis ID: 034668
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
No hits with e-value below 0.001 by BLAST
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
No hits with e-value below 0.001 by BLAST
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
No hits with e-value below 0.001 by BLAST
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
No confident hit detected by STRING
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 87 | |||
| KOG0004 | 156 | consensus Ubiquitin/40S ribosomal protein S27a fus | 99.67 | |
| COG5272 | 57 | UBI4 Ubiquitin [Posttranslational modification, pr | 94.25 | |
| PRK00432 | 50 | 30S ribosomal protein S27ae; Validated | 90.48 |
| >KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=99.67 E-value=1.8e-17 Score=121.69 Aligned_cols=49 Identities=37% Similarity=0.491 Sum_probs=47.5
Q ss_pred cceEEEecCCCcccccccCcCCCcccccccceeeeeeeeeEEeCCCCCC
Q 034668 39 FSHVKLNFPNSVYSCLNHYQGVSAAITSKKKKVKLVVLQFYKVDDSGKV 87 (87)
Q Consensus 39 ~~HlvLrlrg~~kkrkkK~YTTPKKiKHKhKKVKLAVLkyYKVDenGKV 87 (87)
--||+|||+||+++|||++|++||+++|+|+|++|++++||+||+||+|
T Consensus 66 tl~l~l~l~Gg~kkrkkk~~~~pk~~~~~~kk~~l~~~~y~kvd~ngki 114 (156)
T KOG0004|consen 66 TLHLVLRLRGGAKKRKKKSYTTPKKIKSKHKKVSLAVLKYYKVDENGKV 114 (156)
T ss_pred eEEEEEEecCCcccccccccccccccCCCccccccCCccceeeccCcch
Confidence 4699999999999999999999999999999999999999999999986
|
|
| >COG5272 UBI4 Ubiquitin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00432 30S ribosomal protein S27ae; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 87 | |||
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 99.86 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 99.69 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 96.63 |
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
Probab=99.86 E-value=4.6e-23 Score=143.52 Aligned_cols=51 Identities=22% Similarity=0.221 Sum_probs=32.4
Q ss_pred hccceEEEecCCCcccccccCcCCCcccccccceeeeeeeeeEEeCCCCCC
Q 034668 37 TQFSHVKLNFPNSVYSCLNHYQGVSAAITSKKKKVKLVVLQFYKVDDSGKV 87 (87)
Q Consensus 37 ~~~~HlvLrlrg~~kkrkkK~YTTPKKiKHKhKKVKLAVLkyYKVDenGKV 87 (87)
...-||++|++||+||||||+||||||+||+|||||||||+||+||+||||
T Consensus 64 gstL~Lvlrl~GGgKkrkKk~~t~Pkk~~~~~~~~~~~~~~~~~~~~~~~~ 114 (152)
T 3u5c_f 64 ESTLHLVLRLRGGGKKRKXXXXXXXXXXXXXXXXXXXXVLSYYKVDAEGKV 114 (152)
T ss_dssp ------------------CCCCCCCSCCCCCCCCCCCCCCCCSEECSSSCE
T ss_pred CCEEEEEeeccCCCcCcccccccccccccccccccccceeeEEEEccCCeE
Confidence 446799999999999999999999999999999999999999999999986
|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00