Citrus Sinensis ID: 035730

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MAKTPQIGNKSTENLFEDFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLGDNKWSRCNQAFPIPSNCKIDKIHAKWNNAILTVTMPKETITQPQPRKEEPKTTQKSPKAAEHKEPKSSKDFQQVSASQKAADEEPKSSKDFQQAAASPKAADKEPKTSKDFQQITEMQNEVKSNIHGEKKEDGKSPDALTAQKSDETTFPKDAVSMNQTDKTNEVAKAKKIDQMTQKGFTMPENVTEKEEKKSITAAVMKDVKGIATDQNEDKQLLINIGVAALVIVALGAYVSYSIGSKSKG
cccccccccccccccccccccccccEEccccEEEEEEccccccccEEEEEEEcccEEEEEEEEEEcccEEEEEEEEEEcccccccccEEEEEEccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHcccccccccccccccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHEEEEccccccc
cccccccccccccccEccccccccccccccccEEEEEcccccccEEEEEEEEcccEEEEEcccccccccEEEEEEEcccccccccccEEEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHEEEEEccccccc
maktpqignkstenlfedfhpmsewldepennillvhlpdftkeqIRITCvrssrivrvtgerqlgdnkwsrcnqafpipsnckidkiHAKWNNAIltvtmpketitqpqprkeepkttqkspkaaehkepksskdfqqvsasqkaadeepksskdfqqaaaspkaadkepktskdFQQITEMQNEVKsnihgekkedgkspdaltaqksdettfpkdavsmnqtdkTNEVAKAKKIDQMtqkgftmpenvtekeEKKSITAAVMKDVKgiatdqneDKQLLINIGVAALVIVALGAYVSYsigskskg
maktpqignkstenlFEDFHPMSEWLDEPENNILLVHLPdftkeqiritcvrssrivrvtgerqlgdnkwsrcNQAFPIPSNCKIDKIHAKWNNAILTvtmpketitqpqprkeepkttqkspkaaehkepksskdfqqVSASQkaadeepksskDFQQAaaspkaadkepktsKDFQQITEMQnevksnihgekkedgkspdaltaqksdettfpkdavsmnqtdktnevakakkidqmtqkgftmpenvtekeekKSITAAVMKDVKGIATDQNEDKQLLINIGVAALVIVALGAYVsysigskskg
MAKTPQIGNKSTENLFEDFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLGDNKWSRCNQAFPIPSNCKIDKIHAKWNNAILTVTMPKETITQPQPRKEEPKTTQKSPKAAEHKEPKSSKDFQQVSASQKAADEEPKSSKDFQQAAASPKAADKEPKTSKDFQQITEMQNEVKSNIHGEKKEDGKSPDALTAQKSDETTFPKDAVSMNQTDKTNEVAKAKKIDQMTQKGFTMPENVTEKEEKKSITAAVMKDVKGIATDQNEDKQllinigvaalvivalgayvSYSIGSKSKG
******************FHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLGDNKWSRCNQAFPIPSNCKIDKIHAKWNNAILTVTM**********************************************************************************************************************************************************************VKGIAT**NEDKQLLINIGVAALVIVALGAYVSYSI******
****************EDFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVT***********RCNQAFPIPSNCKIDKIHAKWNNAILTVT**************************************************************************************************************************************************************************************INIGVAALVIVALGAYVSYSIGS****
MAKTPQIGNKSTENLFEDFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLGDNKWSRCNQAFPIPSNCKIDKIHAKWNNAILTVTMPKET**********************************************************************DFQQITEMQNEVKSNIHG**************QKSDETTFPKDAVSMNQTDKTNEVAKAKKIDQMTQKGFTMP**********SITAAVMKDVKGIATDQNEDKQLLINIGVAALVIVALGAYVSYSIGSKSKG
***************FEDFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLGDNKWSRCNQAFPIPSNCKIDKIHAKWNNAILTVTMPKE******************************************************************************************************************************************************E*KKSITAAVMKDVKGIATDQNEDKQLLINIGVAALVIVALGAYVSYSIG*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKTPQIGNKSTENLFEDFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLGDNKWSRCNQAFPIPSNCKIDKIHAKWNNAILTVTMPKETITQPQPRKEEPKTTQKSPKAAEHKEPKSSKDFQQVSASQKAADEEPKSSKDFQQAAASPKAADKEPKTSKDFQQITEMQNEVKSNIHGEKKEDGKSPDALTAQKSDETTFPKDAVSMNQTDKTNEVAKAKKIDQMTQKGFTMPENVTEKEEKKSITAAVMKDVKGIATDQNEDKQLLINIGVAALVIVALGAYVSYSIGSKSKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query309 2.2.26 [Sep-21-2011]
P27879143 18.1 kDa class I heat sho N/A no 0.278 0.601 0.295 1e-08
P27880158 18.2 kDa class I heat sho N/A no 0.278 0.544 0.285 4e-08
P02519153 17.3 kDa class I heat sho no no 0.275 0.555 0.288 5e-08
P04793153 17.5 kDa class I heat sho no no 0.300 0.607 0.277 1e-07
P04794154 17.5 kDa class I heat sho no no 0.300 0.603 0.266 3e-07
P19244197 22.7 kDa class IV heat sh N/A no 0.268 0.421 0.315 3e-07
P05478161 18.5 kDa class I heat sho no no 0.275 0.527 0.257 1e-06
P30221154 17.8 kDa class I heat sho N/A no 0.278 0.558 0.316 4e-06
P13853157 17.6 kDa class I heat sho no no 0.255 0.503 0.296 9e-06
P04795154 17.6 kDa class I heat sho no no 0.291 0.584 0.264 9e-06
>sp|P27879|HSP11_MEDSA 18.1 kDa class I heat shock protein (Fragment) OS=Medicago sativa GN=HSP18.1 PE=2 SV=1 Back     alignment and function desciption
 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 57/98 (58%), Gaps = 12/98 (12%)

Query: 24  EWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQL----GDNKWSRCNQA--- 76
           +W + PE ++    LP   KE++++  +   R+++++GER +     +++W R  ++   
Sbjct: 39  DWKETPEAHVFKADLPGLKKEEVKVE-IEDDRVLQISGERNVEKEDKNDQWHRVERSSGK 97

Query: 77  ----FPIPSNCKIDKIHAKWNNAILTVTMPKETITQPQ 110
               F +P N K+D++ A   N +LTVT+PKE I +P+
Sbjct: 98  FMRRFRLPENAKMDQVKAAMENGVLTVTVPKEEIKKPE 135

Medicago sativa (taxid: 3879)
>sp|P27880|HSP12_MEDSA 18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1 Back     alignment and function description
>sp|P02519|HSP11_SOYBN 17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1 Back     alignment and function description
>sp|P04793|HSP13_SOYBN 17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1 Back     alignment and function description
>sp|P04794|HSP14_SOYBN 17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1 Back     alignment and function description
>sp|P19244|HSP41_PEA 22.7 kDa class IV heat shock protein OS=Pisum sativum GN=HSP22.7 PE=2 SV=1 Back     alignment and function description
>sp|P05478|HSP16_SOYBN 18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1 Back     alignment and function description
>sp|P30221|HSP11_SOLLC 17.8 kDa class I heat shock protein OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function description
>sp|P13853|HS17C_ARATH 17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2 Back     alignment and function description
>sp|P04795|HSP15_SOYBN 17.6 kDa class I heat shock protein OS=Glycine max GN=HSP17.6-L PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
255546799305 small heat-shock protein, putative [Rici 0.867 0.878 0.360 7e-40
224097524370 predicted protein [Populus trichocarpa] 0.970 0.810 0.330 6e-36
297806473366 hypothetical protein ARALYDRAFT_487275 [ 0.886 0.748 0.318 3e-35
224113355328 predicted protein [Populus trichocarpa] 0.944 0.890 0.346 3e-30
356515359305 PREDICTED: uncharacterized protein LOC10 0.864 0.875 0.348 4e-30
302608974366 RTM2 protein [Arabidopsis thaliana] 0.368 0.311 0.483 5e-27
293337598366 restricted tev movement 2 [Arabidopsis t 0.300 0.254 0.559 2e-26
293337582366 restricted tev movement 2 [Arabidopsis t 0.300 0.254 0.559 2e-26
293337614366 restricted tev movement 2 [Arabidopsis t 0.300 0.254 0.559 2e-26
293337600366 restricted tev movement 2 [Arabidopsis t 0.300 0.254 0.559 2e-26
>gi|255546799|ref|XP_002514458.1| small heat-shock protein, putative [Ricinus communis] gi|223546454|gb|EEF47954.1| small heat-shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  170 bits (431), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 166/305 (54%), Gaps = 37/305 (12%)

Query: 16  FEDFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLGDNKWSRCNQ 75
           +EDF P  EW +E    +LL+HLPD+ KEQ++IT V ++R++ + GER + DNKWSR ++
Sbjct: 15  YEDFQPKIEWKEEEGAILLLLHLPDYKKEQLKITYVNTTRVITILGERPITDNKWSRLDK 74

Query: 76  AFPIPSNCKIDKIHAKWNNAILTVTMPKETITQP------------QPRKEEPKTTQKSP 123
           +F +P NC ++KI AK+ N ILT+TMPK TITQP            Q R E+  T Q  P
Sbjct: 75  SFSVPLNCHVNKIQAKFQNGILTITMPKITITQPSSPSKPAPASSVQDRDEKKGTPQVPP 134

Query: 124 KAAEHKEPKSSKDFQQVSASQKAADEEPKSSKDFQQAAASPKAADKEPKTSKDFQQITEM 183
           +A    E K+ K  ++    Q   D +        +AA +P    KEP  +   +Q  E 
Sbjct: 135 EA--KAEQKAQKGTEETGPKQNQTDGKK------MEAALNP----KEP-LNDTVKQKDEK 181

Query: 184 QNEVKSN----IHGEKKEDGKSPDALTAQKSDETTFPKDAVSMNQTDKTNEVAKAKKIDQ 239
            ++ KSN    + G++    K  +++ A+  D     K+A +        E  K  K D 
Sbjct: 182 GDDQKSNGKKEMSGKEDNSKKRKESMLAESEDTNKKRKEAAAGGTIRSGVENQKEDKFDG 241

Query: 240 MTQKGFTMPENVTEKEEKKSITAAVMKDVKGIATDQNEDKQLLINIGVAALVIVALGAYV 299
            +++ F         E+ K++ AA  + VKG+A + ++++Q L NIGVA LVI ALGAY+
Sbjct: 242 ASEELFG--------EKMKNVAAAAKEKVKGLAMELSQERQALANIGVAVLVIAALGAYI 293

Query: 300 SYSIG 304
           SY  G
Sbjct: 294 SYRYG 298

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224097524|ref|XP_002310972.1| predicted protein [Populus trichocarpa] gi|222850792|gb|EEE88339.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297806473|ref|XP_002871120.1| hypothetical protein ARALYDRAFT_487275 [Arabidopsis lyrata subsp. lyrata] gi|297316957|gb|EFH47379.1| hypothetical protein ARALYDRAFT_487275 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224113355|ref|XP_002316467.1| predicted protein [Populus trichocarpa] gi|222865507|gb|EEF02638.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356515359|ref|XP_003526368.1| PREDICTED: uncharacterized protein LOC100814906 [Glycine max] Back     alignment and taxonomy information
>gi|302608974|emb|CBW45863.1| RTM2 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|293337598|gb|ADE43087.1| restricted tev movement 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|293337582|gb|ADE43079.1| restricted tev movement 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|293337614|gb|ADE43095.1| restricted tev movement 2 [Arabidopsis thaliana] gi|302609010|emb|CBW45881.1| RTM2 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|293337600|gb|ADE43088.1| restricted tev movement 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
TAIR|locus:2175438366 RTM2 "AT5G04890" [Arabidopsis 0.760 0.642 0.330 1.3e-31
TAIR|locus:2045144224 AT2G27140 "AT2G27140" [Arabido 0.631 0.870 0.287 2.1e-20
TAIR|locus:2147137249 AT5G20970 "AT5G20970" [Arabido 0.576 0.714 0.278 3.2e-17
TAIR|locus:2075805 490 AT3G10680 "AT3G10680" [Arabido 0.822 0.518 0.231 1.1e-10
UNIPROTKB|Q943E7149 HSP16.9C "16.9 kDa class I hea 0.294 0.610 0.271 4.2e-09
UNIPROTKB|Q943E6150 HSP16.9B "16.9 kDa class I hea 0.294 0.606 0.271 7e-09
UNIPROTKB|P27777150 HSP16.9A "16.9 kDa class I hea 0.294 0.606 0.271 9e-09
TAIR|locus:2174269161 HSP18.2 "heat shock protein 18 0.343 0.658 0.280 1.5e-08
UNIPROTKB|P31673154 HSP17.4 "17.4 kDa class I heat 0.294 0.590 0.287 2.5e-08
UNIPROTKB|Q84J50159 HSP17.7 "17.7 kDa class I heat 0.300 0.584 0.3 2.5e-08
TAIR|locus:2175438 RTM2 "AT5G04890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 347 (127.2 bits), Expect = 1.3e-31, P = 1.3e-31
 Identities = 82/248 (33%), Positives = 135/248 (54%)

Query:    16 FEDFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLGDNKWSRCNQ 75
             +EDF P SEW D+PE  IL + L  F KEQ+++T V SS+++RVTGER L + KWSR N+
Sbjct:    16 YEDFVPKSEWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVTGERPLANRKWSRFNE 75

Query:    76 AFPIPSNCKIDKIHAKWNNAILTVTMPKETITQPQPRKEEPKTTQKSPKAAEHKEPKSSK 135
              F +P NC +DKIH  + N +LT+TMPKETIT+       P+T++    A E       K
Sbjct:    76 VFTVPQNCLVDKIHGSFKNNVLTITMPKETITKVAYL---PETSRTEAAALEKAAKLEEK 132

Query:   136 DFQQVSASQKAADEEPKSSKD--FQQAAASPKAADKEPKTSKDFQQITEMQNEVKSNIHG 193
                + S  ++  +EE K  K    ++  A  +   +E K +K+  ++ ++Q E K+    
Sbjct:   133 RLLEESRRKEKEEEEAKQMKKQLLEEKEALIRKLQEEAK-AKEEAEMRKLQEEAKAKEEA 191

Query:   194 EKK---EDGKSPDALTAQKSDETTFPK---DAVSMNQTDKTNEVAKAKKIDQMTQKGFTM 247
               K   E+ ++ + L  +K +E    +   + + + +  K  ++ + K +D+  +K   +
Sbjct:   192 AAKKLQEEIEAKEKLEERKLEERRLEERKLEDMKLAEEAKLKKIQERKSVDESGEKEKIL 251

Query:   248 -PENVTEK 254
              PE V  K
Sbjct:   252 KPEVVYTK 259
GO:0003674 "molecular_function" evidence=ND
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0009615 "response to virus" evidence=IMP
TAIR|locus:2045144 AT2G27140 "AT2G27140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147137 AT5G20970 "AT5G20970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075805 AT3G10680 "AT3G10680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q943E7 HSP16.9C "16.9 kDa class I heat shock protein 3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q943E6 HSP16.9B "16.9 kDa class I heat shock protein 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27777 HSP16.9A "16.9 kDa class I heat shock protein 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2174269 HSP18.2 "heat shock protein 18.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P31673 HSP17.4 "17.4 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84J50 HSP17.7 "17.7 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_VIII0114
hypothetical protein (370 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 3e-10
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain 1e-07
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 2e-07
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 1e-05
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 2e-05
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information 
 Score = 55.6 bits (135), Expect = 3e-10
 Identities = 21/90 (23%), Positives = 44/90 (48%), Gaps = 12/90 (13%)

Query: 24  EWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLGDNK----------WSRC 73
           +  +  +  ++   LP F KE I++       ++ ++GER+  + +          +   
Sbjct: 1   DVYETDDAYVVEADLPGFKKEDIKVEVED--GVLTISGEREEEEEEEENYLRRERSYGSF 58

Query: 74  NQAFPIPSNCKIDKIHAKWNNAILTVTMPK 103
           +++F +P +   DKI A   N +LT+T+PK
Sbjct: 59  SRSFRLPEDVDPDKIKASLENGVLTITLPK 88

sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps. Length = 88
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 309
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.85
PRK11597142 heat shock chaperone IbpB; Provisional 99.84
PRK10743137 heat shock protein IbpA; Provisional 99.83
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.83
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.82
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.82
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.82
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.81
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.81
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.8
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.79
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.79
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.78
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.76
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.74
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.74
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.73
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.69
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.65
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.62
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.44
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.42
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.13
cd0646384 p23_like Proteins containing this p23_like domain 98.77
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 98.7
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.42
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 98.34
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 97.81
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 97.66
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 97.38
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 97.29
cd0646892 p23_CacyBP p23_like domain found in proteins simil 97.21
cd0648887 p23_melusin_like p23_like domain similar to the C- 96.89
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 96.88
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 96.03
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 95.66
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.25
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 93.79
KOG1309196 consensus Suppressor of G2 allele of skp1 [Signal 93.15
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 89.57
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 88.23
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.85  E-value=8.3e-21  Score=161.64  Aligned_cols=97  Identities=26%  Similarity=0.463  Sum_probs=83.2

Q ss_pred             ccccceeeEEcCCeEEEEEEcCCCCCCCeEEEEEecCCEEEEEEEEEcc----CC-------eEEEEEEEEECCCCcccC
Q 035730           18 DFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLG----DN-------KWSRCNQAFPIPSNCKID   86 (309)
Q Consensus        18 ~~~P~vDI~Etdd~yvL~vDLPGfkpEDIkV~vVdeg~~LtIsGere~~----~~-------k~~rF~R~f~LPe~VD~e   86 (309)
                      .+.|+|||+++++.|+|.++||||+++||+|++  +++.|+|+|++...    ..       .+..|+|+|.||..|+.+
T Consensus        38 ~~~P~vdi~e~~~~~~I~~elPG~~kedI~I~~--~~~~l~I~g~~~~~~~~~~~~~~~~e~~~~~f~r~~~Lp~~v~~~  115 (146)
T COG0071          38 TGTPPVDIEETDDEYRITAELPGVDKEDIEITV--EGNTLTIRGEREEEEEEEEEGYLRRERAYGEFERTFRLPEKVDPE  115 (146)
T ss_pred             CCCCcEEEEEcCCEEEEEEEcCCCChHHeEEEE--ECCEEEEEEEecccccccCCceEEEEEEeeeEEEEEECccccccc
Confidence            378999999999999999999999999999998  67899999998752    11       245599999999999999


Q ss_pred             ceeEEEeCcEEEEEEeCcCCCCCCCCCCCCeEeec
Q 035730           87 KIHAKWNNAILTVTMPKETITQPQPRKEEPKTTQK  121 (309)
Q Consensus        87 ~IkAsLsDGVLtItLPK~~~~~~~p~~ek~r~IeI  121 (309)
                      .+.|+|+||||+|+|||..+..     .++++|.|
T Consensus       116 ~~~A~~~nGvL~I~lpk~~~~~-----~~~~~i~I  145 (146)
T COG0071         116 VIKAKYKNGLLTVTLPKAEPEE-----KKPKRIEI  145 (146)
T ss_pred             ceeeEeeCcEEEEEEecccccc-----ccCceeec
Confidence            9999999999999999985432     35566665

>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
1gme_A151 Heat shock protein 16.9B; small heat shock protein 2e-12
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 2e-09
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 2e-09
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 3e-07
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 5e-07
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 2e-06
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 2e-06
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 7e-05
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
 Score = 62.7 bits (153), Expect = 2e-12
 Identities = 26/106 (24%), Positives = 53/106 (50%), Gaps = 12/106 (11%)

Query: 19  FHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQL----GDNKWSR-- 72
            +   +W + PE ++    LP   KE++++  V    ++ V+GER       ++KW R  
Sbjct: 42  ANARMDWKETPEAHVFKADLPGVKKEEVKVE-VEDGNVLVVSGERTKEKEDKNDKWHRVE 100

Query: 73  -----CNQAFPIPSNCKIDKIHAKWNNAILTVTMPKETITQPQPRK 113
                  + F +  + K++++ A   N +LTVT+PK  + +P+ + 
Sbjct: 101 RSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVKKPEVKA 146
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.88
4fei_A102 Heat shock protein-related protein; stress respons 99.88
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.87
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.84
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.84
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.84
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.84
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.82
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.8
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.78
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.76
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.61
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 98.78
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 98.75
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.94
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.86
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 97.32
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 97.05
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 97.04
2o30_A131 Nuclear movement protein; MCSG, structural genomic 96.97
3igf_A374 ALL4481 protein; two-domained protein consisting o 96.9
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 96.82
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 96.8
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 96.73
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 96.49
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 96.45
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 96.29
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
Probab=99.88  E-value=1.7e-22  Score=159.26  Aligned_cols=86  Identities=23%  Similarity=0.476  Sum_probs=77.5

Q ss_pred             ccccceeeEEcCCeEEEEEEcCCCCCCCeEEEEEecCCEEEEEEEEEcc----CCe-------EEEEEEEEECCCCcccC
Q 035730           18 DFHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLG----DNK-------WSRCNQAFPIPSNCKID   86 (309)
Q Consensus        18 ~~~P~vDI~Etdd~yvL~vDLPGfkpEDIkV~vVdeg~~LtIsGere~~----~~k-------~~rF~R~f~LPe~VD~e   86 (309)
                      .|.|++||++++++|+|.++||||+++||+|++  +++.|+|+|++...    +..       +++|.|+|.||.+||.+
T Consensus         2 ~~~P~~di~e~~~~~~v~~~lPG~~~edi~v~~--~~~~L~I~g~~~~~~~~~~~~~~~~er~~g~f~r~~~LP~~vd~~   79 (100)
T 3gla_A            2 QWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQM--DKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADAD   79 (100)
T ss_dssp             CSCCCEEEEECSSEEEEEEECTTSCGGGCEEEE--ETTEEEEEEEECCGGGSSGGGEEEECCCCEEEEEEEECCTTBCTT
T ss_pred             CccCcEEEEECCCEEEEEEECCCCCHHHEEEEE--ECCEEEEEEEEcCcCccCCccEEEEeecceEEEEEEECCCCcChH
Confidence            589999999999999999999999999999998  57899999998753    122       44699999999999999


Q ss_pred             ceeEEEeCcEEEEEEeCcC
Q 035730           87 KIHAKWNNAILTVTMPKET  105 (309)
Q Consensus        87 ~IkAsLsDGVLtItLPK~~  105 (309)
                      .|+|+|+||||+|+|||.+
T Consensus        80 ~i~A~~~~GvL~I~~pK~~   98 (100)
T 3gla_A           80 GITAAGRNGVLEIRIPKRP   98 (100)
T ss_dssp             SCEEEEETTEEEEEEEBC-
T ss_pred             HeEEEEeCCEEEEEEecCC
Confidence            9999999999999999974
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 309
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 5e-09
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 2e-06
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

 Score = 52.1 bits (124), Expect = 5e-09
 Identities = 23/106 (21%), Positives = 50/106 (47%), Gaps = 12/106 (11%)

Query: 19  FHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGER-----------QLGD 67
            +   +W + PE ++    LP   KE++++  V    ++ V+GER              +
Sbjct: 41  ANARMDWKETPEAHVFKADLPGVKKEEVKVE-VEDGNVLVVSGERTKEKEDKNDKWHRVE 99

Query: 68  NKWSRCNQAFPIPSNCKIDKIHAKWNNAILTVTMPKETITQPQPRK 113
               +  + F +  + K++++ A   N +LTVT+PK  + +P+ + 
Sbjct: 100 RSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVKKPEVKA 145
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.84
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.83
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 97.96
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 96.78
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 95.62
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 95.48
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 95.08
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

Probab=99.84  E-value=8.1e-21  Score=158.63  Aligned_cols=98  Identities=29%  Similarity=0.588  Sum_probs=82.4

Q ss_pred             cccceeeEEcCCeEEEEEEcCCCCCCCeEEEEEecCCEEEEEEEEEcc----CCeEE-------EEEEEEECCCCcccCc
Q 035730           19 FHPMSEWLDEPENNILLVHLPDFTKEQIRITCVRSSRIVRVTGERQLG----DNKWS-------RCNQAFPIPSNCKIDK   87 (309)
Q Consensus        19 ~~P~vDI~Etdd~yvL~vDLPGfkpEDIkV~vVdeg~~LtIsGere~~----~~k~~-------rF~R~f~LPe~VD~e~   87 (309)
                      +.|++||++++++|+|.++||||+++||+|++ ++++.|+|+|++...    +..|+       +|+|+|.||.+||.++
T Consensus        41 ~~p~~dv~e~~~~~~i~~~lPG~~~edi~v~v-~~~~~l~i~~~~~~~~~~~~~~~~~~e~~~~~f~r~~~LP~~vd~~~  119 (150)
T d1gmea_          41 ANARMDWKETPEAHVFKADLPGVKKEEVKVEV-EDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEE  119 (150)
T ss_dssp             GGGCEEEEECSSEEEEEEECTTCCGGGEEEEE-ETTTEEEEEECCCCCCCCTTCEEEECCCCCCCEEEEEECSSCCCGGG
T ss_pred             CCCceeEEECCCEEEEEEEeCCCccCCEEEEE-EEccceeEEEEEecccccccceeeeeeeccceEEEEEECCCCeeece
Confidence            46899999999999999999999999999997 446789999987553    23333       4999999999999999


Q ss_pred             eeEEEeCcEEEEEEeCcCCCCCCCCCCCCeEeecC
Q 035730           88 IHAKWNNAILTVTMPKETITQPQPRKEEPKTTQKS  122 (309)
Q Consensus        88 IkAsLsDGVLtItLPK~~~~~~~p~~ek~r~IeI~  122 (309)
                      |+|+|+||||+|+|||....     ..+.+.|+|.
T Consensus       120 i~A~~~nGvL~I~lpK~~~~-----~~~~~~I~I~  149 (150)
T d1gmea_         120 VKAGLENGVLTVTVPKAEVK-----KPEVKAIQIS  149 (150)
T ss_dssp             CEEEEETTEEEEEEECCCCC-----TTCCCCCCCC
T ss_pred             eEEEEECCEEEEEEEcCCcC-----CCCceEEecc
Confidence            99999999999999997433     2356777774
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure