Citrus Sinensis ID: 034916
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 79 | ||||||
| 255541566 | 61 | conserved hypothetical protein [Ricinus | 0.772 | 1.0 | 0.901 | 7e-25 | |
| 224127652 | 61 | predicted protein [Populus trichocarpa] | 0.759 | 0.983 | 0.883 | 7e-24 | |
| 334186244 | 71 | uncharacterized protein [Arabidopsis tha | 0.873 | 0.971 | 0.774 | 9e-24 | |
| 297810127 | 71 | hypothetical protein ARALYDRAFT_327720 [ | 0.898 | 1.0 | 0.723 | 2e-23 | |
| 225454192 | 80 | PREDICTED: uncharacterized protein LOC10 | 0.759 | 0.75 | 0.85 | 1e-21 | |
| 297745269 | 64 | unnamed protein product [Vitis vinifera] | 0.759 | 0.937 | 0.85 | 1e-21 | |
| 388501504 | 79 | unknown [Medicago truncatula] | 0.962 | 0.962 | 0.658 | 5e-21 | |
| 356568382 | 74 | PREDICTED: uncharacterized protein LOC10 | 0.936 | 1.0 | 0.658 | 7e-21 | |
| 356504525 | 79 | PREDICTED: uncharacterized protein LOC10 | 0.962 | 0.962 | 0.645 | 2e-20 | |
| 356522628 | 72 | PREDICTED: uncharacterized protein LOC10 | 0.911 | 1.0 | 0.643 | 4e-19 |
| >gi|255541566|ref|XP_002511847.1| conserved hypothetical protein [Ricinus communis] gi|223549027|gb|EEF50516.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 117 bits (294), Expect = 7e-25, Method: Compositional matrix adjust.
Identities = 55/61 (90%), Positives = 60/61 (98%)
Query: 1 MNPQTDKIVRRTTMVATAVASYFLLTADYGPEPNALDPIKKAILSAESSVKEFIFGSKKE 60
MNP+TDKIVRRTTMVATAVASYFLLTADYGP+PNA+DP+KKAILSAE+SVKEFIFGSKK
Sbjct: 1 MNPKTDKIVRRTTMVATAVASYFLLTADYGPQPNAVDPVKKAILSAENSVKEFIFGSKKG 60
Query: 61 P 61
P
Sbjct: 61 P 61
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224127652|ref|XP_002320127.1| predicted protein [Populus trichocarpa] gi|222860900|gb|EEE98442.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|334186244|ref|NP_191962.2| uncharacterized protein [Arabidopsis thaliana] gi|49617787|gb|AAT67589.1| hypothetical protein At4G00530 [Arabidopsis thaliana] gi|60547841|gb|AAX23884.1| hypothetical protein At4g00530 [Arabidopsis thaliana] gi|332656495|gb|AEE81895.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297810127|ref|XP_002872947.1| hypothetical protein ARALYDRAFT_327720 [Arabidopsis lyrata subsp. lyrata] gi|297318784|gb|EFH49206.1| hypothetical protein ARALYDRAFT_327720 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225454192|ref|XP_002272715.1| PREDICTED: uncharacterized protein LOC100267043 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297745269|emb|CBI40349.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388501504|gb|AFK38818.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356568382|ref|XP_003552390.1| PREDICTED: uncharacterized protein LOC100804482 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356504525|ref|XP_003521046.1| PREDICTED: uncharacterized protein LOC100306571 [Glycine max] gi|255628915|gb|ACU14802.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356522628|ref|XP_003529948.1| PREDICTED: uncharacterized protein LOC100787462 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 79 | ||||||
| TAIR|locus:505006092 | 62 | AT1G01725 "AT1G01725" [Arabido | 0.784 | 1.0 | 0.725 | 1.5e-19 |
| TAIR|locus:505006092 AT1G01725 "AT1G01725" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 233 (87.1 bits), Expect = 1.5e-19, P = 1.5e-19
Identities = 45/62 (72%), Positives = 54/62 (87%)
Query: 1 MNPQTDKIVRRTTMVATAVASYFLLTADYGPEPNALDPIKKAILSAESSVKEFIFGSKKE 60
MNPQ +K+V+ T++VATAV SYFLLTADYGPEPNALDPI++ ILSA+ SVKEFIF SKK
Sbjct: 1 MNPQIEKVVKVTSVVATAVVSYFLLTADYGPEPNALDPIRQRILSAQDSVKEFIFPSKKS 60
Query: 61 PR 62
+
Sbjct: 61 DK 62
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.308 0.123 0.330 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 79 79 0.00091 102 3 11 23 0.47 29
29 0.39 30
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 423 (45 KB)
Total size of DFA: 74 KB (2063 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 10.21u 0.08s 10.29t Elapsed: 00:00:01
Total cpu time: 10.21u 0.08s 10.29t Elapsed: 00:00:01
Start: Fri May 10 03:32:44 2013 End: Fri May 10 03:32:45 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00140286 | hypothetical protein (62 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
No hit with probability above 80.00
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00