Citrus Sinensis ID: 035927


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MKNKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFPEMQTSNIRPDEFTIVRILTAYMYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFPTIRPDEVTYVGVLSACTHNGNETFVINSCNL
ccccHHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccEEHHHHHHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHcccc
cccccEHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHcc
mknkdvisWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREAltlfpemqtsnirpdefTIVRILTAYMYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLaisdpfptirpdevTYVGVLSActhngnetFVINSCNL
MKNKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTlfpemqtsnirpdeFTIVRILTAYMYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFPTIRPDEVTYVGVLSActhngnetfvinscnl
MKNKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFPEMQTSNIRPDEFTIVRILTAYMYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFPTIRPDEVTYVGVLSACTHNGNETFVINSCNL
*****VISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFPEMQTSNIRPDEFTIVRILTAYMYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFPTIRPDEVTYVGVLSACTHNGNETFVIN****
*KNKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFPEMQTSNIRPDEFTIVRILTAYMYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFPTIRPDEVTYVGVLSACTHNGNETFVINSCNL
MKNKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFPEMQTSNIRPDEFTIVRILTAYMYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFPTIRPDEVTYVGVLSACTHNGNETFVINSCNL
***KDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFPEMQTSNIRPDEFTIVRILTAYMYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFPTIRPDEVTYVGVLSACTHNGNETFVINSCNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFPEMQTSNIRPDEFTIVRILTAYMYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFPTIRPDEVTYVGVLSACTHNGNETFVINSCNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
Q9LSB8 687 Putative pentatricopeptid yes no 0.928 0.206 0.449 2e-38
Q9SJZ3 681 Pentatricopeptide repeat- no no 0.928 0.208 0.342 1e-27
Q9C866 570 Pentatricopeptide repeat- no no 0.928 0.249 0.358 2e-27
Q1PEU4 555 Pentatricopeptide repeat- no no 0.928 0.255 0.347 1e-24
Q9SJG6 559 Pentatricopeptide repeat- no no 0.901 0.246 0.322 2e-24
Q9MA50 500 Pentatricopeptide repeat- no no 0.928 0.284 0.315 1e-23
Q38959455 Pentatricopeptide repeat- no no 0.934 0.314 0.322 1e-23
Q9FFG8 657 Pentatricopeptide repeat- no no 0.928 0.216 0.315 2e-22
Q683I9 573 Pentatricopeptide repeat- no no 0.895 0.239 0.317 9e-22
Q9FJY7 620 Pentatricopeptide repeat- no no 0.901 0.222 0.306 3e-21
>sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containing protein At3g15930 OS=Arabidopsis thaliana GN=PCMP-E51 PE=3 SV=2 Back     alignment and function desciption
 Score =  157 bits (398), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 107/187 (57%), Gaps = 45/187 (24%)

Query: 1   MKNKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLF 60
           MK +DVISWT IV GY+ RG + +AR YF QMP RD + WT MIDGYLR   F E+L +F
Sbjct: 297 MKARDVISWTSIVKGYVERGNLKLARTYFDQMPVRDRISWTIMIDGYLRAGCFNESLEIF 356

Query: 61  PEMQTSNIRPDEFTIVRILTAY---------------------------------MYCKC 87
            EMQ++ + PDEFT+V +LTA                                  MY KC
Sbjct: 357 REMQSAGMIPDEFTMVSVLTACAHLGSLEIGEWIKTYIDKNKIKNDVVVGNALIDMYFKC 416

Query: 88  GDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFP------------TIRPDEVTYVGVL 135
           G  EKAQ+V   M ++DKFTWTAM+VGLA +                +I+PD++TY+GVL
Sbjct: 417 GCSEKAQKVFHDMDQRDKFTWTAMVVGLANNGQGQEAIKVFFQMQDMSIQPDDITYLGVL 476

Query: 136 SACTHNG 142
           SAC H+G
Sbjct: 477 SACNHSG 483





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protein At2g22410, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E28 PE=2 SV=1 Back     alignment and function description
>sp|Q9C866|PPR65_ARATH Pentatricopeptide repeat-containing protein At1g31430 OS=Arabidopsis thaliana GN=PCMP-E55 PE=2 SV=1 Back     alignment and function description
>sp|Q1PEU4|PP201_ARATH Pentatricopeptide repeat-containing protein At2g44880 OS=Arabidopsis thaliana GN=PCMP-E9 PE=2 SV=2 Back     alignment and function description
>sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E75 PE=2 SV=1 Back     alignment and function description
>sp|Q9MA50|PPR13_ARATH Pentatricopeptide repeat-containing protein At1g05750, chloroplastic OS=Arabidopsis thaliana GN=PDE247 PE=2 SV=1 Back     alignment and function description
>sp|Q38959|PP257_ARATH Pentatricopeptide repeat-containing protein At3g26630, chloroplastic OS=Arabidopsis thaliana GN=PCMP-A6 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFG8|PP417_ARATH Pentatricopeptide repeat-containing protein At5g44230 OS=Arabidopsis thaliana GN=PCMP-H17 PE=2 SV=1 Back     alignment and function description
>sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
356528966 712 PREDICTED: putative pentatricopeptide re 0.928 0.199 0.529 6e-47
255553251 512 pentatricopeptide repeat-containing prot 0.928 0.277 0.545 1e-46
449436619 723 PREDICTED: putative pentatricopeptide re 0.928 0.196 0.502 2e-45
449491161 744 PREDICTED: LOW QUALITY PROTEIN: putative 0.928 0.190 0.502 2e-45
357468161 874 Pentatricopeptide repeat-containing prot 0.928 0.162 0.497 2e-44
224134923 635 predicted protein [Populus trichocarpa] 0.908 0.218 0.505 2e-42
225442904 724 PREDICTED: putative pentatricopeptide re 0.928 0.196 0.497 3e-41
15233234 687 pentatricopeptide repeat-containing prot 0.928 0.206 0.449 1e-36
9294596 695 unnamed protein product [Arabidopsis tha 0.928 0.204 0.449 1e-36
413947530 649 hypothetical protein ZEAMMB73_142662 [Ze 0.928 0.218 0.427 7e-34
>gi|356528966|ref|XP_003533068.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Glycine max] Back     alignment and taxonomy information
 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 99/187 (52%), Positives = 119/187 (63%), Gaps = 45/187 (24%)

Query: 1   MKNKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLF 60
           MKN+DVISWT IV+G+ N GQ+D+AR+YF Q+PERDYV WTAMIDGYLR+NRF EAL LF
Sbjct: 269 MKNRDVISWTSIVTGFANIGQIDLARKYFDQIPERDYVSWTAMIDGYLRMNRFIEALALF 328

Query: 61  PEMQTSNIRPDEFTIVRILTAY---------------------------------MYCKC 87
            EMQ SN++PDEFT+V ILTA                                  MY KC
Sbjct: 329 REMQMSNVKPDEFTMVSILTACAHLGALELGEWVKTYIDKNSIKNDTFVGNALIDMYFKC 388

Query: 88  GDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPF------------PTIRPDEVTYVGVL 135
           G+V KA++V ++M  KDKFTWTAMIVGLAI+                +I PDE+TY+GVL
Sbjct: 389 GNVGKAKKVFKEMHHKDKFTWTAMIVGLAINGHGEEALAMFSNMIEASITPDEITYIGVL 448

Query: 136 SACTHNG 142
            ACTH G
Sbjct: 449 CACTHAG 455




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255553251|ref|XP_002517668.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543300|gb|EEF44832.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449436619|ref|XP_004136090.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449491161|ref|XP_004158817.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g15930-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357468161|ref|XP_003604365.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355505420|gb|AES86562.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224134923|ref|XP_002327523.1| predicted protein [Populus trichocarpa] gi|222836077|gb|EEE74498.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225442904|ref|XP_002264123.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15233234|ref|NP_188214.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546758|sp|Q9LSB8.2|PP235_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g15930 gi|332642227|gb|AEE75748.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9294596|dbj|BAB02877.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413947530|gb|AFW80179.1| hypothetical protein ZEAMMB73_142662 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
TAIR|locus:2041198 681 SLO1 "SLOW GROWTH 1" [Arabidop 0.529 0.118 0.456 4.2e-26
TAIR|locus:2054966 555 AHG11 "ABA hypersensitive germ 0.529 0.145 0.439 2.9e-25
TAIR|locus:2093920 687 AT3G15930 "AT3G15930" [Arabido 0.764 0.170 0.462 2.2e-22
TAIR|locus:2205200 741 OTP82 "AT1G08070" [Arabidopsis 0.601 0.124 0.382 1.2e-20
TAIR|locus:2206164 570 AT1G31430 [Arabidopsis thalian 0.764 0.205 0.404 1.1e-18
TAIR|locus:505006163 761 AT1G32415 "AT1G32415" [Arabido 0.718 0.144 0.379 5.9e-16
TAIR|locus:2057986 625 AT2G36980 [Arabidopsis thalian 0.620 0.152 0.278 7.9e-08
TAIR|locus:2044797 627 AT2G35030 [Arabidopsis thalian 0.699 0.170 0.407 3.3e-16
TAIR|locus:2198678 500 PDE247 "pigment defective 247" 0.529 0.162 0.432 8.9e-16
TAIR|locus:2032955 790 AT1G25360 "AT1G25360" [Arabido 0.673 0.130 0.301 6.6e-08
TAIR|locus:2041198 SLO1 "SLOW GROWTH 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 211 (79.3 bits), Expect = 4.2e-26, Sum P(2) = 4.2e-26
 Identities = 37/81 (45%), Positives = 57/81 (70%)

Query:     1 MKNKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLF 60
             ++ + ++SWT ++SGY   G +D++R+ F  M E+D VLW AMI G ++  R ++AL LF
Sbjct:   318 LEKRTIVSWTTMISGYARCGLLDVSRKLFDDMEEKDVVLWNAMIGGSVQAKRGQDALALF 377

Query:    61 PEMQTSNIRPDEFTIVRILTA 81
              EMQTSN +PDE T++  L+A
Sbjct:   378 QEMQTSNTKPDEITMIHCLSA 398


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2054966 AHG11 "ABA hypersensitive germination 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093920 AT3G15930 "AT3G15930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206164 AT1G31430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006163 AT1G32415 "AT1G32415" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057986 AT2G36980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044797 AT2G35030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198678 PDE247 "pigment defective 247" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032955 AT1G25360 "AT1G25360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_scaffold_44000037
hypothetical protein (635 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-18
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-18
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-16
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-16
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-13
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-11
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-07
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.003
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score = 80.7 bits (199), Expect = 2e-18
 Identities = 52/183 (28%), Positives = 80/183 (43%), Gaps = 46/183 (25%)

Query: 5   DVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFRE-ALTLFPEM 63
           DV     ++  Y++ G    A + F++M  +D V WTAMI GY + N   + AL  +  M
Sbjct: 322 DVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEK-NGLPDKALETYALM 380

Query: 64  QTSNIRPDEFTIVRILTA------------------------Y---------MYCKCGDV 90
           +  N+ PDE TI  +L+A                        Y         MY KC  +
Sbjct: 381 EQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCI 440

Query: 91  EKAQRVLRKMLRKDKFTWTAMIVGLAISDP-----------FPTIRPDEVTYVGVLSACT 139
           +KA  V   +  KD  +WT++I GL +++              T++P+ VT +  LSAC 
Sbjct: 441 DKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLLTLKPNSVTLIAALSACA 500

Query: 140 HNG 142
             G
Sbjct: 501 RIG 503


Length = 857

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.97
PLN03077 857 Protein ECB2; Provisional 99.97
PLN03218 1060 maturation of RBCL 1; Provisional 99.96
PLN03077 857 Protein ECB2; Provisional 99.96
PLN03218 1060 maturation of RBCL 1; Provisional 99.96
PF1304150 PPR_2: PPR repeat family 99.67
PF1304150 PPR_2: PPR repeat family 99.56
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.21
PF1285434 PPR_1: PPR repeat 99.18
PF1285434 PPR_1: PPR repeat 99.18
PRK11788389 tetratricopeptide repeat protein; Provisional 99.14
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.11
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.11
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.97
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.96
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.92
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.82
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.68
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.65
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.62
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.5
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.48
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.45
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.36
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.35
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.33
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.31
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.3
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.3
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.28
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.27
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.27
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.21
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.19
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.13
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.1
PRK12370553 invasion protein regulator; Provisional 98.1
PRK11189296 lipoprotein NlpI; Provisional 98.08
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.06
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.04
KOG1126638 consensus DNA-binding cell division cycle control 98.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.03
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.01
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.01
PRK15359144 type III secretion system chaperone protein SscB; 97.93
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.9
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.89
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 97.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.87
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.87
PRK15359144 type III secretion system chaperone protein SscB; 97.87
PRK11189296 lipoprotein NlpI; Provisional 97.86
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.85
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.85
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.82
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.79
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.79
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.78
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.76
PRK12370553 invasion protein regulator; Provisional 97.72
PRK10370198 formate-dependent nitrite reductase complex subuni 97.71
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.71
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 97.69
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.67
PRK14574 822 hmsH outer membrane protein; Provisional 97.65
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.63
PRK14574 822 hmsH outer membrane protein; Provisional 97.56
PRK10370198 formate-dependent nitrite reductase complex subuni 97.56
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.55
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 97.55
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.51
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.51
KOG2003 840 consensus TPR repeat-containing protein [General f 97.51
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.5
KOG1129478 consensus TPR repeat-containing protein [General f 97.46
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.44
KOG1126638 consensus DNA-binding cell division cycle control 97.42
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.39
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.35
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.32
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.29
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.28
KOG2003 840 consensus TPR repeat-containing protein [General f 97.27
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.26
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.26
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.23
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.23
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.21
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.2
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.16
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 97.16
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.14
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.13
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.13
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.13
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.13
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.12
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.07
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.06
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.03
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.01
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.99
KOG2076 895 consensus RNA polymerase III transcription factor 96.94
PF12688120 TPR_5: Tetratrico peptide repeat 96.93
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.86
KOG3941 406 consensus Intermediate in Toll signal transduction 96.86
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.84
KOG1129478 consensus TPR repeat-containing protein [General f 96.79
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.71
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.71
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.66
cd05804355 StaR_like StaR_like; a well-conserved protein foun 96.65
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.58
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.56
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.56
KOG0547606 consensus Translocase of outer mitochondrial membr 96.53
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.52
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.52
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.48
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.44
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.37
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.34
KOG3785557 consensus Uncharacterized conserved protein [Funct 96.34
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.3
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.28
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.24
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.23
PF1337173 TPR_9: Tetratricopeptide repeat 96.19
KOG3785557 consensus Uncharacterized conserved protein [Funct 96.17
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.16
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.08
PRK10803263 tol-pal system protein YbgF; Provisional 95.97
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.94
PRK10803263 tol-pal system protein YbgF; Provisional 95.86
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.86
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 95.85
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 95.83
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.79
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 95.77
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.72
PF13512142 TPR_18: Tetratricopeptide repeat 95.66
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.66
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 95.56
PF13762145 MNE1: Mitochondrial splicing apparatus component 95.54
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 95.5
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 95.49
PF1337173 TPR_9: Tetratricopeptide repeat 95.46
COG3629280 DnrI DNA-binding transcriptional activator of the 95.42
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.39
KOG1128 777 consensus Uncharacterized conserved protein, conta 95.38
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.36
KOG1125579 consensus TPR repeat-containing protein [General f 95.3
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 95.25
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 95.22
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 95.22
KOG1128 777 consensus Uncharacterized conserved protein, conta 95.21
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.06
KOG3941 406 consensus Intermediate in Toll signal transduction 94.99
PF12688120 TPR_5: Tetratrico peptide repeat 94.97
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 94.91
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.91
PRK14720 906 transcript cleavage factor/unknown domain fusion p 94.85
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 94.81
KOG2047 835 consensus mRNA splicing factor [RNA processing and 94.69
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 94.51
KOG2376 652 consensus Signal recognition particle, subunit Srp 94.44
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.22
KOG2047 835 consensus mRNA splicing factor [RNA processing and 94.08
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.0
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 93.97
PRK14720 906 transcript cleavage factor/unknown domain fusion p 93.9
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.86
KOG2076 895 consensus RNA polymerase III transcription factor 93.77
KOG4162799 consensus Predicted calmodulin-binding protein [Si 93.62
KOG0547 606 consensus Translocase of outer mitochondrial membr 93.54
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 93.49
KOG3060 289 consensus Uncharacterized conserved protein [Funct 93.43
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.25
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.15
KOG0553 304 consensus TPR repeat-containing protein [General f 93.0
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.97
PLN02789 320 farnesyltranstransferase 92.95
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.87
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.72
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 92.71
KOG4570 418 consensus Uncharacterized conserved protein [Funct 92.65
smart00299140 CLH Clathrin heavy chain repeat homology. 92.35
COG4235287 Cytochrome c biogenesis factor [Posttranslational 92.35
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.04
PRK10153517 DNA-binding transcriptional activator CadC; Provis 92.03
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 91.98
KOG2796366 consensus Uncharacterized conserved protein [Funct 91.88
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 91.86
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 91.68
PRK15331165 chaperone protein SicA; Provisional 91.64
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 91.63
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 91.49
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.26
KOG0553304 consensus TPR repeat-containing protein [General f 91.15
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.04
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 91.0
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 90.98
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 90.46
PF1342844 TPR_14: Tetratricopeptide repeat 90.38
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.36
COG3629280 DnrI DNA-binding transcriptional activator of the 90.34
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 90.18
KOG0495 913 consensus HAT repeat protein [RNA processing and m 90.06
KOG4340 459 consensus Uncharacterized conserved protein [Funct 89.96
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.67
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 89.6
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.33
PRK10564303 maltose regulon periplasmic protein; Provisional 88.99
COG1729262 Uncharacterized protein conserved in bacteria [Fun 88.95
PF1342844 TPR_14: Tetratricopeptide repeat 88.91
KOG4570 418 consensus Uncharacterized conserved protein [Funct 88.74
KOG1125579 consensus TPR repeat-containing protein [General f 88.72
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 88.64
KOG0495 913 consensus HAT repeat protein [RNA processing and m 87.85
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 87.7
PRK04841 903 transcriptional regulator MalT; Provisional 87.65
COG1729262 Uncharacterized protein conserved in bacteria [Fun 87.63
PRK15331165 chaperone protein SicA; Provisional 87.18
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.02
KOG3060289 consensus Uncharacterized conserved protein [Funct 86.9
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 86.83
smart00299140 CLH Clathrin heavy chain repeat homology. 86.7
KOG2041 1189 consensus WD40 repeat protein [General function pr 86.65
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 86.39
COG4700251 Uncharacterized protein conserved in bacteria cont 86.36
PLN02789320 farnesyltranstransferase 86.26
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 86.22
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 86.17
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 85.82
COG3118304 Thioredoxin domain-containing protein [Posttransla 85.03
KOG2376 652 consensus Signal recognition particle, subunit Srp 85.02
PF1343134 TPR_17: Tetratricopeptide repeat 84.85
PF13281374 DUF4071: Domain of unknown function (DUF4071) 84.64
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 83.45
PF13934226 ELYS: Nuclear pore complex assembly 83.4
PF13170 297 DUF4003: Protein of unknown function (DUF4003) 83.28
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 83.26
COG4700251 Uncharacterized protein conserved in bacteria cont 83.25
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 83.21
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.72
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.61
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 82.52
COG4455 273 ImpE Protein of avirulence locus involved in tempe 82.46
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 82.37
KOG2610 491 consensus Uncharacterized conserved protein [Funct 82.15
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 81.74
PF0374562 DUF309: Domain of unknown function (DUF309); Inter 80.97
COG3947361 Response regulator containing CheY-like receiver a 80.92
PF13929292 mRNA_stabil: mRNA stabilisation 80.62
COG4455 273 ImpE Protein of avirulence locus involved in tempe 80.52
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 80.26
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.2e-32  Score=219.94  Aligned_cols=150  Identities=31%  Similarity=0.521  Sum_probs=134.2

Q ss_pred             CCchhHHHHHHHHHHhcCChHHHHHHHHhCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHhhCCCCCChhHHHHHHHHH
Q 035927            3 NKDVISWTDIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFPEMQTSNIRPDEFTIVRILTAY   82 (153)
Q Consensus         3 ~pd~~~~~~li~~~~~~g~~~~a~~l~~~m~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~t~~~li~~~   82 (153)
                      .||..+||+||++|++.|++++|.++|++|.++|..+||+||.+|++.|+.++|+++|++|++.|++||..||+++|.+|
T Consensus       256 ~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~  335 (697)
T PLN03081        256 VGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIF  335 (697)
T ss_pred             CccceeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHH
Confidence            46777888888888888888888888888888888888888888888888888888888888888888888888888877


Q ss_pred             ---------------------------------HHhccCChHHHHHHHHhcccCChhhHHHHHHHHHhcCCCC-------
Q 035927           83 ---------------------------------MYCKCGDVEKAQRVLRKMLRKDKFTWTAMIVGLAISDPFP-------  122 (153)
Q Consensus        83 ---------------------------------~~~~~g~~~~a~~~~~~m~~~~~~~~~~li~~~~~~~~~~-------  122 (153)
                                                       +|+++|++++|.++|++|.++|+.+||+||.+|++.|..+       
T Consensus       336 ~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~  415 (697)
T PLN03081        336 SRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFE  415 (697)
T ss_pred             HhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHH
Confidence                                             7899999999999999999999999999999999998877       


Q ss_pred             -----CCCCCHhHHHHHHHHHhcCCchhHhhhhcc
Q 035927          123 -----TIRPDEVTYVGVLSACTHNGNETFVINSCN  152 (153)
Q Consensus       123 -----~~~p~~~t~~~ll~~~~~~g~~~~a~~~~~  152 (153)
                           |+.||..||++++.+|++.|..++|.++|+
T Consensus       416 ~M~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~  450 (697)
T PLN03081        416 RMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQ  450 (697)
T ss_pred             HHHHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHH
Confidence                 999999999999999999999999999885



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13934 ELYS: Nuclear pore complex assembly Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF03745 DUF309: Domain of unknown function (DUF309); InterPro: IPR005500 This family consists of eubacterial and archaebacterial proteins of unknown function Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 48.3 bits (113), Expect = 2e-07
 Identities = 14/108 (12%), Positives = 36/108 (33%), Gaps = 10/108 (9%)

Query: 5   DVISWTDIVSGYINRGQVDIARQYFAQMPER-------DYVLWTAMIDGYLRVNRFREAL 57
                       +   Q+ +A         +          ++ A++ G+ R   F+E +
Sbjct: 126 QQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELV 185

Query: 58  TLFPEMQTSNIRPDEFTIVRILTAYMYCKCG-DVEKAQRVLRKMLRKD 104
            +   ++ + + PD  +    L      +   D    +R L +M ++ 
Sbjct: 186 YVLFMVKDAGLTPDLLSYAAAL--QCMGRQDQDAGTIERCLEQMSQEG 231


>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.91
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.8
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.6
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.55
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.17
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.14
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.14
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.06
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.05
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.03
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 98.99
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.98
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 98.97
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.92
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.91
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.91
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.9
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.89
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 98.89
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.86
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.81
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.8
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.79
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.79
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.76
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.74
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.73
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.72
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.7
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.7
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.66
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.64
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.64
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.63
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.61
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.61
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.6
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.56
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.55
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.52
3u4t_A272 TPR repeat-containing protein; structural genomics 98.51
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 98.51
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.5
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.48
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.48
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.48
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.46
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.45
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.41
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.4
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.39
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.38
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.36
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.35
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.34
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.31
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.29
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.29
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.29
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.27
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.27
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.27
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.26
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.26
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.24
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.23
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.22
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.22
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.21
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.19
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.18
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.17
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.15
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.14
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.13
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.12
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.1
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.08
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.07
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.03
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.02
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.01
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.01
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.99
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.97
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.96
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.95
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.94
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.94
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.94
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.92
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.92
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.92
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.91
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.91
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.91
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.91
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.9
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.9
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.89
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.89
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.86
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.84
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.84
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.84
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.84
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.82
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.82
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 97.82
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.82
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.81
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.81
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.81
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.81
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.8
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.78
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.78
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.77
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.76
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.76
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.73
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.71
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.68
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.64
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.64
4g1t_A 472 Interferon-induced protein with tetratricopeptide 97.63
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.63
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.62
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.6
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.59
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.58
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.54
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.54
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.54
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.53
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.52
4g1t_A472 Interferon-induced protein with tetratricopeptide 97.48
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.46
3k9i_A117 BH0479 protein; putative protein binding protein, 97.43
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.41
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.36
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.35
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.34
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.33
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.31
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.3
3k9i_A117 BH0479 protein; putative protein binding protein, 97.3
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.26
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.25
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.21
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.19
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.19
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.19
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.13
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.02
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.98
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.96
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.9
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.89
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.86
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.86
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.75
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.75
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.75
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.74
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.73
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 96.71
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.66
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.59
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 96.46
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.45
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 96.41
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.36
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.05
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 95.95
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 95.75
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.73
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.69
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.16
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.02
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.62
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 94.4
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 94.31
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 94.28
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.16
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 94.05
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.01
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.73
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.71
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.57
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 92.97
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 92.75
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 92.36
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 92.03
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.02
1klx_A138 Cysteine rich protein B; structural genomics, heli 91.75
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 91.63
1pc2_A152 Mitochondria fission protein; unknown function; NM 90.96
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.87
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.16
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 89.45
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 89.37
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 88.04
1pc2_A152 Mitochondria fission protein; unknown function; NM 87.34
2p58_C116 Putative type III secretion protein YSCG; type III 87.3
2uwj_G115 Type III export protein PSCG; virulence, chaperone 87.15
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 87.02
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 86.88
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 85.97
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 85.9
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 85.31
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 85.25
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 84.89
2uwj_G115 Type III export protein PSCG; virulence, chaperone 84.54
2p58_C116 Putative type III secretion protein YSCG; type III 84.09
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 83.96
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 83.38
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 83.29
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 81.5
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=99.97  E-value=7.4e-31  Score=203.16  Aligned_cols=145  Identities=12%  Similarity=0.153  Sum_probs=135.8

Q ss_pred             hhHHHHHHHHHHhcCChHHHHHHHHhCC----CCCHHHHHHHHHHHHhcCC---------hHHHHHHHHHHhhCCCCCCh
Q 035927            6 VISWTDIVSGYINRGQVDIARQYFAQMP----ERDYVLWTAMIDGYLRVNR---------FREALTLFPEMQTSNIRPDE   72 (153)
Q Consensus         6 ~~~~~~li~~~~~~g~~~~a~~l~~~m~----~~~~~~~~~li~~~~~~~~---------~~~a~~~~~~m~~~~~~p~~   72 (153)
                      ...++.+|++|++.|++++|.++|++|.    +||..+||+||.+|++.+.         +++|.++|++|++.|+.||.
T Consensus        26 e~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd~  105 (501)
T 4g26_A           26 EALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPNE  105 (501)
T ss_dssp             HHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCCH
T ss_pred             HHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCCH
Confidence            3468899999999999999999999997    5899999999999997654         68999999999999999999


Q ss_pred             hHHHHHHHHHHHhccCChHHHHHHHHhcc----cCChhhHHHHHHHHHhcCCCC------------CCCCCHhHHHHHHH
Q 035927           73 FTIVRILTAYMYCKCGDVEKAQRVLRKML----RKDKFTWTAMIVGLAISDPFP------------TIRPDEVTYVGVLS  136 (153)
Q Consensus        73 ~t~~~li~~~~~~~~g~~~~a~~~~~~m~----~~~~~~~~~li~~~~~~~~~~------------~~~p~~~t~~~ll~  136 (153)
                      .||+++|.+  |++.|++++|.++|++|.    .||..+||++|.+|++.|.++            |+.||..||++||.
T Consensus       106 ~tyn~lI~~--~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~  183 (501)
T 4g26_A          106 ATFTNGARL--AVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLK  183 (501)
T ss_dssp             HHHHHHHHH--HHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHH
T ss_pred             HHHHHHHHH--HHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHH
Confidence            999999999  599999999999999996    469999999999999999888            99999999999999


Q ss_pred             HHhcCCchhHhhhhcc
Q 035927          137 ACTHNGNETFVINSCN  152 (153)
Q Consensus       137 ~~~~~g~~~~a~~~~~  152 (153)
                      +|++.|+.++|.++|+
T Consensus       184 ~~~~~g~~d~A~~ll~  199 (501)
T 4g26_A          184 VSMDTKNADKVYKTLQ  199 (501)
T ss_dssp             HHHHTTCHHHHHHHHH
T ss_pred             HHhhCCCHHHHHHHHH
Confidence            9999999999999874



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.81
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.68
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.53
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.31
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.29
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.27
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.21
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.13
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 98.12
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.11
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.01
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.92
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 97.87
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.86
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 97.83
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.79
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.79
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.63
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.59
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.57
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 97.53
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.35
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.32
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.27
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.24
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.23
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.12
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.12
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.05
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.03
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.88
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.88
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.74
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.68
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.68
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.64
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.54
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.06
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.7
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.47
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.34
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.25
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.08
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 94.66
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 93.85
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 93.52
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.0
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 90.27
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 88.18
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 86.35
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 85.01
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 83.71
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.81  E-value=6.9e-08  Score=68.31  Aligned_cols=145  Identities=10%  Similarity=0.028  Sum_probs=97.5

Q ss_pred             chhHHHHHHHHHHhcCChHHHHHHHHhCC---CCCHHHHHHHHHHHHhcCChHHHHHHHHHHhhCCCCCChhHHHHHHHH
Q 035927            5 DVISWTDIVSGYINRGQVDIARQYFAQMP---ERDYVLWTAMIDGYLRVNRFREALTLFPEMQTSNIRPDEFTIVRILTA   81 (153)
Q Consensus         5 d~~~~~~li~~~~~~g~~~~a~~l~~~m~---~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~t~~~li~~   81 (153)
                      +...|..+...+...|++++|...+.+..   ..+...+..+...+.+.|++++|...+++..+.. +-+..++..+...
T Consensus       202 ~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~  280 (388)
T d1w3ba_         202 FLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANA  280 (388)
T ss_dssp             CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHH
T ss_pred             cHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHH
Confidence            34456677777777777777777777654   2355667777777777777777877777776542 1234455555555


Q ss_pred             HHHhccCChHHHHHHHHhccc---CChhhHHHHHHHHHhcCCCC----------CCCCC-HhHHHHHHHHHhcCCchhHh
Q 035927           82 YMYCKCGDVEKAQRVLRKMLR---KDKFTWTAMIVGLAISDPFP----------TIRPD-EVTYVGVLSACTHNGNETFV  147 (153)
Q Consensus        82 ~~~~~~g~~~~a~~~~~~m~~---~~~~~~~~li~~~~~~~~~~----------~~~p~-~~t~~~ll~~~~~~g~~~~a  147 (153)
                        |.+.|++++|++.++...+   .+...+..+...+...|.++          .+.|+ ...+..+...+.+.|++++|
T Consensus       281 --~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A  358 (388)
T d1w3ba_         281 --LKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEA  358 (388)
T ss_dssp             --HHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHH
T ss_pred             --HHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHH
Confidence              5777777777777776643   25566667777777766666          45565 45577777888888888888


Q ss_pred             hhhcc
Q 035927          148 INSCN  152 (153)
Q Consensus       148 ~~~~~  152 (153)
                      .+.|+
T Consensus       359 ~~~~~  363 (388)
T d1w3ba_         359 LMHYK  363 (388)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            77663



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure