Citrus Sinensis ID: 035510

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
HAEVVLKGTNVDGVYDCHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQVGTFIDRTGRMS
cccEEEEcccccEEccccccccccccccccHHHHHHccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHcccccEEEEccccccc
ccEEEEEEEcccccEcccccccccEHccccHHHHHHccccEHHHHHHHHHHHccccEEEEEccccccHHHHEccccccEEEccccEcc
HAEVVLkgtnvdgvydchsrdnnatfehisfrelgsrgaipmdstalsfcdensipVVVFNllepgniskaicgdqvgtfidrtgrms
haevvlkgtnvdgvydcHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPgniskaicgdqvgtfidrtgrms
HAEVVLKGTNVDGVYDCHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQVGTFIDRTGRMS
****VLKGTNVDGVYDCHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQVGTFID******
HAEVVLKGTNVDGVYDCHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQVGTFID******
HAEVVLKGTNVDGVYDCHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQVGTFIDRTGRMS
HAEVVLKGTNVDGVYDCHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQVGTFIDRT****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HAEVVLKGTNVDGVYDCHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQVGTFIDRTGRMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
A5UUV0243 Uridylate kinase OS=Rosei yes no 0.920 0.333 0.5 3e-16
Q7VD61237 Uridylate kinase OS=Proch yes no 0.965 0.358 0.413 4e-16
Q47S51252 Uridylate kinase OS=Therm yes no 0.909 0.317 0.463 8e-16
Q0I8L5235 Uridylate kinase OS=Synec yes no 0.909 0.340 0.463 4e-15
Q46GQ4237 Uridylate kinase OS=Proch yes no 0.863 0.320 0.454 8e-15
A2C0Y1237 Uridylate kinase OS=Proch yes no 0.863 0.320 0.454 8e-15
Q0AYK2238 Uridylate kinase OS=Syntr yes no 0.943 0.348 0.447 1e-14
Q2JS42254 Uridylate kinase OS=Synec yes no 0.943 0.326 0.411 1e-14
Q10Y48244 Uridylate kinase OS=Trich yes no 0.920 0.331 0.445 1e-14
A3DE57235 Uridylate kinase OS=Clost yes no 0.909 0.340 0.463 1e-14
>sp|A5UUV0|PYRH_ROSS1 Uridylate kinase OS=Roseiflexus sp. (strain RS-1) GN=pyrH PE=3 SV=2 Back     alignment and function desciption
 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (66%), Gaps = 3/84 (3%)

Query: 1   HAEVVLKGTN-VDGVYDCHSR--DNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPV 57
           HAEV+L   N VDGVY    R   +   FE+IS+ E  SRG   MDSTAL+FC +N+IP+
Sbjct: 154 HAEVILMAKNGVDGVYSADPRRYPDAKRFEYISYMEALSRGLTVMDSTALTFCMDNNIPI 213

Query: 58  VVFNLLEPGNISKAICGDQVGTFI 81
           +VF+ L PGNI + + G+ VGT +
Sbjct: 214 IVFDPLTPGNIERIVMGEHVGTLV 237
Catalyzes the reversible phosphorylation of UMP to UDP.
Roseiflexus sp. (strain RS-1) (taxid: 357808)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 2EC: 2
>sp|Q7VD61|PYRH_PROMA Uridylate kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q47S51|PYRH_THEFY Uridylate kinase OS=Thermobifida fusca (strain YX) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q0I8L5|PYRH_SYNS3 Uridylate kinase OS=Synechococcus sp. (strain CC9311) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q46GQ4|PYRH_PROMT Uridylate kinase OS=Prochlorococcus marinus (strain NATL2A) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|A2C0Y1|PYRH_PROM1 Uridylate kinase OS=Prochlorococcus marinus (strain NATL1A) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q0AYK2|PYRH_SYNWW Uridylate kinase OS=Syntrophomonas wolfei subsp. wolfei (strain Goettingen) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q2JS42|PYRH_SYNJA Uridylate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q10Y48|PYRH_TRIEI Uridylate kinase OS=Trichodesmium erythraeum (strain IMS101) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|A3DE57|PYRH_CLOTH Uridylate kinase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=pyrH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
294987231105 uridylate monophosphate kinase [Cucumis 1.0 0.838 0.795 2e-35
449440463 538 PREDICTED: uncharacterized protein LOC10 1.0 0.163 0.795 2e-35
356533447 497 PREDICTED: uncharacterized protein LOC10 1.0 0.177 0.795 3e-35
356548307 487 PREDICTED: uncharacterized protein LOC10 1.0 0.180 0.795 3e-35
297740040 368 unnamed protein product [Vitis vinifera] 1.0 0.239 0.761 9e-34
255575477 539 transcription factor, putative [Ricinus 0.988 0.161 0.781 1e-33
357440229 512 Uridylate kinase [Medicago truncatula] g 1.0 0.171 0.761 2e-33
225441042 574 PREDICTED: uncharacterized protein LOC10 1.0 0.153 0.761 2e-33
224068943 211 predicted protein [Populus trichocarpa] 0.954 0.398 0.797 7e-33
18398728 542 aspartate/glutamate/uridylate kinase-lik 0.977 0.158 0.732 7e-32
>gi|294987231|gb|ADF56050.1| uridylate monophosphate kinase [Cucumis sativus] Back     alignment and taxonomy information
 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/88 (79%), Positives = 81/88 (92%)

Query: 1   HAEVVLKGTNVDGVYDCHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVF 60
           HAE VLKGTNVDGVYDC+S+DNN TF+HISFREL SRGAI MD TAL+FC+EN++PVVVF
Sbjct: 18  HAEAVLKGTNVDGVYDCNSQDNNFTFKHISFRELVSRGAISMDMTALTFCEENNLPVVVF 77

Query: 61  NLLEPGNISKAICGDQVGTFIDRTGRMS 88
           NLLEPGNISKA+CG+QVGT ID+ GR+S
Sbjct: 78  NLLEPGNISKALCGEQVGTLIDQNGRIS 105

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449440463|ref|XP_004138004.1| PREDICTED: uncharacterized protein LOC101222460 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356533447|ref|XP_003535275.1| PREDICTED: uncharacterized protein LOC100805176 [Glycine max] Back     alignment and taxonomy information
>gi|356548307|ref|XP_003542544.1| PREDICTED: uncharacterized protein LOC100805459 [Glycine max] Back     alignment and taxonomy information
>gi|297740040|emb|CBI30222.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255575477|ref|XP_002528640.1| transcription factor, putative [Ricinus communis] gi|223531929|gb|EEF33743.1| transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357440229|ref|XP_003590392.1| Uridylate kinase [Medicago truncatula] gi|140052428|gb|ABE80123.2| Homeodomain-like; Uridylate kinase [Medicago truncatula] gi|355479440|gb|AES60643.1| Uridylate kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|225441042|ref|XP_002277826.1| PREDICTED: uncharacterized protein LOC100264768 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224068943|ref|XP_002326237.1| predicted protein [Populus trichocarpa] gi|222833430|gb|EEE71907.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18398728|ref|NP_566366.1| aspartate/glutamate/uridylate kinase-like protein [Arabidopsis thaliana] gi|14030681|gb|AAK53015.1|AF375431_1 AT3g10030/T22K18_15 [Arabidopsis thaliana] gi|21464551|gb|AAM52230.1| AT3g10030/T22K18_15 [Arabidopsis thaliana] gi|332641330|gb|AEE74851.1| aspartate/glutamate/uridylate kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
TAIR|locus:2100108542 AT3G10030 [Arabidopsis thalian 0.977 0.158 0.732 1.6e-31
TAIR|locus:2093949339 AT3G18680 [Arabidopsis thalian 0.954 0.247 0.546 4.3e-18
TIGR_CMR|CHY_1785242 CHY_1785 "uridylate kinase" [C 0.909 0.330 0.475 2.3e-14
TIGR_CMR|GSU_1919239 GSU_1919 "uridylate kinase" [G 0.909 0.334 0.402 3.8e-14
TIGR_CMR|BA_3963240 BA_3963 "uridylate kinase" [Ba 0.909 0.333 0.421 2.4e-12
UNIPROTKB|P65929261 pyrH "Uridylate kinase" [Mycob 0.909 0.306 0.414 5.5e-11
TIGR_CMR|ECH_0266244 ECH_0266 "uridylate kinase" [E 0.897 0.323 0.407 4.5e-10
TIGR_CMR|CBU_1384243 CBU_1384 "uridylate kinase" [C 0.943 0.341 0.364 9.9e-10
TIGR_CMR|SO_1631242 SO_1631 "uridylate kinase" [Sh 0.909 0.330 0.353 2.2e-09
TIGR_CMR|DET_0375241 DET_0375 "uridylate kinase" [D 0.909 0.331 0.385 3.7e-09
TAIR|locus:2100108 AT3G10030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 349 (127.9 bits), Expect = 1.6e-31, P = 1.6e-31
 Identities = 63/86 (73%), Positives = 76/86 (88%)

Query:     1 HAEVVLKGTNVDGVYDCHSRDNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVF 60
             +AE V+KGTNVDGVYDCHS+D+N TFEHISF++L SRG   MD+ AL+FC+ENSIPVVVF
Sbjct:   454 NAEAVVKGTNVDGVYDCHSQDSNVTFEHISFQDLASRGLTSMDTMALNFCEENSIPVVVF 513

Query:    61 NLLEPGNISKAICGDQVGTFIDRTGR 86
             N LE GNI+KA+CG+QVGT IDR+GR
Sbjct:   514 NFLEAGNITKALCGEQVGTLIDRSGR 539
GO:0003677 "DNA binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA;ISS
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:2093949 AT3G18680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1785 CHY_1785 "uridylate kinase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1919 GSU_1919 "uridylate kinase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3963 BA_3963 "uridylate kinase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P65929 pyrH "Uridylate kinase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0266 ECH_0266 "uridylate kinase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1384 CBU_1384 "uridylate kinase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1631 SO_1631 "uridylate kinase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0375 DET_0375 "uridylate kinase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
cd04254231 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, t 5e-33
cd04239229 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase 1e-30
PRK00358231 PRK00358, pyrH, uridylate kinase; Provisional 5e-30
TIGR02075232 TIGR02075, pyrH_bact, uridylate kinase 3e-23
COG0528238 COG0528, PyrH, Uridylate kinase [Nucleotide transp 2e-22
PRK14558231 PRK14558, pyrH, uridylate kinase; Provisional 6e-17
cd04253221 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP k 1e-10
PRK14556249 PRK14556, pyrH, uridylate kinase; Provisional 9e-09
TIGR02076221 TIGR02076, pyrH_arch, uridylate kinase, putative 2e-08
pfam00696230 pfam00696, AA_kinase, Amino acid kinase family 5e-08
PRK14557247 PRK14557, pyrH, uridylate kinase; Provisional 2e-06
cd02115248 cd02115, AAK, Amino Acid Kinases (AAK) superfamily 4e-06
COG1608252 COG1608, COG1608, Predicted archaeal kinase [Gener 3e-05
cd04241252 cd04241, AAK_FomA-like, AAK_FomA-like: This CD inc 2e-04
cd04256284 cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate 2e-04
cd04255262 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD i 5e-04
>gnl|CDD|239787 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information 
 Score =  113 bits (285), Expect = 5e-33
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 2/83 (2%)

Query: 2   AEVVLKGTNVDGVYDCHSRDN-NAT-FEHISFRELGSRGAIPMDSTALSFCDENSIPVVV 59
           A+V+LK T VDGVYD   + N NA  ++H+++ E+ S+G   MD+TA + C +N++P+VV
Sbjct: 149 ADVILKATKVDGVYDADPKKNPNAKRYDHLTYDEVLSKGLKVMDATAFTLCRDNNLPIVV 208

Query: 60  FNLLEPGNISKAICGDQVGTFID 82
           FN+ EPGN+ KA+ G+ VGT I 
Sbjct: 209 FNINEPGNLLKAVKGEGVGTLIS 231

The UMP kinase of E. coli (Ec) is known to function as a homohexamer, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial and chloroplast UMPKs (this CD) have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK). Length = 231
>gnl|CDD|239772 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>gnl|CDD|234735 PRK00358, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|213681 TIGR02075, pyrH_bact, uridylate kinase Back     alignment and domain information
>gnl|CDD|223602 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|173023 PRK14558, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239786 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>gnl|CDD|173021 PRK14556, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|233711 TIGR02076, pyrH_arch, uridylate kinase, putative Back     alignment and domain information
>gnl|CDD|216067 pfam00696, AA_kinase, Amino acid kinase family Back     alignment and domain information
>gnl|CDD|173022 PRK14557, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239033 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>gnl|CDD|224524 COG1608, COG1608, Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|239774 cd04241, AAK_FomA-like, AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>gnl|CDD|239789 cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>gnl|CDD|239788 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
COG0528238 PyrH Uridylate kinase [Nucleotide transport and me 99.92
PRK14558231 pyrH uridylate kinase; Provisional 99.91
PRK14556249 pyrH uridylate kinase; Provisional 99.9
PRK00358231 pyrH uridylate kinase; Provisional 99.9
PRK14557247 pyrH uridylate kinase; Provisional 99.9
cd04254231 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi 99.88
TIGR02075233 pyrH_bact uridylate kinase. This protein, also cal 99.87
cd04239229 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik 99.86
cd04253221 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP 99.86
COG0263 369 ProB Glutamate 5-kinase [Amino acid transport and 99.86
TIGR02076221 pyrH_arch uridylate kinase, putative. This family 99.84
PRK12314266 gamma-glutamyl kinase; Provisional 99.84
PRK13402 368 gamma-glutamyl kinase; Provisional 99.83
cd04242251 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K 99.82
cd04256284 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase 99.82
TIGR01027 363 proB glutamate 5-kinase. Bacterial ProB proteins h 99.8
PRK05429 372 gamma-glutamyl kinase; Provisional 99.8
PTZ00489264 glutamate 5-kinase; Provisional 99.8
cd02115248 AAK Amino Acid Kinases (AAK) superfamily, catalyti 99.77
cd04245288 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Ki 99.76
cd04234227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) 99.74
COG0527 447 LysC Aspartokinases [Amino acid transport and meta 99.74
cd04246239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina 99.74
cd04255262 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th 99.73
cd04261239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina 99.73
cd04257294 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa 99.73
cd04241252 AAK_FomA-like AAK_FomA-like: This CD includes a fo 99.72
TIGR01092 715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.72
cd04259295 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super 99.72
cd04243293 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina 99.72
cd04247306 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfa 99.72
COG1608252 Predicted archaeal kinase [General function predic 99.71
cd04244298 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina 99.71
PLN02418 718 delta-1-pyrroline-5-carboxylate synthase 99.71
PRK09034 454 aspartate kinase; Reviewed 99.7
PRK08841 392 aspartate kinase; Validated 99.69
cd04258292 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Ki 99.69
PRK05925 440 aspartate kinase; Provisional 99.69
TIGR00656 401 asp_kin_monofn aspartate kinase, monofunctional cl 99.68
PRK09084 448 aspartate kinase III; Validated 99.67
cd04260244 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase 99.67
PRK06291 465 aspartate kinase; Provisional 99.67
PLN02551 521 aspartokinase 99.67
KOG1154285 consensus Gamma-glutamyl kinase [Amino acid transp 99.66
cd04240203 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin 99.66
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 99.65
PRK08210 403 aspartate kinase I; Reviewed 99.65
TIGR02078327 AspKin_pair Pyrococcus aspartate kinase subunit, p 99.65
PRK07431 587 aspartate kinase; Provisional 99.65
TIGR00657 441 asp_kinases aspartate kinase. The Lys-sensitive en 99.64
COG2054212 Uncharacterized archaeal kinase related to asparto 99.61
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 99.61
PRK06635 404 aspartate kinase; Reviewed 99.6
PRK12353314 putative amino acid kinase; Reviewed 99.6
PRK14058268 acetylglutamate/acetylaminoadipate kinase; Provisi 99.6
PRK08373341 aspartate kinase; Validated 99.59
PRK08961 861 bifunctional aspartate kinase/diaminopimelate deca 99.58
TIGR00746310 arcC carbamate kinase. The seed alignment for this 99.54
PRK09181 475 aspartate kinase; Validated 99.54
cd04250279 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase 99.52
cd04235308 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot 99.5
cd04248304 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase S 99.5
PRK00942283 acetylglutamate kinase; Provisional 99.47
PRK12686312 carbamate kinase; Reviewed 99.45
PF00696242 AA_kinase: Amino acid kinase family Match to Gluta 99.44
PLN02512309 acetylglutamate kinase 99.43
cd04238256 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate 99.42
cd04249252 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina 99.42
PRK12354307 carbamate kinase; Reviewed 99.4
PRK12454313 carbamate kinase-like carbamoyl phosphate syntheta 99.39
CHL00202284 argB acetylglutamate kinase; Provisional 99.36
PRK09411297 carbamate kinase; Reviewed 99.3
cd04251257 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina 99.26
PRK12352316 putative carbamate kinase; Reviewed 99.26
KOG0456 559 consensus Aspartate kinase [Amino acid transport a 99.12
COG0548265 ArgB Acetylglutamate kinase [Amino acid transport 99.09
PRK05279 441 N-acetylglutamate synthase; Validated 98.99
cd04237280 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) 98.98
TIGR01890 429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 98.83
TIGR00761231 argB acetylglutamate kinase. This model describes 98.69
COG0549312 ArcC Carbamate kinase [Amino acid transport and me 98.66
cd04252248 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam 98.42
PRK04531 398 acetylglutamate kinase; Provisional 98.35
cd04236271 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA 98.13
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 96.08
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 95.5
PLN02825 515 amino-acid N-acetyltransferase 95.5
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 90.64
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 87.31
>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=99.92  E-value=2.5e-25  Score=153.81  Aligned_cols=83  Identities=40%  Similarity=0.775  Sum_probs=79.9

Q ss_pred             CCcEEEEeec-cCeecCCCCC--CCceeeeccCHHHHhhCCCCcchHHHHHHHHhCCCCEEEEeCCCcchHHHhhcCCCc
Q 035510            1 HAEVVLKGTN-VDGVYDCHSR--DNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQV   77 (88)
Q Consensus         1 ~ad~li~~td-VdGvy~~dP~--~~a~~i~~i~~~e~~~~g~~~~d~~a~~la~~~gi~v~I~ng~~~~~i~~~l~g~~~   77 (88)
                      +||.|+++|+ ||||||+||+  |+|+++++++|.|+++.+..+||++|+++|++++||++|||+++++++.+++.|++.
T Consensus       153 ~ad~ll~atn~VDGVY~~DPkk~pdA~~~~~Lty~e~l~~~l~vmD~tA~~l~~~~~i~i~Vfn~~~~~~l~~~~~ge~~  232 (238)
T COG0528         153 EADVLLKATNKVDGVYDADPKKDPDAKKYDTLTYDEVLKIGLKVMDPTAFSLARDNGIPIIVFNINKPGNLKRALKGEEV  232 (238)
T ss_pred             CCcEEEEeccCCCceeCCCCCCCCCceecccCCHHHHHHhcCeeecHHHHHHHHHcCCcEEEEeCCCCccHHHHHcCCCC
Confidence            5899999996 9999999999  999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEEec
Q 035510           78 GTFIDR   83 (88)
Q Consensus        78 GT~i~~   83 (88)
                      ||+|.+
T Consensus       233 gT~V~~  238 (238)
T COG0528         233 GTIVEP  238 (238)
T ss_pred             ceEecC
Confidence            999864

>PRK14558 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PRK14556 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PRK00358 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PRK14557 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase Back     alignment and domain information
>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative Back     alignment and domain information
>PRK12314 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PTZ00489 glutamate 5-kinase; Provisional Back     alignment and domain information
>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains Back     alignment and domain information
>COG1608 Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>PRK05925 aspartate kinase; Provisional Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>PLN02551 aspartokinase Back     alignment and domain information
>KOG1154 consensus Gamma-glutamyl kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase Back     alignment and domain information
>COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>PRK12353 putative amino acid kinase; Reviewed Back     alignment and domain information
>PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional Back     alignment and domain information
>PRK08373 aspartate kinase; Validated Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>TIGR00746 arcC carbamate kinase Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria Back     alignment and domain information
>PRK00942 acetylglutamate kinase; Provisional Back     alignment and domain information
>PRK12686 carbamate kinase; Reviewed Back     alignment and domain information
>PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families Back     alignment and domain information
>PLN02512 acetylglutamate kinase Back     alignment and domain information
>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>PRK12354 carbamate kinase; Reviewed Back     alignment and domain information
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>CHL00202 argB acetylglutamate kinase; Provisional Back     alignment and domain information
>PRK09411 carbamate kinase; Reviewed Back     alignment and domain information
>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>PRK12352 putative carbamate kinase; Reviewed Back     alignment and domain information
>KOG0456 consensus Aspartate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>TIGR00761 argB acetylglutamate kinase Back     alignment and domain information
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
3nwy_A281 Structure And Allosteric Regulation Of The Uridine 1e-11
2a1f_A247 Crystal Structure Of Uridylate Kinase Length = 247 6e-10
2bnd_A241 The Structure Of E.Coli Ump Kinase In Complex With 2e-09
2bne_A241 The Structure Of E. Coli Ump Kinase In Complex With 3e-09
1ybd_A239 Crystal Structure Analysis Of Uridylate Kinase From 7e-09
3ek5_A243 Unique Gtp-Binding Pocket And Allostery Of Ump Kina 1e-08
2va1_A256 Crystal Structure Of Ump Kinase From Ureaplasma Par 2e-08
2bnf_A241 The Structure Of E. Coli Ump Kinase In Complex With 7e-08
1z9d_A252 Crystal Structure Of A Putative Uridylate Kinase (U 1e-07
4a7w_A240 Crystal Structure Of Uridylate Kinase From Helicoba 1e-05
2jjx_A255 The Crystal Structure Of Ump Kinase From Bacillus A 1e-04
>pdb|3NWY|A Chain A, Structure And Allosteric Regulation Of The Uridine Monophosphate Kinase From Mycobacterium Tuberculosis Length = 281 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 2/82 (2%)
Query: 2   AEVVLKGTNVDGVYDCHSRDNNAT--FEHISFRELGSRGAIPMDSTALSFCDENSIPVVV 59
           A+VVL    VDGV+    R N        +S RE+  RG    D+TA S C +N +P++V
Sbjct: 198 ADVVLMAKAVDGVFAEDPRVNPEAELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILV 257
Query: 60  FNLLEPGNISKAICGDQVGTFI 81
           FNLL  GNI++A+ G+++GT +
Sbjct: 258 FNLLTDGNIARAVRGEKIGTLV 279
>pdb|2A1F|A Chain A, Crystal Structure Of Uridylate Kinase Length = 247 Back     alignment and structure
>pdb|2BND|A Chain A, The Structure Of E.Coli Ump Kinase In Complex With Udp Length = 241 Back     alignment and structure
>pdb|2BNE|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Ump Length = 241 Back     alignment and structure
>pdb|1YBD|A Chain A, Crystal Structure Analysis Of Uridylate Kinase From Neisseria Meningitidis Length = 239 Back     alignment and structure
>pdb|3EK5|A Chain A, Unique Gtp-Binding Pocket And Allostery Of Ump Kinase From A Gram- Negative Phytopathogen Bacterium Length = 243 Back     alignment and structure
>pdb|2VA1|A Chain A, Crystal Structure Of Ump Kinase From Ureaplasma Parvum Length = 256 Back     alignment and structure
>pdb|2BNF|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Utp Length = 241 Back     alignment and structure
>pdb|1Z9D|A Chain A, Crystal Structure Of A Putative Uridylate Kinase (Ump-Kinase) From Streptococcus Pyogenes Length = 252 Back     alignment and structure
>pdb|4A7W|A Chain A, Crystal Structure Of Uridylate Kinase From Helicobacter Pylori Length = 240 Back     alignment and structure
>pdb|2JJX|A Chain A, The Crystal Structure Of Ump Kinase From Bacillus Anthracis (Ba1797) Length = 255 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
3ek6_A243 Uridylate kinase; UMPK unique GTP B site, alloster 4e-31
3nwy_A281 Uridylate kinase; allosterically activated form, A 1e-30
2va1_A256 Uridylate kinase; UMPK, transferase, pyrimidine bi 2e-30
2jjx_A255 Uridylate kinase, UMP kinase; structural genomics, 2e-30
2a1f_A247 Uridylate kinase; PYRH, structural genomics, PSI, 4e-30
4a7w_A240 Uridylate kinase; transferase; HET: GTP; 1.80A {He 5e-30
1ybd_A239 Uridylate kinase; alpha/beta/alpha fold, hexamer, 2e-29
2ogx_B270 Molybdenum storage protein subunit beta; open alph 2e-28
2brx_A244 Uridylate kinase; UMP kinase, amino acid kinase, p 2e-28
2j4j_A226 Uridylate kinase; transferase, nucleoside monophos 4e-28
1z9d_A252 Uridylate kinase, UK, UMP kinase; structural genom 9e-28
2ij9_A219 Uridylate kinase; structural genomics, protein str 1e-25
2ogx_A276 Molybdenum storage protein subunit alpha; open alp 6e-22
3k4o_A266 Isopentenyl phosphate kinase; small molecule kinas 5e-15
3ll5_A249 Gamma-glutamyl kinase related protein; alternate m 6e-08
3ll9_A269 Isopentenyl phosphate kinase; mevalonate biosynthe 3e-06
>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A Length = 243 Back     alignment and structure
 Score =  108 bits (271), Expect = 4e-31
 Identities = 24/83 (28%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 1   HAEVVLKGTNVDGVYDCHSRDNNAT--FEHISFRELGSRGAIPMDSTALSFCDENSIPVV 58
            A+++LK T VDGVYD   + ++    ++ +++ E+  +G   MD+ A +   ++ +P+ 
Sbjct: 157 GADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTAAFALARDSDLPLR 216

Query: 59  VFNLLEPGNISKAICGDQVGTFI 81
           +F + EPG + + + G Q+GT +
Sbjct: 217 IFGMSEPGVLLRILHGAQIGTLV 239
>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Length = 281 Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Length = 256 Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Length = 255 Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Length = 247 Back     alignment and structure
>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Length = 240 Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Length = 239 Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 270 Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Length = 244 Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Length = 226 Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Length = 252 Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Length = 219 Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276 Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Length = 266 Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249 Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 269 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
3ek6_A243 Uridylate kinase; UMPK unique GTP B site, alloster 99.89
1ybd_A239 Uridylate kinase; alpha/beta/alpha fold, hexamer, 99.89
2jjx_A255 Uridylate kinase, UMP kinase; structural genomics, 99.88
2a1f_A247 Uridylate kinase; PYRH, structural genomics, PSI, 99.88
3nwy_A281 Uridylate kinase; allosterically activated form, A 99.87
1z9d_A252 Uridylate kinase, UK, UMP kinase; structural genom 99.87
4a7w_A240 Uridylate kinase; transferase; HET: GTP; 1.80A {He 99.87
2j4j_A226 Uridylate kinase; transferase, nucleoside monophos 99.86
2va1_A256 Uridylate kinase; UMPK, transferase, pyrimidine bi 99.86
2brx_A244 Uridylate kinase; UMP kinase, amino acid kinase, p 99.84
2j5v_A 367 Glutamate 5-kinase; proline biosynthesis, gamma gl 99.83
2ij9_A219 Uridylate kinase; structural genomics, protein str 99.82
2ogx_A276 Molybdenum storage protein subunit alpha; open alp 99.82
2ako_A251 Glutamate 5-kinase; structural genomics, PSI, prot 99.81
2rd5_A298 Acetylglutamate kinase-like protein; protein-prote 99.77
2ap9_A299 NAG kinase, acetylglutamate kinase, AGK; structura 99.77
2ogx_B270 Molybdenum storage protein subunit beta; open alph 99.76
3ll9_A269 Isopentenyl phosphate kinase; mevalonate biosynthe 99.76
3tvi_A 446 Aspartokinase; structural genomics, ACT domains, r 99.76
2v5h_A321 Acetylglutamate kinase; amino-acid biosynthesis, t 99.75
2egx_A269 Putative acetylglutamate kinase; struc genomics, N 99.73
2cdq_A 510 Aspartokinase; aspartate kinase, amino acid metabo 99.73
3d40_A286 FOMA protein; fosfomycin, antibiotic resistance, k 99.72
3ab4_A 421 Aspartokinase; aspartate kinase, concerted inhibit 99.71
2j0w_A 449 Lysine-sensitive aspartokinase 3; feedback inhibit 99.71
3c1m_A 473 Probable aspartokinase; allosteric inhibition, thr 99.69
3l76_A 600 Aspartokinase; allostery, ACT domains, kinase tran 99.69
3ll5_A249 Gamma-glutamyl kinase related protein; alternate m 99.69
2bty_A282 Acetylglutamate kinase; N-acetyl-L-glutamate kinas 99.64
2buf_A300 Acetylglutamate kinase; acetyglutamate kinase, ADP 99.63
2e9y_A316 Carbamate kinase; transferase, structural genomics 99.62
1e19_A314 Carbamate kinase-like carbamoylphosphate synthetas 99.61
2we5_A310 Carbamate kinase 1; arginine catabolism, arginine 99.6
1gs5_A258 Acetylglutamate kinase; carbamate kinase, amino ac 99.59
3d2m_A 456 Putative acetylglutamate synthase; protein-COA-Glu 99.53
3kzf_A317 Carbamate kinase; arginine dihydrolase pathway, gi 99.51
3k4o_A266 Isopentenyl phosphate kinase; small molecule kinas 99.5
4axs_A332 Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm 99.46
3zzh_A307 Acetylglutamate kinase; transferase, arginine bios 99.26
3s6g_A 460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 99.13
3l86_A279 Acetylglutamate kinase; ARGB, amino-acid biosynthe 99.11
4ab7_A 464 Protein Arg5,6, mitochondrial; transferase, argini 99.06
3s6k_A 467 Acetylglutamate kinase; synthase, transferase; 2.8 98.97
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 93.12
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 89.12
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 86.61
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 80.46
>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A Back     alignment and structure
Probab=99.89  E-value=2.7e-23  Score=143.45  Aligned_cols=83  Identities=29%  Similarity=0.646  Sum_probs=79.0

Q ss_pred             CCcEEEEeeccCeecCCCCC--CCceeeeccCHHHHhhCCCCcchHHHHHHHHhCCCCEEEEeCCCcchHHHhhcCCCce
Q 035510            1 HAEVVLKGTNVDGVYDCHSR--DNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQVG   78 (88)
Q Consensus         1 ~ad~li~~tdVdGvy~~dP~--~~a~~i~~i~~~e~~~~g~~~~d~~a~~la~~~gi~v~I~ng~~~~~i~~~l~g~~~G   78 (88)
                      +||.|+++|||||||++||+  |+|++|++++++|+.+.+.++||+.|+++|.++|++++|+|+++|+++.+++.|+.+|
T Consensus       157 ~Ad~li~lTdVdGvy~~dp~~~p~a~~i~~i~~~e~~~~g~~~~~~~a~~~a~~~gv~v~I~~g~~~~~l~~~l~g~~~G  236 (243)
T 3ek6_A          157 GADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTAAFALARDSDLPLRIFGMSEPGVLLRILHGAQIG  236 (243)
T ss_dssp             TCSEEEEECSSSSCBSSCGGGCTTCCBCSEECHHHHHHHTCCSSCHHHHHHHHHTTCCEEEECCCSTTHHHHHHTTCCCS
T ss_pred             CCCEEEEEeCCCccCCCCCCCCCCceecccccHHHHHhCCchhHHHHHHHHHHHCCCeEEEEcCCCccHHHHHHCCCCCc
Confidence            69999999999999999998  8999999999998877778899999999999999999999999999999999999999


Q ss_pred             eEEec
Q 035510           79 TFIDR   83 (88)
Q Consensus        79 T~i~~   83 (88)
                      |+|.+
T Consensus       237 T~i~~  241 (243)
T 3ek6_A          237 TLVQG  241 (243)
T ss_dssp             EEECC
T ss_pred             eEEee
Confidence            99987
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Back     alignment and structure
>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Back     alignment and structure
>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Back     alignment and structure
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Back     alignment and structure
>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Back     alignment and structure
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Back     alignment and structure
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Back     alignment and structure
>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803} Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Back     alignment and structure
>4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans} Back     alignment and structure
>3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} Back     alignment and structure
>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 88
d2a1fa1236 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophi 5e-16
d1ybda1236 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseri 2e-15
d2ij9a1219 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeog 2e-14
d1z9da1238 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptoc 3e-14
d2brxa1225 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococc 3e-09
d2hmfa1302 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus ja 4e-09
d2cdqa1304 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Ar 2e-08
d2j0wa1292 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli 4e-08
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Length = 236 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: PyrH-like
domain: Uridylate kinase PyrH
species: Haemophilus influenzae [TaxId: 727]

 Score = 67.7 bits (164), Expect = 5e-16
 Identities = 28/83 (33%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 1   HAEVVLKGTNVDGVYDCHSR--DNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVV 58
            A+VVLK T VDGVYDC      +   ++++S+ E+  +    MD +A +   ++ +P+ 
Sbjct: 153 EADVVLKATKVDGVYDCDPAKNPDAKLYKNLSYAEVIDKELKVMDLSAFTLARDHGMPIR 212

Query: 59  VFNLLEPGNISKAICGDQVGTFI 81
           VFN+ +PG + + + G + GT I
Sbjct: 213 VFNMGKPGALRQVVTGTEEGTTI 235
>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Length = 236 Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Length = 219 Back     information, alignment and structure
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Length = 238 Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Length = 225 Back     information, alignment and structure
>d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Length = 302 Back     information, alignment and structure
>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 304 Back     information, alignment and structure
>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Length = 292 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d2a1fa1236 Uridylate kinase PyrH {Haemophilus influenzae [Tax 99.94
d1ybda1236 Uridylate kinase PyrH {Neisseria meningitidis [Tax 99.93
d2brxa1225 Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 99.92
d2ij9a1219 Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax 99.91
d1z9da1238 Uridylate kinase PyrH {Streptococcus pyogenes [Tax 99.91
d2akoa1250 Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1 99.86
d2cdqa1304 Aspartokinase {Thale cress (Arabidopsis thaliana) 99.78
d2j0wa1292 Aspartokinase {Escherichia coli [TaxId: 562]} 99.75
d2hmfa1302 Aspartokinase {Methanococcus jannaschii [TaxId: 21 99.72
d1e19a_313 Carbamate kinase {Archaeon Pyrococcus furiosus [Ta 99.55
d2ap9a1291 N-acetyl-l-glutamate kinase {Mycobacterium tubercu 99.51
d1b7ba_307 Carbamate kinase {Enterococcus faecium [TaxId: 135 99.43
d2btya1282 N-acetyl-l-glutamate kinase {Thermotoga maritima [ 99.38
d2bufa1300 N-acetyl-l-glutamate kinase {Pseudomonas aeruginos 99.31
d1gs5a_258 N-acetyl-l-glutamate kinase {Escherichia coli [Tax 98.95
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 95.7
d1xvia_ 232 Putative mannosyl-3-phosphoglycerate phosphatase M 93.63
d1rkqa_ 271 Hypothetical protein YidA {Escherichia coli [TaxId 92.22
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: PyrH-like
domain: Uridylate kinase PyrH
species: Haemophilus influenzae [TaxId: 727]

Probab=99.94  E-value=5.4e-27  Score=157.54  Aligned_cols=82  Identities=34%  Similarity=0.654  Sum_probs=74.2

Q ss_pred             CCcEEEEeeccCeecCCCCC--CCceeeeccCHHHHhhCCCCcchHHHHHHHHhCCCCEEEEeCCCcchHHHhhcCCCce
Q 035510            1 HAEVVLKGTNVDGVYDCHSR--DNNATFEHISFRELGSRGAIPMDSTALSFCDENSIPVVVFNLLEPGNISKAICGDQVG   78 (88)
Q Consensus         1 ~ad~li~~tdVdGvy~~dP~--~~a~~i~~i~~~e~~~~g~~~~d~~a~~la~~~gi~v~I~ng~~~~~i~~~l~g~~~G   78 (88)
                      +||+|+++||||||||+||+  |+|+++++++++|+++.|.++||++|+++|+++||+++|+||++|++|.++++|+++|
T Consensus       153 ~Ad~lii~TDVdGvyt~dP~~~~~A~~i~~i~~~e~l~~G~~v~k~~Aa~~a~~~gi~v~I~ng~~~~~l~~~l~Ge~~G  232 (236)
T d2a1fa1         153 EADVVLKATKVDGVYDCDPAKNPDAKLYKNLSYAEVIDKELKVMDLSAFTLARDHGMPIRVFNMGKPGALRQVVTGTEEG  232 (236)
T ss_dssp             TCSEEEEEESSSSCBCC-------CCBCSEECHHHHHHTTCCSSCHHHHHHHHHHTCCEEEEETTSTTHHHHHHTCSCSS
T ss_pred             chhHHHHhhcccccccccccccccccccccccHHHHHhcCCceeHHHHHHHHHHCCCeEEEEeCCCCcHHHHHHcCCCCc
Confidence            69999999999999999999  8999999999999988899999999999999999999999999999999999999999


Q ss_pred             eEEe
Q 035510           79 TFID   82 (88)
Q Consensus        79 T~i~   82 (88)
                      |+|.
T Consensus       233 TlI~  236 (236)
T d2a1fa1         233 TTIC  236 (236)
T ss_dssp             EEEC
T ss_pred             ceeC
Confidence            9983
>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure