Citrus Sinensis ID: 035988

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690--
METEEILQELENVEAEVRLVQEQIKQLVDRQDQLYERQSELKSLLEAFEASRGSPIQYGGSSSTAVENWSGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFCMVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQLIIDRVLVRIGPFSPGKKIIKLEISSVQKNTADNKKSTKRSLTSSALEFELDELRKELASISGGILPHSVLSSQLIRLISARKPSTMEEASSNHLEKIIGKLKTGKYGSRILEVISKCGNSEQQHDNNAVSKEEQGRDARASKRTKKEKAVVVVDSSDDSEV
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHccccEEEEEccccccHHHHHHccccccccEEEEcHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccHHHcccHHHHHHHcccccccHHcccccHHHHHHHHHHccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccEEEEEcccccccHHHHHcccccccccccccEEEccccccHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHccHHHHHccccccccEEEEEEcHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEccccccc
cccHHHHHHHHHccHHHHHHHHHccccHcHHHHHHHHHHccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHcccHcccccHHHHHHHHHccccEEEEEcccccccHHEHcHHHHccccEEEEcHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHccccEEEEEEccHHHcccHHHHHHHHHHHHHcccEEEEEEcHHHHccccccccHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHcccccEEEEEccccccEEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHccccccHHcccccHHHHHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEEcccccHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccHHHHHHHHHHHHHccccEEccccccEEEEccHHHHccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccEEEEEccccccc
METEEILQELENVEAEVRLVQEQIKQLVDRQDQLYERQSELKSLLEAFEasrgspiqyggssstavenwsgtfewdsraddvrlnvfgipayrANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALgipahmltsttskeDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLekchhagrlslisideahccsqwghdfrpdyknlgilktqfpdvpmmaLTATATQKVQNDLMEMLHIRKCIKFVstinrpnlFYMVREKSSVGKVVIDEIAKYIQesypnsesgivyCFSRKECEQVAQELRQRGisadyyhadmdiNAREKVHMRWSKNKLQVIVGTVAfgmginkpdVRFVIHHSLSKSVETYYQEsgragrdglpsecllffrpadvprqssmvfyensglqnlydivrysqyplhwniEKVRLVIFEKLQQVNLFCMVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQLIIDRVlvrigpfspgkkIIKLEISSVQkntadnkkstkrSLTSSALEFELDELRKELASisggilphsvLSSQLIRLIsarkpstmeeaSSNHLEKIIGKLKTGKYGSRILEVISKcgnseqqhdnnavskeeqgrdaraskrtkkEKAVVVVdssddsev
METEEILQELENVEAEVRLVQEQIKQLVDRQDQLYERQSELKSLLEAFEAsrgspiqyggssstavENWSGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHmltsttskedEKFIYKALekgegelkmlYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKyiqesypnseSGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFCMVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQLIidrvlvrigpfspgkkiIKLEissvqkntadnkkstkrsltssaLEFELDELRKELASIsggilphsvlsSQLIRLISARkpstmeeassnhLEKIIGKLKTGKYGSRILEVISkcgnseqqhdnnavskeeqgrdaraskrtkkekavvvvdssddsev
METEEILQELENVEAEVRLVQEQIKQLVDRQDQLYERQSELKSLLEAFEASRGSPIQYGGSSSTAVENWSGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFCMVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQLIIDRVLVRIGPFSPGKKIIKLEISSVQKNTADNKKSTKRSLTSSALEFELDELRKELASISGGILPHSVLSSQLIRLISARKPSTMEEASSNHLEKIIGKLKTGKYGSRILEVISKCGNSEQQHDNNAVSKEEQGRDARASKRTKKEKAvvvvdssddsEV
******************LV********************************************AVENWSGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFCMVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQLIIDRVLVRIGPFSPGKKIIKLEI*********************************LASISGGILPHSVLSSQLIRLI*****************KIIGKLKTGKYGSRILEVISK*********************************************
******L*ELENVEAEVRLVQ***************************************************FEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSM*********NLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFCMVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQLIIDRVLVRIGPFSPGKKII****************************FELDELRKELASISGGILPHSVLSSQLIRLISARKPSTMEEASSNHLEKIIGKLKTGKYGSRILEVISK*********************************************
METEEILQELENVEAEVRLVQEQIKQLVDRQDQLYERQSELKSLLEAFEASRGSPI*********VENWSGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFCMVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQLIIDRVLVRIGPFSPGKKIIKLEISSV**************LTSSALEFELDELRKELASISGGILPHSVLSSQLIRLISAR**********NHLEKIIGKLKTGKYGSRILEVISKCG*******************************************
****EILQELENVEAEVRLVQEQIKQLVDRQDQLYERQSELKSLLEAFEA*******************SGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFCMVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQLIIDRVLVRIGPFSPGKKIIKLEISSVQKNTADNKKSTKRSLTSSALEFELDELRKELASISGGILPHSVLSSQLIRLISARKPSTMEEASSNHLEKIIGKLKTGKYGSRILEVISKCGNSEQQ***********G*DARA*****KEKA************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQSELKSLLEAFEASRGSPIQYGGSSSTAVENWSGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFCMVVLAGHAQCIISLLQDIQDNNQRLTMLQLxxxxxxxxxxxxxxxxxxxxxQLVLQLIIDRVLVRIGPFSPGKKIIKLEISSVQKNTADNKKSTKRSLTSSALEFELDELRKELASISGGILPHSVLSSQLIRLISARKPSTMEEASSNHLEKIIGKLKTGKYGSRILEVISKCGNSEQQHDNNAVSKEEQGRDARASKRTKKEKAVVVVDSSDDSEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query692 2.2.26 [Sep-21-2011]
Q9FT73705 Mediator of RNA polymeras yes no 0.976 0.958 0.653 0.0
Q6AYJ1621 ATP-dependent DNA helicas yes no 0.832 0.927 0.419 1e-132
Q9Z129648 ATP-dependent DNA helicas yes no 0.783 0.836 0.427 1e-130
Q5RF63649 ATP-dependent DNA helicas yes no 0.776 0.827 0.427 1e-128
P46063649 ATP-dependent DNA helicas yes no 0.776 0.827 0.425 1e-128
A8WK63618 Putative ATP-dependent DN N/A no 0.621 0.695 0.467 1e-118
Q9TXJ8631 Putative ATP-dependent DN yes no 0.621 0.681 0.469 1e-117
Q8L840 1188 ATP-dependent DNA helicas no no 0.518 0.302 0.489 1e-102
Q9VGI8 1487 Bloom syndrome protein ho yes no 0.647 0.301 0.408 1e-100
Q9FT701150 ATP-dependent DNA helicas no no 0.589 0.354 0.454 1e-100
>sp|Q9FT73|MED34_ARATH Mediator of RNA polymerase II transcription subunit 34 OS=Arabidopsis thaliana GN=MED34 PE=1 SV=1 Back     alignment and function desciption
 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/721 (65%), Positives = 565/721 (78%), Gaps = 45/721 (6%)

Query: 1   METEEILQELENVEAEVRLVQEQIKQLVDRQDQLYERQSELKSLLEAFEASRGSPIQYGG 60
           ME+E I ++L+N++ E++ VQ QI  L++ QD+LYER+SELK+LL+A  AS GSP+   G
Sbjct: 1   MESEAIQEDLQNLDVELKDVQGQISALIEHQDRLYERKSELKTLLKALAAS-GSPVASSG 59

Query: 61  SSSTAVENWSGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKS 120
            SS A+ENWS TFEWDSRADDVR NVFGI  YRANQ+EIINA+++GRDVLVIMAAGGGKS
Sbjct: 60  GSS-AIENWSETFEWDSRADDVRFNVFGISKYRANQKEIINAIMTGRDVLVIMAAGGGKS 118

Query: 121 LCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKG 180
           LCYQLPA+LR G  LVVSPLLSLIQDQVM LAALGI A+MLTST+ KE+EKF+YKALEKG
Sbjct: 119 LCYQLPAMLRGGTTLVVSPLLSLIQDQVMGLAALGISAYMLTSTSGKENEKFVYKALEKG 178

Query: 181 EGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGI 240
           E +LK+LYVTPEK+SKSKRFMSKLEKCH+AGRLSLISIDEAHCCSQWGHDFRPDYKNL I
Sbjct: 179 EDDLKILYVTPEKVSKSKRFMSKLEKCHNAGRLSLISIDEAHCCSQWGHDFRPDYKNLSI 238

Query: 241 LKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVV 300
           LKTQFP VPM+ALTATATQKVQNDL+EMLHI KC+KFVS++NRPNLFY VREKS+VGK+V
Sbjct: 239 LKTQFPKVPMVALTATATQKVQNDLIEMLHIPKCVKFVSSVNRPNLFYSVREKSAVGKLV 298

Query: 301 IDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMR 360
           +DEIA++I+ESY N+ESGIVYCFSRKECEQ+A +LR+RGISADYYHADMD N REKVHMR
Sbjct: 299 VDEIAEFIRESYSNNESGIVYCFSRKECEQIAGDLRERGISADYYHADMDANMREKVHMR 358

Query: 361 WSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFR 420
           WSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKS+ETYYQESGRAGRDGLPSEC+LFFR
Sbjct: 359 WSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSMETYYQESGRAGRDGLPSECILFFR 418

Query: 421 PADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFC------ 474
            ADVPRQSSMVFYE SGLQNLYDIVRY Q               E  Q  N  C      
Sbjct: 419 SADVPRQSSMVFYEYSGLQNLYDIVRYCQSKTKCRRSAFFRHFGEPSQDCNGMCDNCALS 478

Query: 475 ----MVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQ 530
                V ++  ++ ++S++Q+ Q  +QR+TMLQL DK++ K K++ ++LKR+E+E LV++
Sbjct: 479 SEVKEVDVSDLSKLVVSMVQETQAKDQRVTMLQLGDKLRNKHKDLIAELKRDEVEHLVIK 538

Query: 531 LIIDRVL--------------VRIGPFS----PGKKIIKLEISSVQKNTADNKKSTKRSL 572
           LI+D VL              V +GP +     G+K IK+E SS Q       K  KRS+
Sbjct: 539 LIVDSVLKEEFQHTPYSTNAYVTMGPLANQLLQGRKTIKMETSSRQ------TKKLKRSI 592

Query: 573 TSSALEFELDELRKELASISGGILPHSVLSSQLIRLISARKPSTMEEASSNHLEKIIGKL 632
           T S LE +LDELRKE+++  G ILPH+VLS+Q I  IS++KP +++E     LE IIGKL
Sbjct: 593 TFSGLELKLDELRKEISAADGSILPHTVLSTQQIGSISSQKPVSLQE-----LESIIGKL 647

Query: 633 KTGKYGSRIL-EVISKCGNSEQQHDNNAVSKEEQGRDARASKRTKKEKAVVVVDSSDDSE 691
           KT KYG RIL EV+     SEQ  ++   +KEE  + +R  KR K +K VV+V+SS + E
Sbjct: 648 KTEKYGDRILEEVMRHEAVSEQLVEDP--TKEETCK-SRLRKRAKTQKDVVLVESSGEEE 704

Query: 692 V 692
            
Sbjct: 705 A 705
3'-5' DNA helicase that may play a role in the repair of DNA. Exhibits a magnesium-dependent ATP or dATP-dependent DNA-helicase activity. Can use GTP/dGTP, CTP/dCTP or UTP/dUTP as nucleotide cofactors. Catalyzes Holliday junction branch migration and replication fork regression. Disrupts D-loop structures.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=2 SV=1 Back     alignment and function description
>sp|Q9Z129|RECQ1_MOUSE ATP-dependent DNA helicase Q1 OS=Mus musculus GN=Recql PE=1 SV=2 Back     alignment and function description
>sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 Back     alignment and function description
>sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 Back     alignment and function description
>sp|A8WK63|RECQ1_CAEBR Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis briggsae GN=CBG24191 PE=3 SV=1 Back     alignment and function description
>sp|Q9TXJ8|RECQ1_CAEEL Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis elegans GN=K02F3.12 PE=3 SV=3 Back     alignment and function description
>sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 Back     alignment and function description
>sp|Q9VGI8|BLM_DROME Bloom syndrome protein homolog OS=Drosophila melanogaster GN=mus309 PE=1 SV=1 Back     alignment and function description
>sp|Q9FT70|RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query692
359474777711 PREDICTED: ATP-dependent DNA helicase Q- 0.976 0.950 0.712 0.0
296085510710 unnamed protein product [Vitis vinifera] 0.975 0.950 0.709 0.0
224074554718 predicted protein [Populus trichocarpa] 0.991 0.955 0.700 0.0
356531519695 PREDICTED: ATP-dependent DNA helicase Q- 0.963 0.959 0.683 0.0
255557667714 DNA helicase recq1, putative [Ricinus co 0.960 0.931 0.678 0.0
297851930704 RECQL2 [Arabidopsis lyrata subsp. lyrata 0.975 0.958 0.649 0.0
30692489705 ATP-dependent DNA helicase Q-like 2 [Ara 0.976 0.958 0.653 0.0
449453437738 PREDICTED: mediator of RNA polymerase II 0.979 0.918 0.629 0.0
357484579685 ATP-dependent DNA helicase RecQ family p 0.945 0.954 0.639 0.0
293332763710 uncharacterized protein LOC100382802 [Ze 0.972 0.947 0.638 0.0
>gi|359474777|ref|XP_002267000.2| PREDICTED: ATP-dependent DNA helicase Q-like 2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/713 (71%), Positives = 591/713 (82%), Gaps = 37/713 (5%)

Query: 5   EILQELENVEAEVRLVQEQIKQLVDRQDQLYERQSELKSLLEAFEASRGSPIQYGGSSST 64
           ++L+EL NVE E++ VQ+QIK L+DRQ++L+ERQSELK+LLEA + S GSP++ G  +S 
Sbjct: 6   DLLEELFNVELELQDVQDQIKNLLDRQEKLHERQSELKTLLEACKGS-GSPVKDG--ASV 62

Query: 65  AVENWSGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQ 124
           AVENWSG F+WD++ADDVR N+FGI  YRANQ+EIINAV+SGRDVLVIMAAGGGKSLCYQ
Sbjct: 63  AVENWSGPFDWDAQADDVRFNIFGISTYRANQREIINAVMSGRDVLVIMAAGGGKSLCYQ 122

Query: 125 LPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGEL 184
           LPA+LR+G+ALVVSPLLSLIQDQVM LAALGIPA+MLTSTTSKEDEKFIYKALEKG+G+L
Sbjct: 123 LPAILRDGVALVVSPLLSLIQDQVMGLAALGIPAYMLTSTTSKEDEKFIYKALEKGDGDL 182

Query: 185 KMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQ 244
           K+LYVTPEKISKSKRF+SKLEKCHH+G LSLISIDEAHCCSQWGHDFRPDYKNLGILKTQ
Sbjct: 183 KILYVTPEKISKSKRFVSKLEKCHHSGCLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQ 242

Query: 245 FPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEI 304
           FPDVP++ALTATAT+KVQNDLMEMLHI KCIKFVST+NRPNLFYMVREKSSVG+VVIDEI
Sbjct: 243 FPDVPVVALTATATKKVQNDLMEMLHIPKCIKFVSTVNRPNLFYMVREKSSVGRVVIDEI 302

Query: 305 AKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKN 364
           A+YIQESYPN+ESGIVYCFSRKECEQVA+ELR+RGISADYYHADMD+NARE+VH+RWS +
Sbjct: 303 AEYIQESYPNNESGIVYCFSRKECEQVAKELRERGISADYYHADMDVNARERVHLRWSNS 362

Query: 365 KLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADV 424
           KLQVIVGTVAFGMGINKPDVRFVIHHSLSKS+ETYYQESGRAGRDGLPSECLL+FRP DV
Sbjct: 363 KLQVIVGTVAFGMGINKPDVRFVIHHSLSKSMETYYQESGRAGRDGLPSECLLYFRPGDV 422

Query: 425 PRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFC---------- 474
           PRQSSMVFYENSGLQNLYDIV+Y Q               E LQ  N  C          
Sbjct: 423 PRQSSMVFYENSGLQNLYDIVQYCQSKRECRRNAFFRHFAEPLQDCNGMCDNCAFSTEVK 482

Query: 475 MVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQLIID 534
            V ++  A+ +ISLLQD+QDN+QRLTMLQ+VDKMK+K K++ SDL++EEIE LV+QLI D
Sbjct: 483 EVDVSCLAKAMISLLQDMQDNDQRLTMLQMVDKMKVKNKDLGSDLRKEEIEHLVIQLIRD 542

Query: 535 RVL--------------VRIGPF----SPGKKIIKLEISSVQKNTADNKKSTKRSLTSSA 576
           RVL              V +G      S GK+I+KLEIS+  K    N KS+KRSLTSS 
Sbjct: 543 RVLKEEFQHTAYATNAYVTLGLLWKQVSHGKRIVKLEISTKVKTKTGNMKSSKRSLTSSG 602

Query: 577 LEFELDELRKELASISGGILPHSVLSSQLIRLISARKPSTMEEASSNHLEKIIGKLKTGK 636
           LE +LDELRKEL+S  GGI PHSVLS+Q I ++SA+KP+++ E     LE +IGKLKT K
Sbjct: 603 LELKLDELRKELSSTHGGIFPHSVLSTQQISILSAQKPTSILE-----LETMIGKLKTEK 657

Query: 637 YGSRILEVISKCGNSEQQHDNNAVSKEEQGRDARASKRTKKEKAVVVVDSSDD 689
           YGS+ILE I+K   +EQ  +N   + E QG + RA KR K  KAVV+++SS D
Sbjct: 658 YGSKILEEIAKYTETEQP-ENRLKTDEGQGSENRAPKRLKSNKAVVLIESSGD 709

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296085510|emb|CBI29242.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224074554|ref|XP_002304389.1| predicted protein [Populus trichocarpa] gi|222841821|gb|EEE79368.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356531519|ref|XP_003534325.1| PREDICTED: ATP-dependent DNA helicase Q-like 2-like [Glycine max] Back     alignment and taxonomy information
>gi|255557667|ref|XP_002519863.1| DNA helicase recq1, putative [Ricinus communis] gi|223540909|gb|EEF42467.1| DNA helicase recq1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297851930|ref|XP_002893846.1| RECQL2 [Arabidopsis lyrata subsp. lyrata] gi|297339688|gb|EFH70105.1| RECQL2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30692489|ref|NP_174421.2| ATP-dependent DNA helicase Q-like 2 [Arabidopsis thaliana] gi|75334308|sp|Q9FT73.1|MED34_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 34; AltName: Full=ATP-dependent DNA helicase Q-like 2; AltName: Full=RecQ-like protein 2; Short=AtRecQ2; Short=AtRecQl2 gi|11121445|emb|CAC14866.1| DNA Helicase [Arabidopsis thaliana] gi|332193225|gb|AEE31346.1| ATP-dependent DNA helicase Q-like 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449453437|ref|XP_004144464.1| PREDICTED: mediator of RNA polymerase II transcription subunit 34-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357484579|ref|XP_003612577.1| ATP-dependent DNA helicase RecQ family protein expressed [Medicago truncatula] gi|355513912|gb|AES95535.1| ATP-dependent DNA helicase RecQ family protein expressed [Medicago truncatula] Back     alignment and taxonomy information
>gi|293332763|ref|NP_001168975.1| uncharacterized protein LOC100382802 [Zea mays] gi|223974195|gb|ACN31285.1| unknown [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query692
TAIR|locus:2197555705 RECQL2 "RECQ helicase L2" [Ara 0.826 0.811 0.684 8.3e-209
UNIPROTKB|F1NPI7661 RECQL "Uncharacterized protein 0.764 0.800 0.451 3.8e-127
RGD|1311071621 Recql "RecQ protein-like (DNA 0.712 0.793 0.458 4.5e-124
UNIPROTKB|Q6AYJ1621 Recql "ATP-dependent DNA helic 0.712 0.793 0.458 4.5e-124
UNIPROTKB|F1PNP1646 RECQL "Uncharacterized protein 0.710 0.761 0.453 5.7e-124
UNIPROTKB|F1SR01649 RECQL "Uncharacterized protein 0.706 0.753 0.447 1.9e-122
UNIPROTKB|P46063649 RECQL "ATP-dependent DNA helic 0.710 0.758 0.455 5.1e-121
MGI|MGI:103021648 Recql "RecQ protein-like" [Mus 0.712 0.760 0.448 1.1e-120
UNIPROTKB|A0JN36649 RECQL "Uncharacterized protein 0.703 0.750 0.454 1.4e-120
ZFIN|ZDB-GENE-050809-134640 recql "RecQ protein-like (DNA 0.757 0.818 0.419 1.6e-109
TAIR|locus:2197555 RECQL2 "RECQ helicase L2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2019 (715.8 bits), Expect = 8.3e-209, P = 8.3e-209
 Identities = 400/584 (68%), Positives = 475/584 (81%)

Query:     1 METEEILQELENVEAEVRLVQEQIKQLVDRQDQLYERQSELKSLLEAFEASRGSPIQYGG 60
             ME+E I ++L+N++ E++ VQ QI  L++ QD+LYER+SELK+LL+A  AS GSP+   G
Sbjct:     1 MESEAIQEDLQNLDVELKDVQGQISALIEHQDRLYERKSELKTLLKALAAS-GSPVASSG 59

Query:    61 SSSTAVENWSGTFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKS 120
              SS A+ENWS TFEWDSRADDVR NVFGI  YRANQ+EIINA+++GRDVLVIMAAGGGKS
Sbjct:    60 GSS-AIENWSETFEWDSRADDVRFNVFGISKYRANQKEIINAIMTGRDVLVIMAAGGGKS 118

Query:   121 LCYQLPAVLREGIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKG 180
             LCYQLPA+LR G  LVVSPLLSLIQDQVM LAALGI A+MLTST+ KE+EKF+YKALEKG
Sbjct:   119 LCYQLPAMLRGGTTLVVSPLLSLIQDQVMGLAALGISAYMLTSTSGKENEKFVYKALEKG 178

Query:   181 EGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGI 240
             E +LK+LYVTPEK+SKSKRFMSKLEKCH+AGRLSLISIDEAHCCSQWGHDFRPDYKNL I
Sbjct:   179 EDDLKILYVTPEKVSKSKRFMSKLEKCHNAGRLSLISIDEAHCCSQWGHDFRPDYKNLSI 238

Query:   241 LKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVV 300
             LKTQFP VPM+ALTATATQKVQNDL+EMLHI KC+KFVS++NRPNLFY VREKS+VGK+V
Sbjct:   239 LKTQFPKVPMVALTATATQKVQNDLIEMLHIPKCVKFVSSVNRPNLFYSVREKSAVGKLV 298

Query:   301 IDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMR 360
             +DEIA++I+ESY N+ESGIVYCFSRKECEQ+A +LR+RGISADYYHADMD N REKVHMR
Sbjct:   299 VDEIAEFIRESYSNNESGIVYCFSRKECEQIAGDLRERGISADYYHADMDANMREKVHMR 358

Query:   361 WSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFR 420
             WSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKS+ETYYQESGRAGRDGLPSEC+LFFR
Sbjct:   359 WSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSMETYYQESGRAGRDGLPSECILFFR 418

Query:   421 PADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFC------ 474
              ADVPRQSSMVFYE SGLQNLYDIVRY Q               E  Q  N  C      
Sbjct:   419 SADVPRQSSMVFYEYSGLQNLYDIVRYCQSKTKCRRSAFFRHFGEPSQDCNGMCDNCALS 478

Query:   475 ----MVVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLKEIDSDLKREEIEQLVLQ 530
                  V ++  ++ ++S++Q+ Q  +QR+TMLQL DK++ K K++ ++LKR+E+E LV++
Sbjct:   479 SEVKEVDVSDLSKLVVSMVQETQAKDQRVTMLQLGDKLRNKHKDLIAELKRDEVEHLVIK 538

Query:   531 LIIDRVLVRIGPFSPGKKIIKLEISSVQKNTADNKKSTKRSLTS 574
             LI+D VL      +P      + +  +       +K+ K   +S
Sbjct:   539 LIVDSVLKEEFQHTPYSTNAYVTMGPLANQLLQGRKTIKMETSS 582
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0043140 "ATP-dependent 3'-5' DNA helicase activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0016592 "mediator complex" evidence=IDA
GO:0006281 "DNA repair" evidence=IC
GO:0006310 "DNA recombination" evidence=IC
GO:0009378 "four-way junction helicase activity" evidence=IDA
GO:0043138 "3'-5' DNA helicase activity" evidence=IDA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
UNIPROTKB|F1NPI7 RECQL "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1311071 Recql "RecQ protein-like (DNA helicase Q1-like)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AYJ1 Recql "ATP-dependent DNA helicase Q1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNP1 RECQL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SR01 RECQL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P46063 RECQL "ATP-dependent DNA helicase Q1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:103021 Recql "RecQ protein-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A0JN36 RECQL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050809-134 recql "RecQ protein-like (DNA helicase Q1-like)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6AYJ1RECQ1_RAT3, ., 6, ., 4, ., 1, 20.41930.83230.9275yesno
Q9FT73MED34_ARATH3, ., 6, ., 4, ., 1, 20.65320.97680.9588yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.991
3rd Layer3.6.40.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00007632001
SubName- Full=Chromosome chr2 scaffold_196, whole genome shotgun sequence; (747 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00030485001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (341 aa)
      • 0.448

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 1e-164
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 1e-143
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 1e-132
PRK11057607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 1e-126
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 1e-124
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 3e-31
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 9e-30
smart0049082 smart00490, HELICc, helicase superfamily c-termina 6e-23
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-22
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-19
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 6e-17
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-15
COG1205 851 COG1205, COG1205, Distinct helicase family with a 5e-12
COG1202830 COG1202, COG1202, Superfamily II helicase, archaea 3e-11
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 4e-10
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-07
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 3e-07
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-07
pfam0057068 pfam00570, HRDC, HRDC domain 8e-06
TIGR03817742 TIGR03817, DECH_helic, helicase/secretion neighbor 2e-05
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-05
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 3e-04
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 6e-04
TIGR00595505 TIGR00595, priA, primosomal protein N' 0.001
COG1204766 COG1204, COG1204, Superfamily II helicase [General 0.002
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 0.003
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information 
 Score =  479 bits (1235), Expect = e-164
 Identities = 197/394 (50%), Positives = 274/394 (69%), Gaps = 13/394 (3%)

Query: 85  NVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLI 144
            VFG+ ++R  Q E+INAVL GRD  V+M  GGGKSLCYQLPA+  +GI LV+SPL+SL+
Sbjct: 5   TVFGLSSFRPVQLEVINAVLLGRDCFVVMPTGGGKSLCYQLPALCSDGITLVISPLISLM 64

Query: 145 QDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKL 204
           +DQV+ L A GIPA  L S+ SKE +K +   L+  +G++K+LYVTPEK S S R +  L
Sbjct: 65  EDQVLQLKASGIPATFLNSSQSKEQQKNVLTDLK--DGKIKLLYVTPEKCSASNRLLQTL 122

Query: 205 EKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQND 264
           E+      ++LI++DEAHC SQWGHDFRPDYK LG LK +FP+VP+MALTATA+  V+ D
Sbjct: 123 EE---RKGITLIAVDEAHCISQWGHDFRPDYKALGSLKQKFPNVPIMALTATASPSVRED 179

Query: 265 LMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKYIQESYPNSESGIVYCFS 324
           ++  L+++    F ++ +RPNL+Y VR K+     +++++ ++I++ +   +SGI+YC S
Sbjct: 180 ILRQLNLKNPQIFCTSFDRPNLYYEVRRKTPK---ILEDLLRFIRKEFK-GKSGIIYCPS 235

Query: 325 RKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDV 384
           RK+ EQV   L+  GI+A  YHA ++I+AR+ VH ++ ++++QV+V TVAFGMGINKPDV
Sbjct: 236 RKKSEQVTASLQNLGIAAGAYHAGLEISARDDVHHKFQRDEIQVVVATVAFGMGINKPDV 295

Query: 385 RFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYENSGLQNLYDI 444
           RFVIH+SL KS+E+YYQESGRAGRDGLPSEC LF+ PAD+ R   ++  E  G Q  Y +
Sbjct: 296 RFVIHYSLPKSMESYYQESGRAGRDGLPSECHLFYAPADINRLRRLLMEEPDGQQRTYKL 355

Query: 445 VRYSQYPLHWNIEKVRLVI----FEKLQQVNLFC 474
             Y       N    R +I    F + Q    F 
Sbjct: 356 KLYEMMEYCLNSSTCRRLILLSHFGEKQLNKSFG 389

All proteins in this family for which functions are known are 3'-5' DNA-DNA helicases. These proteins are used for recombination, recombinational repair, and possibly maintenance of chromosome stability. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 470
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|201312 pfam00570, HRDC, HRDC domain Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|233040 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 692
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0353695 consensus ATP-dependent DNA helicase [General func 100.0
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0343758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PRK09200790 preprotein translocase subunit SecA; Reviewed 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 100.0
PRK13766773 Hef nuclease; Provisional 100.0
PRK05580679 primosome assembly protein PriA; Validated 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG11971139 Mfd Transcription-repair coupling factor (superfam 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
COG1200677 RecG RecG-like helicase [DNA replication, recombin 100.0
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.98
KOG0354746 consensus DEAD-box like helicase [General function 99.98
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.97
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.97
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
PRK04914956 ATP-dependent helicase HepA; Validated 99.97
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.96
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.96
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK09694878 helicase Cas3; Provisional 99.96
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.95
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.95
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.94
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.94
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 99.94
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.94
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.94
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.93
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.93
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.92
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.92
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.91
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.91
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.91
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.9
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 99.9
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.9
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.89
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.89
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.89
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.87
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.87
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 99.86
PRK05298652 excinuclease ABC subunit B; Provisional 99.86
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.85
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.85
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.85
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.85
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.84
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 99.84
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.81
COG4096875 HsdR Type I site-specific restriction-modification 99.81
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.81
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.8
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.8
CHL00122870 secA preprotein translocase subunit SecA; Validate 99.8
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.79
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.77
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.76
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.75
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.73
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.72
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.72
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.71
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 99.7
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.7
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.68
KOG0387923 consensus Transcription-coupled repair protein CSB 99.68
KOG1123776 consensus RNA polymerase II transcription initiati 99.68
smart00487201 DEXDc DEAD-like helicases superfamily. 99.65
COG4889 1518 Predicted helicase [General function prediction on 99.65
PRK14873665 primosome assembly protein PriA; Provisional 99.65
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.63
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.58
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.58
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.56
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.56
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.55
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.55
smart0049082 HELICc helicase superfamily c-terminal domain. 99.53
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.48
PF0057068 HRDC: HRDC domain Bloom syndrome. Werner syndrome. 99.48
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.46
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 99.42
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.4
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.39
smart0034181 HRDC Helicase and RNase D C-terminal. Hypothetical 99.38
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 99.38
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.28
KOG4439901 consensus RNA polymerase II transcription terminat 99.16
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.13
COG0610962 Type I site-specific restriction-modification syst 99.1
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.07
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 99.02
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.01
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.01
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.95
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.92
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 98.74
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.64
PRK10829373 ribonuclease D; Provisional 98.64
PF09382106 RQC: RQC domain; InterPro: IPR018982 This entry re 98.61
KOG2340698 consensus Uncharacterized conserved protein [Funct 98.53
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.51
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.51
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 98.34
TIGR01388367 rnd ribonuclease D. This model describes ribonucle 98.26
PRK15483 986 type III restriction-modification system StyLTI en 98.23
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.14
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.12
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.02
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.99
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 97.85
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.82
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.81
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.69
COG0349361 Rnd Ribonuclease D [Translation, ribosomal structu 97.65
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 97.59
TIGR00376637 DNA helicase, putative. The gene product may repre 97.55
KOG1803649 consensus DNA helicase [Replication, recombination 97.38
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.34
PF1324576 AAA_19: Part of AAA domain 97.31
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 97.3
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.29
KOG1131 755 consensus RNA polymerase II transcription initiati 97.24
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.21
KOG18051100 consensus DNA replication helicase [Replication, r 97.14
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.05
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.0
PRK08181269 transposase; Validated 96.91
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.9
PRK10536262 hypothetical protein; Provisional 96.81
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.8
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.71
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.71
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 96.69
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.6
PRK06526254 transposase; Provisional 96.55
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.54
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.52
PRK06835329 DNA replication protein DnaC; Validated 96.44
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 96.41
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.38
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 96.36
PF1140880 Helicase_Sgs1: Sgs1 RecQ helicase; InterPro: IPR02 96.33
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.31
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.22
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.17
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.14
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.11
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.04
PRK08727233 hypothetical protein; Validated 95.86
PF13871278 Helicase_C_4: Helicase_C-like 95.84
smart00382148 AAA ATPases associated with a variety of cellular 95.82
PRK07952244 DNA replication protein DnaC; Validated 95.82
PRK14974336 cell division protein FtsY; Provisional 95.82
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.75
PRK08116268 hypothetical protein; Validated 95.66
PRK12377248 putative replication protein; Provisional 95.62
KOG0383696 consensus Predicted helicase [General function pre 95.59
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.49
KOG1001674 consensus Helicase-like transcription factor HLTF/ 95.49
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.39
PRK06921266 hypothetical protein; Provisional 95.23
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.17
PRK05707328 DNA polymerase III subunit delta'; Validated 95.16
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.1
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.05
PRK08769319 DNA polymerase III subunit delta'; Validated 95.03
PRK05580 679 primosome assembly protein PriA; Validated 94.98
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 94.95
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 94.94
TIGR00595 505 priA primosomal protein N'. All proteins in this f 94.9
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.9
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 94.89
PTZ001121164 origin recognition complex 1 protein; Provisional 94.71
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.69
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 94.67
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.6
PRK04296190 thymidine kinase; Provisional 94.58
PRK06893229 DNA replication initiation factor; Validated 94.54
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 94.53
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.51
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 94.5
PRK09183259 transposase/IS protein; Provisional 94.45
KOG0298 1394 consensus DEAD box-containing helicase-like transc 94.45
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 94.35
PF13173128 AAA_14: AAA domain 94.35
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.34
PRK14873665 primosome assembly protein PriA; Provisional 94.31
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.27
TIGR02928365 orc1/cdc6 family replication initiation protein. M 94.27
PF00004132 AAA: ATPase family associated with various cellula 94.26
PRK13897606 type IV secretion system component VirD4; Provisio 94.26
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 94.21
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 94.05
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.99
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.95
PRK08084235 DNA replication initiation factor; Provisional 93.95
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 93.94
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.94
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.92
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 93.84
PRK13826 1102 Dtr system oriT relaxase; Provisional 93.78
PRK12422445 chromosomal replication initiation protein; Provis 93.74
TIGR00064272 ftsY signal recognition particle-docking protein F 93.64
PRK13889988 conjugal transfer relaxase TraA; Provisional 93.6
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 93.6
KOG2206 687 consensus Exosome 3'-5' exoribonuclease complex, s 93.56
COG1198 730 PriA Primosomal protein N' (replication factor Y) 93.53
PRK06871325 DNA polymerase III subunit delta'; Validated 93.53
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 93.51
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.47
PRK13850670 type IV secretion system protein VirD4; Provisiona 93.37
PRK08903227 DnaA regulatory inactivator Hda; Validated 93.34
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 93.31
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.31
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 93.25
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 93.25
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 93.24
PRK05642234 DNA replication initiation factor; Validated 93.24
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 93.21
PRK06964342 DNA polymerase III subunit delta'; Validated 93.14
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 93.11
TIGR00643630 recG ATP-dependent DNA helicase RecG. 93.11
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 93.1
PRK00149450 dnaA chromosomal replication initiation protein; R 92.99
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 92.97
PRK13822641 conjugal transfer coupling protein TraG; Provision 92.97
PRK10867433 signal recognition particle protein; Provisional 92.93
PRK13342413 recombination factor protein RarA; Reviewed 92.9
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 92.9
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 92.86
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 92.8
PRK05973237 replicative DNA helicase; Provisional 92.78
PRK04195482 replication factor C large subunit; Provisional 92.75
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 92.65
PRK09112351 DNA polymerase III subunit delta'; Validated 92.65
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 92.62
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 92.6
PRK06067234 flagellar accessory protein FlaH; Validated 92.59
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 92.58
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 92.57
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 92.57
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 92.53
PHA02533534 17 large terminase protein; Provisional 92.52
PRK106891147 transcription-repair coupling factor; Provisional 92.51
PRK06090319 DNA polymerase III subunit delta'; Validated 92.48
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 92.48
TIGR02767623 TraG-Ti Ti-type conjugative transfer system protie 92.41
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 92.37
PLN03025319 replication factor C subunit; Provisional 92.37
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 92.35
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 92.34
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 92.32
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 92.32
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 92.32
TIGR00362405 DnaA chromosomal replication initiator protein Dna 92.28
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 92.26
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 92.26
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 92.25
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 92.22
PRK08939306 primosomal protein DnaI; Reviewed 92.2
PRK11823446 DNA repair protein RadA; Provisional 92.17
PRK05748448 replicative DNA helicase; Provisional 92.11
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 92.1
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 92.01
PRK13876663 conjugal transfer coupling protein TraG; Provision 91.97
PRK07940394 DNA polymerase III subunit delta'; Validated 91.92
PRK04328249 hypothetical protein; Provisional 91.87
COG0552340 FtsY Signal recognition particle GTPase [Intracell 91.86
PHA02544316 44 clamp loader, small subunit; Provisional 91.8
PRK14088440 dnaA chromosomal replication initiation protein; P 91.74
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 91.73
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 91.7
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 91.64
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 91.62
PRK13341725 recombination factor protein RarA/unknown domain f 91.58
PRK09354349 recA recombinase A; Provisional 91.51
PRK07993334 DNA polymerase III subunit delta'; Validated 91.45
PRK08699325 DNA polymerase III subunit delta'; Validated 91.43
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 91.41
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 91.29
COG1484254 DnaC DNA replication protein [DNA replication, rec 91.27
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 91.21
KOG2028554 consensus ATPase related to the helicase subunit o 91.2
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 91.2
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 91.15
PRK10416318 signal recognition particle-docking protein FtsY; 91.08
PHA02542473 41 41 helicase; Provisional 91.07
PRK05636505 replicative DNA helicase; Provisional 91.05
CHL00181287 cbbX CbbX; Provisional 91.04
PRK00771437 signal recognition particle protein Srp54; Provisi 90.92
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 90.89
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 90.89
COG2255332 RuvB Holliday junction resolvasome, helicase subun 90.88
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 90.83
cd03115173 SRP The signal recognition particle (SRP) mediates 90.82
TIGR02237209 recomb_radB DNA repair and recombination protein R 90.81
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 90.8
cd00983325 recA RecA is a bacterial enzyme which has roles in 90.73
TIGR02012321 tigrfam_recA protein RecA. This model describes or 90.72
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 90.68
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.65
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 90.61
PRK12402337 replication factor C small subunit 2; Reviewed 90.6
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 90.58
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 90.53
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 90.52
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 90.49
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 90.49
TIGR00767415 rho transcription termination factor Rho. Members 90.39
PRK13880636 conjugal transfer coupling protein TraG; Provision 90.38
PRK08760476 replicative DNA helicase; Provisional 90.34
cd01394218 radB RadB. The archaeal protein radB shares simila 90.17
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 90.13
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 90.05
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 90.04
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 90.04
PRK06904472 replicative DNA helicase; Validated 90.02
PRK11054684 helD DNA helicase IV; Provisional 90.0
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 89.95
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 89.95
KOG2543438 consensus Origin recognition complex, subunit 5 [R 89.87
PRK08533230 flagellar accessory protein FlaH; Reviewed 89.83
PRK09165497 replicative DNA helicase; Provisional 89.78
TIGR00959428 ffh signal recognition particle protein. This mode 89.71
PRK13833323 conjugal transfer protein TrbB; Provisional 89.7
KOG0734752 consensus AAA+-type ATPase containing the peptidas 89.64
PRK05595444 replicative DNA helicase; Provisional 89.6
PRK14087450 dnaA chromosomal replication initiation protein; P 89.56
PRK14086617 dnaA chromosomal replication initiation protein; P 89.52
COG0556663 UvrB Helicase subunit of the DNA excision repair c 89.46
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 89.41
TIGR00665434 DnaB replicative DNA helicase. This model describe 89.39
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 89.32
PRK09376416 rho transcription termination factor Rho; Provisio 89.28
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 89.27
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 89.2
PRK09361225 radB DNA repair and recombination protein RadB; Pr 89.18
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 89.15
PRK14701 1638 reverse gyrase; Provisional 89.14
COG1200677 RecG RecG-like helicase [DNA replication, recombin 89.11
CHL00095821 clpC Clp protease ATP binding subunit 89.06
TIGR00763775 lon ATP-dependent protease La. This protein is ind 88.97
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 88.95
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 88.94
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 88.89
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 88.87
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 88.71
COG3972660 Superfamily I DNA and RNA helicases [General funct 88.69
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 88.54
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 88.52
PRK13894319 conjugal transfer ATPase TrbB; Provisional 88.46
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 88.35
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 88.26
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 88.22
KOG1001674 consensus Helicase-like transcription factor HLTF/ 88.21
PRK07471365 DNA polymerase III subunit delta'; Validated 88.19
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 88.17
PRK00440319 rfc replication factor C small subunit; Reviewed 88.15
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 88.1
cd01128249 rho_factor Transcription termination factor rho is 87.86
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 87.82
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 87.8
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 87.66
PRK13851344 type IV secretion system protein VirB11; Provision 87.64
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 87.64
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 87.5
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 87.41
PRK08506472 replicative DNA helicase; Provisional 87.39
PRK10865857 protein disaggregation chaperone; Provisional 87.33
PRK08840464 replicative DNA helicase; Provisional 87.3
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 87.28
CHL00176638 ftsH cell division protein; Validated 87.18
COG0593408 DnaA ATPase involved in DNA replication initiation 87.08
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 87.02
PRK07004460 replicative DNA helicase; Provisional 86.9
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 86.82
PHA03368738 DNA packaging terminase subunit 1; Provisional 86.77
PRK12608380 transcription termination factor Rho; Provisional 86.61
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 86.55
COG0470325 HolB ATPase involved in DNA replication [DNA repli 86.51
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 86.5
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 86.41
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 86.34
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 85.86
PTZ00110545 helicase; Provisional 85.81
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 85.63
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 85.57
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 85.53
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 85.36
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 85.29
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 85.24
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 85.19
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 85.18
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 85.12
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 84.91
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 84.86
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 84.82
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 84.76
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 84.75
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 84.71
COG4626546 Phage terminase-like protein, large subunit [Gener 84.61
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 84.59
cd01393226 recA_like RecA is a bacterial enzyme which has rol 84.57
PRK09519 790 recA DNA recombination protein RecA; Reviewed 84.57
COG3973747 Superfamily I DNA and RNA helicases [General funct 84.5
PRK04841 903 transcriptional regulator MalT; Provisional 84.43
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 84.4
PRK08006471 replicative DNA helicase; Provisional 84.25
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 84.17
KOG0347731 consensus RNA helicase [RNA processing and modific 84.05
PRK06321472 replicative DNA helicase; Provisional 84.0
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 83.99
KOG0745564 consensus Putative ATP-dependent Clp-type protease 83.99
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 83.97
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 83.87
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 83.83
PRK10436462 hypothetical protein; Provisional 83.77
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 83.74
TIGR03743634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 83.59
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 83.59
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 83.57
PHA00350399 putative assembly protein 83.51
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 83.47
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 83.29
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 83.01
CHL00095821 clpC Clp protease ATP binding subunit 83.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 82.98
PHA03333752 putative ATPase subunit of terminase; Provisional 82.86
COG11971139 Mfd Transcription-repair coupling factor (superfam 82.85
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.2e-104  Score=904.26  Aligned_cols=578  Identities=39%  Similarity=0.660  Sum_probs=507.9

Q ss_pred             ccccc-CCCCcHHHHHHHHHhcCCCCCCHHHHHHHHHHHcCCCEEEEecCCChhHHHHHHHHHhcCCeEEEEcccHHHHH
Q 035988           67 ENWSG-TFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSPLLSLIQ  145 (692)
Q Consensus        67 ~~w~~-~~~~~~~~~~~l~~~fg~~~~r~~Q~~ai~~il~g~dviv~apTGsGKTl~~~lpal~~~~~~lvi~Pt~~L~~  145 (692)
                      .+|.+ .|+|+..+...+++.|||..|||+|.++|++++.|+|++++||||+|||+||++|++..++.+|||+|+++||+
T Consensus       435 ~~W~~~~fpw~~~L~~~lk~~FG~~sFRp~Q~eaI~aiL~GrDVLVimPTGSGKSLcYQLPAL~~~GiTLVISPLiSLmq  514 (1195)
T PLN03137        435 KKWSSRNFPWTKKLEVNNKKVFGNHSFRPNQREIINATMSGYDVFVLMPTGGGKSLTYQLPALICPGITLVISPLVSLIQ  514 (1195)
T ss_pred             ccccccCCCchHHHHHHHHHHcCCCCCCHHHHHHHHHHHcCCCEEEEcCCCccHHHHHHHHHHHcCCcEEEEeCHHHHHH
Confidence            35887 89999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCEEEEecCCChhHHHHHHHHHHhcCCCccEEEeChhhhhchHHHHHHHHhhhhcCCceEEEEeCccccc
Q 035988          146 DQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCS  225 (692)
Q Consensus       146 q~~~~l~~~gi~~~~~~~~~~~~~~~~~~~~l~~~~~~~~Ili~Tpe~l~~~~~~~~~l~~~~~~~~l~~iVIDEaH~l~  225 (692)
                      ||+..+...|+++..++++....+...++..+....+.++|+|+|||++.....+...+........+.+||||||||++
T Consensus       515 DQV~~L~~~GI~Aa~L~s~~s~~eq~~ilr~l~s~~g~~~ILyvTPERL~~~d~ll~~L~~L~~~~~LslIVIDEAHcVS  594 (1195)
T PLN03137        515 DQIMNLLQANIPAASLSAGMEWAEQLEILQELSSEYSKYKLLYVTPEKVAKSDSLLRHLENLNSRGLLARFVIDEAHCVS  594 (1195)
T ss_pred             HHHHHHHhCCCeEEEEECCCCHHHHHHHHHHHHhcCCCCCEEEEChHHhhcchHHHHHHHhhhhccccceeccCcchhhh
Confidence            99999999999999999999988888888777664458999999999997654556666554445679999999999999


Q ss_pred             ccCCCchHHHHHHHHHHhhCCCCCEEEEecccchhhHHHHHHHhcccceEEEeccCCCCcceEEEeeccCcchHHHHHHH
Q 035988          226 QWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIA  305 (692)
Q Consensus       226 ~~g~~fr~~~~~l~~l~~~~~~~~~i~lSAT~~~~~~~~i~~~l~~~~~~~~~~~~~r~~l~~~v~~~~~~~~~~~~~l~  305 (692)
                      +|||+||+.|..+..++..+|++|+++||||+++.+..++.+.|++..+.++..+++|||+.|.+..+..   .....+.
T Consensus       595 qWGhDFRpdYr~L~~Lr~~fp~vPilALTATAT~~V~eDI~~~L~l~~~~vfr~Sf~RpNL~y~Vv~k~k---k~le~L~  671 (1195)
T PLN03137        595 QWGHDFRPDYQGLGILKQKFPNIPVLALTATATASVKEDVVQALGLVNCVVFRQSFNRPNLWYSVVPKTK---KCLEDID  671 (1195)
T ss_pred             hcccchHHHHHHHHHHHHhCCCCCeEEEEecCCHHHHHHHHHHcCCCCcEEeecccCccceEEEEeccch---hHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999887532   2345677


Q ss_pred             HHHHHhCCCCCceEEEEeccchHHHHHHHHHHCCCceeEeccCCCHHHHHHHHHHHhcCCCcEEEeccccccccCCCCcc
Q 035988          306 KYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVR  385 (692)
Q Consensus       306 ~~l~~~~~~~~~~IIf~~s~~~~e~l~~~L~~~g~~v~~~h~~~~~~eR~~~~~~f~~g~~~ILVaT~~~~~GIDip~v~  385 (692)
                      .++.... .++++||||.|++.|+.++..|...|+.+..|||+|++++|..+++.|.+|+++|||||++|+||||+|+|+
T Consensus       672 ~~I~~~~-~~esgIIYC~SRke~E~LAe~L~~~Gika~~YHAGLs~eeR~~vqe~F~~Gei~VLVATdAFGMGIDkPDVR  750 (1195)
T PLN03137        672 KFIKENH-FDECGIIYCLSRMDCEKVAERLQEFGHKAAFYHGSMDPAQRAFVQKQWSKDEINIICATVAFGMGINKPDVR  750 (1195)
T ss_pred             HHHHhcc-cCCCceeEeCchhHHHHHHHHHHHCCCCeeeeeCCCCHHHHHHHHHHHhcCCCcEEEEechhhcCCCccCCc
Confidence            7776543 567899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeCCCCCHHHHHHHHhhcCCCCCCCeeEeecCCCCHHHHHHHHhhhh---------------------hhhHhHHHH
Q 035988          386 FVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYEN---------------------SGLQNLYDI  444 (692)
Q Consensus       386 ~VI~~~~P~s~~~y~Qr~GRagR~G~~g~~i~l~~~~d~~~~~~l~~~~~---------------------~~~~~l~~~  444 (692)
                      +||||++|+|++.|+||+|||||+|.+|.|++||+..|+..++.++....                     ....+|..|
T Consensus       751 ~VIHydlPkSiEsYyQriGRAGRDG~~g~cILlys~~D~~~~~~lI~~~~~~~s~~~~~~~r~~~s~~~~e~~~~~L~~m  830 (1195)
T PLN03137        751 FVIHHSLPKSIEGYHQECGRAGRDGQRSSCVLYYSYSDYIRVKHMISQGGVEQSPMAMGYNRMASSGRILETNTENLLRM  830 (1195)
T ss_pred             EEEEcCCCCCHHHHHhhhcccCCCCCCceEEEEecHHHHHHHHHHHhccccccchhhhhhcccchhHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999888875321                     134679999


Q ss_pred             HHHhcCCccchHHHHHhhhCCCc--ccccCCCc----------cchhHHHHHHHHHHHHHHhcCCCccHHHHHHHHHhcc
Q 035988          445 VRYSQYPLHWNIEKVRLVIFEKL--QQVNLFCM----------VVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKL  512 (692)
Q Consensus       445 ~~~~~~~~~crr~~ll~~f~~~~--~~C~~~Cd----------~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  512 (692)
                      ++||++...|||.++|.||||.+  ..|+..||          .|+|.+|+.++++|.+   .++++|...++|+|+|+.
T Consensus       831 ~~yce~~~~CRR~~lL~yFGE~~~~~~C~~~CDnC~~~~~~~~~D~T~~Aq~~ls~V~~---~~~~fg~~~iidvlrGs~  907 (1195)
T PLN03137        831 VSYCENEVDCRRFLQLVHFGEKFDSTNCKKTCDNCSSSKSLIDKDVTEIARQLVELVKL---TGERFSSAHILEVYRGSL  907 (1195)
T ss_pred             HHHHhChHhhHHHHHHHHcccccCccCCCCCCCCCCCCCcccccccHHHHHHHHHHHHH---hccCcchhheehhhhccc
Confidence            99999667999999999999986  46754576          3899999999999875   578999999999999973


Q ss_pred             --------------cCCCcccCHHHHHHHHHHHHHcCcccc---------------------ccccCCCceeEEEEeecc
Q 035988          513 --------------KEIDSDLKREEIEQLVLQLIIDRVLVR---------------------IGPFSPGKKIIKLEISSV  557 (692)
Q Consensus       513 --------------~~~~~~~~~~~~~~~i~~l~~~~~l~~---------------------~~~~L~g~~~v~l~~~~~  557 (692)
                                    .|.|+++++.+|+++|++|+.+|||..                     +.++|+|+.++.++++..
T Consensus       908 ~~~i~~~~~d~l~~~G~gk~~s~~~~~~li~~Li~~g~L~~~~~~~~~y~~~~~~L~l~~~ka~~vL~g~~~v~l~~~~~  987 (1195)
T PLN03137        908 NQYVKKHRHETLSLHGAGKHLSKGEASRILHYLVTEDILAEDVKKSDLYGSVSSLLKVNESKAYKLFSGGQTIIMRFPSS  987 (1195)
T ss_pred             cHHHHHhCcccccccCccccCCHHHHHHHHHHHHHcCCceeeccccccCCccceEEEeChHHHHHHhCCCceEEEecccc
Confidence                          278999999999999999999999921                     224689999999987432


Q ss_pred             ccccc--------ccc-----cccc-----------cccchHHHHHHHHHHHHHHHHHh-CCCCceEeccHHHHHHHHHc
Q 035988          558 QKNTA--------DNK-----KSTK-----------RSLTSSALEFELDELRKELASIS-GGILPHSVLSSQLIRLISAR  612 (692)
Q Consensus       558 ~~~~~--------~~~-----~~~~-----------~~~~~~~l~~~l~~~r~~~a~~~-~~~~~~~i~~~~~l~~~~~~  612 (692)
                      .+..+        ...     ....           ....++.||++|++||+++|++. .|+|||+||+|.||++||..
T Consensus       988 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~Lfe~Lr~lR~elA~e~~~~vppyvIFsD~TL~eIA~~ 1067 (1195)
T PLN03137        988 VKASKPSKFEATPAKGPLTSGKQSTLPMATPAQPPVDLNLSAILYTALRKLRTALVKEAGDGVMAYHIFGNATLQQISKR 1067 (1195)
T ss_pred             cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHhhhcCCCCeEEECHHHHHHHHHH
Confidence            11110        000     0000           01136789999999999999981 29999999999999999999


Q ss_pred             CCCChhhcchhhhhhc--ccchhhhhhhHHHHHHHHhhhccCCCCC
Q 035988          613 KPSTMEEASSNHLEKI--IGKLKTGKYGSRILEVISKCGNSEQQHD  656 (692)
Q Consensus       613 ~p~~~~~~~~~~l~~i--~g~~k~~~~g~~~l~~~~~~~~~~~~~~  656 (692)
                      +|.|.++     |++|  ||+.|+++||++||++|++|..+.+...
T Consensus      1068 ~P~T~~e-----Ll~I~GVG~~KlekYG~~fL~vI~~~~~ey~~~~ 1108 (1195)
T PLN03137       1068 IPRTKEE-----LLEINGLGKAKVSKYGDRLLETIESTINEYYKTD 1108 (1195)
T ss_pred             CCCCHHH-----HhcCCCccHHHHHHHHHHHHHHHHHHHHHhcCCc
Confidence            9999999     9999  9999999999999999999987666444

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PF00570 HRDC: HRDC domain Bloom syndrome Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>smart00341 HRDC Helicase and RNase D C-terminal Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK10829 ribonuclease D; Provisional Back     alignment and domain information
>PF09382 RQC: RQC domain; InterPro: IPR018982 This entry represents the RQC domain, which is a DNA-binding domain found only in RecQ family enzymes Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>TIGR01388 rnd ribonuclease D Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF11408 Helicase_Sgs1: Sgs1 RecQ helicase; InterPro: IPR022758 RecQ helicases unwind DNA in an ATP-dependent manner Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2206 consensus Exosome 3'-5' exoribonuclease complex, subunit PM/SCL-100 (Rrp6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
2v1x_A591 Crystal Structure Of Human Recq-Like Dna Helicase L 1e-125
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 6e-90
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 2e-86
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 2e-10
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 9e-10
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 3e-08
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 3e-08
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 3e-08
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-08
2hyi_C413 Structure Of The Human Exon Junction Complex With A 4e-08
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 8e-08
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 6e-07
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 9e-07
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-06
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 3e-06
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 4e-06
2vso_A395 Crystal Structure Of A Translation Initiation Compl 4e-06
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 5e-05
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 1e-04
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 1e-04
1fuu_A394 Yeast Initiation Factor 4a Length = 394 2e-04
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-04
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-04
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 2e-04
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 3e-04
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 3e-04
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure 
Iteration: 1

 Score =  446 bits (1146), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 228/506 (45%), Positives = 325/506 (64%), Gaps = 30/506 (5%)
Query: 73  FEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREG 132
           F W  +  D+  NVF +  +R  Q E IN  ++G++V ++M  GGGKSLCYQLPA+  +G
Sbjct: 26  FPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDG 85
Query: 133 IALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPE 192
             LV+ PL+SL++DQ+M L  LGI A ML +++SKE  K+++  +     ELK++YVTPE
Sbjct: 86  FTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPE 145
Query: 193 KISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMA 252
           KI+KSK FMS+LEK + A R + I++DE HCCSQWGHDFRPDYK LGILK QFP+  ++ 
Sbjct: 146 KIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIG 205
Query: 253 LTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKVVIDEIAKYIQESY 312
           LTATAT  V  D  ++L I KC  F ++ NRPNL+Y VR+K S  +  I++I K I   Y
Sbjct: 206 LTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGRY 265
Query: 313 PNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGT 372
              +SGI+YCFS+K+ EQV   L+  GI A  YHA+++   +  VH +WS N++QV+V T
Sbjct: 266 -KGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVAT 324
Query: 373 VAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVF 432
           VAFGMGI+KPDVRFVIHHS+SKS+E YYQESGRAGRD + ++C+L++   D+ R SSMV 
Sbjct: 325 VAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGFGDIFRISSMVV 384
Query: 433 YENSGLQNLYDIVRYSQYPLHWNIEKVRLVI----FEKL---QQVNLFCMVV-------- 477
            EN G Q LY++V Y Q     NI K R V+    F+++   +  N  C           
Sbjct: 385 MENVGQQKLYEMVSYCQ-----NISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFER 439
Query: 478 --LAGHAQCIISLLQDIQDNNQRLTMLQLVD----KMKIKLK---EIDSDLKREEIEQLV 528
             +  + + +I +L+  ++ N++LT L+L+D    K   KL+    +   L RE++E+++
Sbjct: 440 KNITEYCRDLIKILKQAEELNEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPREDLEKII 499
Query: 529 LQLIIDRVLVRIGPFSPGKKIIKLEI 554
              +I + L     F+    I  L+I
Sbjct: 500 AHFLIQQYLKEDYSFTAYATISYLKI 525
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 0.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 1e-168
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 1e-14
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 4e-14
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 3e-13
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 1e-12
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 6e-12
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 8e-12
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 4e-11
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 4e-11
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 5e-11
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 8e-11
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 1e-10
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 5e-10
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 6e-10
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 8e-10
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 3e-09
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-08
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-08
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 6e-08
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 7e-08
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-07
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-07
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 2e-07
2rrd_A101 BLM HRDC domain, HRDC domain from bloom syndrome p 3e-07
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 6e-07
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 1e-06
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 2e-06
2kv2_A85 Bloom syndrome protein; HRDC domain, disease mutat 3e-06
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 3e-06
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-06
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 1e-05
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 9e-05
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-04
2rhf_A77 DNA helicase RECQ; HRDC, D. radiodurans, ATP-bindi 1e-04
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 2e-04
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 3e-04
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 3e-04
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 4e-04
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2rrd_A BLM HRDC domain, HRDC domain from bloom syndrome protein; DNA helicase, RECQ family, HRDC DOMA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2kv2_A Bloom syndrome protein; HRDC domain, disease mutation, DNA replicati binding, nucleotide-binding, nucleus, gene regulation; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2rhf_A DNA helicase RECQ; HRDC, D. radiodurans, ATP-binding, hydrolase nucleotide-binding; HET: DNA; 1.10A {Deinococcus radiodurans} Length = 77 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query692
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
3jux_A822 Protein translocase subunit SECA; protein transloc 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.98
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.97
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.96
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.96
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.96
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.96
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.96
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.95
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.95
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 99.95
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.95
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.95
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.95
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.95
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.95
3bor_A237 Human initiation factor 4A-II; translation initiat 99.95
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.95
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.95
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.94
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.94
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.94
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.94
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.92
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.91
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.91
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.9
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.9
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.9
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.9
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.89
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.89
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.79
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.85
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.83
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.8
2rrd_A101 BLM HRDC domain, HRDC domain from bloom syndrome p 99.78
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.78
2kv2_A85 Bloom syndrome protein; HRDC domain, disease mutat 99.76
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.75
2rhf_A77 DNA helicase RECQ; HRDC, D. radiodurans, ATP-bindi 99.74
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.74
2e1f_A103 Werner syndrome ATP-dependent helicase; HRDC domai 99.73
1wud_A89 ATP-dependent DNA helicase RECQ; DNA-binding domai 99.73
2dgz_A113 Werner syndrome protein variant; HRDC domain, stru 99.72
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.69
1yt3_A375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 99.1
3saf_A428 Exosome component 10; exoribonuclease, RNA exosome 99.1
3cym_A440 Uncharacterized protein BAD_0989; structural genom 99.06
2hbj_A410 Exosome complex exonuclease RRP6; RNA metabolism, 99.04
3aaf_A134 Werner syndrome ATP-dependent helicase; helix-turn 98.3
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.29
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.92
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.9
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.74
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.73
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.72
1d8b_A81 SGS1 RECQ helicase; five helices, three-helical bu 97.3
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.16
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.99
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 96.8
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 96.58
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.33
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.1
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.6
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 95.3
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.2
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.77
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 94.72
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.7
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.67
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 94.59
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 94.4
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.37
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.29
3co5_A143 Putative two-component system transcriptional RES 93.95
2cvh_A220 DNA repair and recombination protein RADB; filamen 93.86
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.83
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.53
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 93.46
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 93.45
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 93.42
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.39
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 93.33
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 93.23
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.18
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.07
3u06_A412 Protein claret segregational; motor domain, stalk 93.06
2kjq_A149 DNAA-related protein; solution structure, NESG, st 93.01
3bos_A242 Putative DNA replication factor; P-loop containing 92.99
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 92.91
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 92.87
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 92.83
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.81
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 92.72
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 92.67
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 92.65
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 92.59
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 92.56
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 92.4
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 92.35
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 92.31
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 92.25
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 92.24
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 92.2
3pvs_A447 Replication-associated recombination protein A; ma 92.15
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 92.15
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 91.98
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 91.93
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 91.85
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 91.74
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 91.67
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 91.63
2z43_A324 DNA repair and recombination protein RADA; archaea 91.61
2r6a_A454 DNAB helicase, replicative helicase; replication, 91.56
1xp8_A366 RECA protein, recombinase A; recombination, radior 91.54
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 91.51
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 91.46
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 91.38
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 91.22
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 91.19
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.08
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 91.08
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 91.06
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 90.75
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 90.34
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 90.28
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 90.28
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 90.21
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 90.07
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 89.77
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 89.59
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 89.21
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 89.11
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 89.09
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 88.92
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 88.79
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 88.77
2gno_A305 DNA polymerase III, gamma subunit-related protein; 88.63
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 88.59
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.5
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 88.48
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 88.43
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 88.19
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 88.12
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 87.88
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 87.85
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 87.78
1u94_A356 RECA protein, recombinase A; homologous recombinat 87.58
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 87.44
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 87.38
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 87.29
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 87.1
3io5_A333 Recombination and repair protein; storage dimer, i 86.84
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 86.8
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 86.54
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 86.49
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 86.41
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 86.37
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 86.23
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 86.21
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 86.19
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 86.19
1yt3_A375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 85.89
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 85.77
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 85.72
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 85.69
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 85.42
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 85.27
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 84.84
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 84.68
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 84.54
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 84.43
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 84.24
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 84.12
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 84.1
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 83.96
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 83.94
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 83.91
2fna_A357 Conserved hypothetical protein; structural genomic 83.71
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 83.54
2xxa_A433 Signal recognition particle protein; protein trans 83.49
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 83.38
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 83.01
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 82.8
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 82.66
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 82.06
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 81.93
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 81.83
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 82.62
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 81.76
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 81.7
1vma_A306 Cell division protein FTSY; TM0570, structural gen 80.94
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 80.83
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 80.27
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
Probab=100.00  E-value=2e-82  Score=723.89  Aligned_cols=498  Identities=44%  Similarity=0.785  Sum_probs=453.3

Q ss_pred             CCCcccccccc-CCCCcHHHHHHHHHhcCCCCCCHHHHHHHHHHHcCCCEEEEecCCChhHHHHHHHHHhcCCeEEEEcc
Q 035988           61 SSSTAVENWSG-TFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLREGIALVVSP  139 (692)
Q Consensus        61 ~~~~~~~~w~~-~~~~~~~~~~~l~~~fg~~~~r~~Q~~ai~~il~g~dviv~apTGsGKTl~~~lpal~~~~~~lvi~P  139 (692)
                      +.+....+|.. .++|++.+.+.|++.|||..|||+|.++|+++++|+|++++||||+|||+||++|++...+++|||+|
T Consensus        13 ~~~~~~~~w~~~~~~l~~~l~~~L~~~fg~~~~rp~Q~~~i~~il~g~d~lv~~pTGsGKTl~~~lpal~~~g~~lVisP   92 (591)
T 2v1x_A           13 EYDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICP   92 (591)
T ss_dssp             ---CCGGGGCCSCSTTHHHHHHHHHHTSCCCSCCTTHHHHHHHHHTTCCEEEECCTTSCTTHHHHHHHHTSSSEEEEECS
T ss_pred             CCCcchhccccccCCCCHHHHHHHHHHhCCCCCCHHHHHHHHHHHcCCCEEEEECCCChHHHHHHHHHHHcCCcEEEEeC
Confidence            44666789988 89999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHHHHcCCCEEEEecCCChhHHHHHHHHHHhcCCCccEEEeChhhhhchHHHHHHHHhhhhcCCceEEEEe
Q 035988          140 LLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTPEKISKSKRFMSKLEKCHHAGRLSLISID  219 (692)
Q Consensus       140 t~~L~~q~~~~l~~~gi~~~~~~~~~~~~~~~~~~~~l~~~~~~~~Ili~Tpe~l~~~~~~~~~l~~~~~~~~l~~iVID  219 (692)
                      +++|+.|+++.++++|+++..++|+....+....+..+....+.++|+|+||++|..+..|.+.+.+...+.++++||||
T Consensus        93 ~~~L~~q~~~~l~~~gi~~~~l~~~~~~~~~~~~~~~l~~~~~~~~Ilv~Tpe~L~~~~~~~~~l~~~~~~~~i~~iViD  172 (591)
T 2v1x_A           93 LISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVD  172 (591)
T ss_dssp             CHHHHHHHHHHHHHHTCCEEECCSSCCHHHHHHHHHHHHCTTCCCCEEEECHHHHHSCHHHHHHHHHHHHTTCEEEEEEE
T ss_pred             HHHHHHHHHHHHHhcCCcEEEEeCCCCHHHHHHHHHHhhcccCCCCEEEEChhHhhccHHHHHHHHhhhhccCCcEEEEE
Confidence            99999999999999999999999999988887777777544458999999999998766788888777778899999999


Q ss_pred             CcccccccCCCchHHHHHHHHHHhhCCCCCEEEEecccchhhHHHHHHHhcccceEEEeccCCCCcceEEEeeccCcchH
Q 035988          220 EAHCCSQWGHDFRPDYKNLGILKTQFPDVPMMALTATATQKVQNDLMEMLHIRKCIKFVSTINRPNLFYMVREKSSVGKV  299 (692)
Q Consensus       220 EaH~l~~~g~~fr~~~~~l~~l~~~~~~~~~i~lSAT~~~~~~~~i~~~l~~~~~~~~~~~~~r~~l~~~v~~~~~~~~~  299 (692)
                      ||||+++||++|++.|..+..+...+|+.|+++||||+++.+..++..+++++.+..+..+++++|+.|.+.........
T Consensus       173 EAH~is~~g~dfr~~~~~l~~l~~~~~~~~ii~lSAT~~~~v~~~i~~~l~~~~~~~~~~~~~r~nl~~~v~~~~~~~~~  252 (591)
T 2v1x_A          173 EVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTED  252 (591)
T ss_dssp             TGGGGSTTCTTCCGGGGGGGHHHHHCTTSEEEEEESSCCHHHHHHHHHHTTCCSCEEEECCCCCTTEEEEEEECCSSHHH
T ss_pred             CcccccccccccHHHHHHHHHHHHhCCCCcEEEEecCCCHHHHHHHHHHhCCCCcEEEecCCCCcccEEEEEeCCCcHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999887766666


Q ss_pred             HHHHHHHHHHHhCCCCCceEEEEeccchHHHHHHHHHHCCCceeEeccCCCHHHHHHHHHHHhcCCCcEEEecccccccc
Q 035988          300 VIDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHMRWSKNKLQVIVGTVAFGMGI  379 (692)
Q Consensus       300 ~~~~l~~~l~~~~~~~~~~IIf~~s~~~~e~l~~~L~~~g~~v~~~h~~~~~~eR~~~~~~f~~g~~~ILVaT~~~~~GI  379 (692)
                      .+..+.+++.... .++++||||+|++.++.+++.|...|+.+..|||+|++++|..+++.|++|+++|||||++++|||
T Consensus       253 ~~~~l~~~l~~~~-~~~~~IVf~~sr~~~e~la~~L~~~g~~~~~~h~~l~~~~R~~~~~~F~~g~~~VlVAT~a~~~GI  331 (591)
T 2v1x_A          253 FIEDIVKLINGRY-KGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVATVAFGMGI  331 (591)
T ss_dssp             HHHHHHHHHTTTT-TTCEEEEECSSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSSSEEEECTTSCTTC
T ss_pred             HHHHHHHHHHHhc-cCCCeEEEeCcHHHHHHHHHHHHHCCCCEEEecCCCCHHHHHHHHHHHHcCCCeEEEEechhhcCC
Confidence            7788888887543 678999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCccEEEEeCCCCCHHHHHHHHhhcCCCCCCCeeEeecCCCCHHHHHHHHhhhhhhhHhHHHHHHHhcCCccchHHHH
Q 035988          380 NKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYENSGLQNLYDIVRYSQYPLHWNIEKV  459 (692)
Q Consensus       380 Dip~v~~VI~~~~P~s~~~y~Qr~GRagR~G~~g~~i~l~~~~d~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~crr~~l  459 (692)
                      |+|+|++||||++|.|+++|+||+|||||+|.+|.|++||++.|...++.++..+.....++..|+.||+++..|||..+
T Consensus       332 D~p~V~~VI~~~~p~s~~~y~Qr~GRaGR~G~~g~~i~l~~~~D~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~Crr~~l  411 (591)
T 2v1x_A          332 DKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLM  411 (591)
T ss_dssp             CCSCEEEEEESSCCSSHHHHHHHHTTSCTTSSCEEEEEEECHHHHHHHHHHTTTSTTHHHHHHHHHHHHTCSSSCHHHHH
T ss_pred             CcccccEEEEeCCCCCHHHHHHHhccCCcCCCCceEEEEEChHHHHHHHHHHhhhhhhHHHHHHHHHHHhcccccHHHHH
Confidence            99999999999999999999999999999999999999999999999999998877888999999999998899999999


Q ss_pred             HhhhCCCc--ccccCCCc----------cchhHHHHHHHHHHHHHHhcCCCccHHHHHHHHHhccc-------CCCcccC
Q 035988          460 RLVIFEKL--QQVNLFCM----------VVLAGHAQCIISLLQDIQDNNQRLTMLQLVDKMKIKLK-------EIDSDLK  520 (692)
Q Consensus       460 l~~f~~~~--~~C~~~Cd----------~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~  520 (692)
                      ++|||+.+  ..|.++||          .|+|.+|+.++++|.++.+.++++|+.+++|+|+|+.+       .-|++++
T Consensus       412 l~~f~e~~~~~~c~~~Cd~C~~~~~~~~~d~~~~~~~~l~~v~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~  491 (591)
T 2v1x_A          412 AQHFDEVWNSEACNKMCDNCCKDSAFERKNITEYCRDLIKILKQAEELNEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLP  491 (591)
T ss_dssp             HHHHTCCC---CCCSCBHHHHCCCCEEEEECHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHTTCSCGGGCCTTCCCCSCC
T ss_pred             HHHcCCCCCccccCCCCCCCCCCCcccccchHHHHHHHHHHHHHHHhcCCcccHHHHHHHHhCCCchHHHhcCCCcCcCC
Confidence            99999986  56755676          59999999999999988888999999999999999742       1278999


Q ss_pred             HHHHHHHHHHHHHcCccc--------------ccc----ccCCCceeEEEEeecccc
Q 035988          521 REEIEQLVLQLIIDRVLV--------------RIG----PFSPGKKIIKLEISSVQK  559 (692)
Q Consensus       521 ~~~~~~~i~~l~~~~~l~--------------~~~----~~L~g~~~v~l~~~~~~~  559 (692)
                      +.+|+++|++|+..|||.              +.|    ++|+|+.++.++++...+
T Consensus       492 ~~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  548 (591)
T 2v1x_A          492 REDLEKIIAHFLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQ  548 (591)
T ss_dssp             HHHHHHHHHHHHHTTSEEEEEEECSSCEEEEEEECGGGGGGGSTTCCCEEEEEC---
T ss_pred             HHHHHHHHHHHHHcCCcEEecccCCCceeEEeeECHHHHHHhcCCceEEEEecCCCC
Confidence            999999999999999992              122    379999999999865544
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2rrd_A BLM HRDC domain, HRDC domain from bloom syndrome protein; DNA helicase, RECQ family, HRDC DOMA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2kv2_A Bloom syndrome protein; HRDC domain, disease mutation, DNA replicati binding, nucleotide-binding, nucleus, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2rhf_A DNA helicase RECQ; HRDC, D. radiodurans, ATP-binding, hydrolase nucleotide-binding; HET: DNA; 1.10A {Deinococcus radiodurans} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2e1f_A Werner syndrome ATP-dependent helicase; HRDC domain, hydrolase; 2.00A {Homo sapiens} SCOP: a.60.8.1 PDB: 2e1e_A Back     alignment and structure
>1wud_A ATP-dependent DNA helicase RECQ; DNA-binding domain, HRDC, hydrolase; 2.20A {Escherichia coli} SCOP: a.60.8.1 Back     alignment and structure
>2dgz_A Werner syndrome protein variant; HRDC domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.60.8.1 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Back     alignment and structure
>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Back     alignment and structure
>3aaf_A Werner syndrome ATP-dependent helicase; helix-turn-helix, winged-helix, protein-DNA complex, DNA-BIN helicase; HET: DNA; 1.90A {Homo sapiens} PDB: 2axl_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1d8b_A SGS1 RECQ helicase; five helices, three-helical bundle flanked by two helices, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.8.1 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 692
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 8e-37
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 6e-27
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 7e-24
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 2e-21
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-19
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 6e-16
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 5e-15
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-14
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 1e-14
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 3e-14
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 7e-13
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 2e-11
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 6e-11
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 6e-11
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 1e-10
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 9e-10
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 6e-09
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 1e-06
d1wuda177 a.60.8.1 (A:530-606) HRDC domain from RecQ helicas 1e-06
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 1e-06
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 5e-06
d1tf5a4175 c.37.1.19 (A:396-570) Translocation ATPase SecA, n 1e-05
d2e1fa194 a.60.8.1 (A:1142-1235) Werner syndrome ATP-depende 1e-05
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 9e-05
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-04
d2eyqa5211 c.37.1.19 (A:779-989) Transcription-repair couplin 8e-04
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 0.002
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecQ helicase domain
species: Escherichia coli [TaxId: 562]

 Score =  134 bits (338), Expect = 8e-37
 Identities = 87/208 (41%), Positives = 126/208 (60%), Gaps = 7/208 (3%)

Query: 72  TFEWDSRADDVRLNVFGIPAYRANQQEIINAVLSGRDVLVIMAAGGGKSLCYQLPAVLRE 131
               +S A  V    FG   +R  Q+EII+ VLSGRD LV+M  GGGKSLCYQ+PA+L  
Sbjct: 6   VLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLN 65

Query: 132 GIALVVSPLLSLIQDQVMCLAALGIPAHMLTSTTSKEDEKFIYKALEKGEGELKMLYVTP 191
           G+ +VVSPL+SL++DQV  L A G+ A  L ST ++E +  +      G+  +++LY+ P
Sbjct: 66  GLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQ--IRLLYIAP 123

Query: 192 EKISKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPDVPMM 251
           E++           +        L+++DEAHC SQWGHDFRP+Y  LG L+ +FP +P M
Sbjct: 124 ERLMLDNFL-----EHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFPTLPFM 178

Query: 252 ALTATATQKVQNDLMEMLHIRKCIKFVS 279
           ALTATA    + D++ +L +   +  +S
Sbjct: 179 ALTATADDTTRQDIVRLLGLNDPLIQIS 206
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 Back     information, alignment and structure
>d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query692
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.98
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.97
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.97
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.96
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.96
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.96
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.95
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.95
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.94
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.94
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.94
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.93
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.93
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.93
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.92
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.92
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.92
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.91
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.88
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.88
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.86
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.83
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.8
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.8
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.79
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.79
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.76
d1wuda177 HRDC domain from RecQ helicase {Escherichia coli [ 99.76
d2e1fa194 Werner syndrome ATP-dependent helicase, WRN {Human 99.75
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.74
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.73
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.72
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.72
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.69
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.63
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.62
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.58
d2hbka196 Exosome complex exonuclease RRP6 domain {Baker's y 99.4
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.39
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.38
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.38
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.33
d1yt3a1101 Ribonuclease D {Escherichia coli [TaxId: 562]} 99.32
d2cpra1113 Exosome component 10, EXOSC10 {Human (Homo sapiens 99.27
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.12
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.1
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.98
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.92
d1oywa1110 DNA helicase RecQ DNA-binding domain {Escherichia 98.84
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.81
d2axla1144 Werner syndrome ATP-dependent helicase WRN {Human 98.3
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.49
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.54
d2qy9a2211 GTPase domain of the signal recognition particle r 96.44
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.34
d1okkd2207 GTPase domain of the signal recognition particle r 96.32
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.21
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.19
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 96.11
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.01
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.92
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.89
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.88
d1vmaa2213 GTPase domain of the signal recognition particle r 95.68
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.34
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 95.31
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.96
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.76
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.74
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 93.45
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 93.41
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 93.33
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.16
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.01
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.33
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 92.12
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.97
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 91.68
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 91.6
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 91.38
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.38
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 91.34
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 91.34
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 91.29
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.11
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 90.76
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 89.3
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.18
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.25
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.18
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 88.04
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 87.87
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 87.77
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 87.62
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 87.28
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 86.86
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 86.72
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.48
d1d8ba_81 HRDC domain from RecQ helicase {Baker's yeast (Sac 85.72
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.64
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 85.07
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 84.37
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 84.27
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 83.31
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 82.84
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.61
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 81.74
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 81.36
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 81.09
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 80.9
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecQ helicase domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=5.2e-38  Score=305.52  Aligned_cols=191  Identities=39%  Similarity=0.678  Sum_probs=173.9

Q ss_pred             cCCCCcceEEEeeccCcchHHHHHHHHHHHHhCCCCCceEEEEeccchHHHHHHHHHHCCCceeEeccCCCHHHHHHHHH
Q 035988          280 TINRPNLFYMVREKSSVGKVVIDEIAKYIQESYPNSESGIVYCFSRKECEQVAQELRQRGISADYYHADMDINAREKVHM  359 (692)
Q Consensus       280 ~~~r~~l~~~v~~~~~~~~~~~~~l~~~l~~~~~~~~~~IIf~~s~~~~e~l~~~L~~~g~~v~~~h~~~~~~eR~~~~~  359 (692)
                      +|+|||+.|.+.....    +++.|.+++...  .+.++||||+|++.++.++..|...|+.+..+||+++.++|..+++
T Consensus         1 s~~RpNi~y~v~~~~~----k~~~L~~~l~~~--~~~~~IIF~~t~~~~~~l~~~l~~~~~~~~~~h~~~~~~~r~~~~~   74 (200)
T d1oywa3           1 SFDRPNIRYMLMEKFK----PLDQLMRYVQEQ--RGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQE   74 (200)
T ss_dssp             CCCCTTEEEEEEECSS----HHHHHHHHHHHT--TTCCEEEECSSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHH
T ss_pred             CCCCCCcEEEEEcCCc----HHHHHHHHHHhc--CCCCEEEEEeeehhhHHhhhhhccCCceeEEecCCCcHHHHHHHHH
Confidence            6899999999987654    367788888765  7789999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCcEEEeccccccccCCCCccEEEEeCCCCCHHHHHHHHhhcCCCCCCCeeEeecCCCCHHHHHHHHhhhh----
Q 035988          360 RWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSVETYYQESGRAGRDGLPSECLLFFRPADVPRQSSMVFYEN----  435 (692)
Q Consensus       360 ~f~~g~~~ILVaT~~~~~GIDip~v~~VI~~~~P~s~~~y~Qr~GRagR~G~~g~~i~l~~~~d~~~~~~l~~~~~----  435 (692)
                      .|++|+++|||||++++||||+|+|++||||++|.|+++|+||+||+||+|.+|.|++|+++.|...++.++....    
T Consensus        75 ~f~~g~~~ilvaTd~~~~GiD~p~v~~VI~~~~P~~~~~y~qr~GR~gR~g~~g~ai~~~~~~d~~~l~~~i~~~~~~~~  154 (200)
T d1oywa3          75 KFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQL  154 (200)
T ss_dssp             HHHTTSCSEEEECTTSCTTTCCTTCCEEEESSCCSSHHHHHHHHTTSCTTSSCEEEEEEECHHHHHHHHHHHHTSCCSHH
T ss_pred             HHhcccceEEEecchhhhccCCCCCCEEEECCCccchHHHHHHhhhhhcCCCCceEEEecCHHHHHHHHhhhhccccccc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999988876532    


Q ss_pred             --hhhHhHHHHHHHhcCCccchHHHHHhhhCCCcccccCCCccc
Q 035988          436 --SGLQNLYDIVRYSQYPLHWNIEKVRLVIFEKLQQVNLFCMVV  477 (692)
Q Consensus       436 --~~~~~l~~~~~~~~~~~~crr~~ll~~f~~~~~~C~~~Cd~d  477 (692)
                        .....+..|..|++ +..|||..|++|||+....||++||.+
T Consensus       155 ~~~~~~~~~~m~~~~~-~~~Crr~~ll~~fge~~~~~C~~CD~C  197 (200)
T d1oywa3         155 QDIERHKLNAMGAFAE-AQTCRRLVLLNYFGEGRQEPCGNCDIC  197 (200)
T ss_dssp             HHHHHHHHHHHHHHHT-CSSCHHHHHHHHTTCCCCSCCSCBHHH
T ss_pred             hhhhHHHHHHHHHHHh-chhhHHHHHHHHcCCCCCCCCCCCCCC
Confidence              23456788999997 788999999999999987777999844
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2hbka1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yt3a1 a.60.8.3 (A:194-294) Ribonuclease D {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cpra1 a.60.8.4 (A:483-595) Exosome component 10, EXOSC10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oywa1 a.4.5.43 (A:407-516) DNA helicase RecQ DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2axla1 a.4.5.43 (A:1-144) Werner syndrome ATP-dependent helicase WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d8ba_ a.60.8.1 (A:) HRDC domain from RecQ helicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure