Citrus Sinensis ID: 034996
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 76 | ||||||
| 225443878 | 85 | PREDICTED: uncharacterized protein LOC10 | 0.921 | 0.823 | 0.648 | 3e-19 | |
| 224116100 | 59 | predicted protein [Populus trichocarpa] | 0.75 | 0.966 | 0.783 | 1e-17 | |
| 449433730 | 86 | PREDICTED: uncharacterized protein LOC10 | 0.789 | 0.697 | 0.721 | 6e-17 | |
| 255557281 | 75 | conserved hypothetical protein [Ricinus | 0.736 | 0.746 | 0.758 | 1e-16 | |
| 357447267 | 70 | hypothetical protein MTR_2g019240 [Medic | 0.907 | 0.985 | 0.633 | 5e-16 | |
| 116790805 | 77 | unknown [Picea sitchensis] gi|148910510| | 0.894 | 0.883 | 0.573 | 2e-14 | |
| 18403595 | 81 | uncharacterized protein [Arabidopsis tha | 0.947 | 0.888 | 0.613 | 5e-14 | |
| 297826925 | 81 | hypothetical protein ARALYDRAFT_902544 [ | 0.947 | 0.888 | 0.6 | 2e-13 | |
| 242042974 | 85 | hypothetical protein SORBIDRAFT_02g00325 | 0.631 | 0.564 | 0.687 | 2e-12 | |
| 357111592 | 83 | PREDICTED: uncharacterized protein LOC10 | 0.618 | 0.566 | 0.702 | 3e-12 |
| >gi|225443878|ref|XP_002277427.1| PREDICTED: uncharacterized protein LOC100243015 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 99.4 bits (246), Expect = 3e-19, Method: Compositional matrix adjust.
Identities = 48/74 (64%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
Query: 1 MAAITVAIIAIAGVVLGWIAIEMACKPCLEKGREAIDQSLNPDYDPDGDADTNIRAPLYP 60
M +T A+IAIAGVVLGWI IE+ACKPCLE+GR+AID+SLNPDYDPD D + +IRAPL P
Sbjct: 1 MGGLTSAVIAIAGVVLGWITIEIACKPCLEQGRQAIDRSLNPDYDPDDDQNVDIRAPLNP 60
Query: 61 HHPAAAPSPSPSDP 74
++ P SDP
Sbjct: 61 ----SSSLPQDSDP 70
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224116100|ref|XP_002331997.1| predicted protein [Populus trichocarpa] gi|118481900|gb|ABK92885.1| unknown [Populus trichocarpa] gi|222874765|gb|EEF11896.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449433730|ref|XP_004134650.1| PREDICTED: uncharacterized protein LOC101212042 [Cucumis sativus] gi|449519468|ref|XP_004166757.1| PREDICTED: uncharacterized protein LOC101224807 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255557281|ref|XP_002519671.1| conserved hypothetical protein [Ricinus communis] gi|223541088|gb|EEF42644.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357447267|ref|XP_003593909.1| hypothetical protein MTR_2g019240 [Medicago truncatula] gi|355482957|gb|AES64160.1| hypothetical protein MTR_2g019240 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|116790805|gb|ABK25746.1| unknown [Picea sitchensis] gi|148910510|gb|ABR18330.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|18403595|ref|NP_565793.1| uncharacterized protein [Arabidopsis thaliana] gi|20197084|gb|AAM14909.1| Expressed protein [Arabidopsis thaliana] gi|21554021|gb|AAM63102.1| unknown [Arabidopsis thaliana] gi|51968766|dbj|BAD43075.1| hypothetical protein [Arabidopsis thaliana] gi|51970512|dbj|BAD43948.1| hypothetical protein [Arabidopsis thaliana] gi|51970622|dbj|BAD44003.1| hypothetical protein [Arabidopsis thaliana] gi|51971725|dbj|BAD44527.1| hypothetical protein [Arabidopsis thaliana] gi|51971883|dbj|BAD44606.1| hypothetical protein [Arabidopsis thaliana] gi|51971887|dbj|BAD44608.1| hypothetical protein [Arabidopsis thaliana] gi|88010859|gb|ABD38864.1| At2g34585 [Arabidopsis thaliana] gi|330253901|gb|AEC08995.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297826925|ref|XP_002881345.1| hypothetical protein ARALYDRAFT_902544 [Arabidopsis lyrata subsp. lyrata] gi|297327184|gb|EFH57604.1| hypothetical protein ARALYDRAFT_902544 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|242042974|ref|XP_002459358.1| hypothetical protein SORBIDRAFT_02g003250 [Sorghum bicolor] gi|241922735|gb|EER95879.1| hypothetical protein SORBIDRAFT_02g003250 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|357111592|ref|XP_003557596.1| PREDICTED: uncharacterized protein LOC100843802 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 76 | ||||||
| TAIR|locus:505006290 | 81 | AT2G34585 "AT2G34585" [Arabido | 0.421 | 0.395 | 0.757 | 1.8e-09 |
| TAIR|locus:505006290 AT2G34585 "AT2G34585" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 138 (53.6 bits), Expect = 1.8e-09, P = 1.8e-09
Identities = 25/33 (75%), Positives = 29/33 (87%)
Query: 22 EMACKPCLEKGREAIDQSLNPDYDPDG-DADTN 53
E+ACKPCLE GREAID+SLNPDYDPD D D++
Sbjct: 22 ELACKPCLESGREAIDRSLNPDYDPDDQDVDSS 54
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.314 0.136 0.415 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 76 36 0.00091 102 3 11 23 0.35 26
29 0.47 22
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 381 (41 KB)
Total size of DFA: 63 KB (2060 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 7.09u 0.10s 7.19t Elapsed: 00:00:01
Total cpu time: 7.09u 0.10s 7.19t Elapsed: 00:00:01
Start: Fri May 10 04:30:34 2013 End: Fri May 10 04:30:35 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00028308001 | SubName- Full=Chromosome chr10 scaffold_43, whole genome shotgun sequence; (85 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
No hit with probability above 80.00
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00