Citrus Sinensis ID: 036055

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
PQFFSKQWRYTAAPSAKVAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVLKRISRARSRS
cccccccccccccccHHHHHHEEEEEEEcccccEEEEEEccHHHHHHHHHHccccccccccccccccccccEEEEEHHHHHHccccccHHHHHHHHHHHHccccc
cccccEEEEEcccccHHHHcHEEEEEEEcccccccEEEEccHHHHHHHHHHccccccccccHHHHHHcccHHHHHHHHHHHHHcccccHcHHHHHHHHHHccccc
pqffskqwrytaapsaKVAYRIVHLFaidpdgqkrpiIGLAVQTLLKALtnsglidpashrleeidacSVECEVNIAQEwldrlpprsyeeEYVLKRISRARSRS
pqffskqwrytaapsakVAYRIVHLFAidpdgqkrPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAqewldrlpprsyeeeyvlkrisrarsrs
PQFFSKQWRYTAAPSAKVAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVLKRISRARSRS
*****KQWRYTAAPSAKVAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVL**********
********************RIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVL**********
PQFFSKQWRYTAAPSAKVAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVLKRISRARSRS
**FFSKQWRYTAAPSAKVAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVLKRI*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PQFFSKQWRYTAAPSAKVAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVLKRISRARSRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
224132022152 predicted protein [Populus trichocarpa] 0.838 0.578 0.840 4e-35
224065308158 predicted protein [Populus trichocarpa] 0.876 0.582 0.793 5e-35
18397961159 2Fe-2S ferredoxin-like protein [Arabidop 0.876 0.578 0.680 7e-30
356527279158 PREDICTED: adrenodoxin-like protein, mit 0.952 0.632 0.653 4e-29
297609803158 Os09g0514600 [Oryza sativa Japonica Grou 0.819 0.544 0.720 1e-28
388496842154 unknown [Medicago truncatula] 0.838 0.571 0.715 1e-28
357504857154 Ferredoxin [Medicago truncatula] gi|3554 0.838 0.571 0.715 1e-28
242049828159 hypothetical protein SORBIDRAFT_02g02980 0.780 0.515 0.731 6e-28
359494751163 PREDICTED: adrenodoxin-like protein, mit 0.819 0.527 0.662 9e-28
195623466162 ferredoxin [Zea mays] 0.780 0.506 0.719 1e-27
>gi|224132022|ref|XP_002321236.1| predicted protein [Populus trichocarpa] gi|118484792|gb|ABK94264.1| unknown [Populus trichocarpa] gi|222862009|gb|EEE99551.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 80/88 (90%)

Query: 15  SAKVAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEV 74
           SAKVA RIV L AIDPDGQKR I+GL+ QTLLKAL N+GLIDPASHRLEEI+ACS ECEV
Sbjct: 31  SAKVADRIVKLSAIDPDGQKREIVGLSGQTLLKALANNGLIDPASHRLEEIEACSAECEV 90

Query: 75  NIAQEWLDRLPPRSYEEEYVLKRISRAR 102
           NIAQEWL+RLPPRSY+EEYVLKR SRAR
Sbjct: 91  NIAQEWLERLPPRSYDEEYVLKRNSRAR 118

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224065308|ref|XP_002301767.1| predicted protein [Populus trichocarpa] gi|222843493|gb|EEE81040.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18397961|ref|NP_566309.1| 2Fe-2S ferredoxin-like protein [Arabidopsis thaliana] gi|297829298|ref|XP_002882531.1| electron carrier/ iron ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|6041858|gb|AAF02167.1|AC009853_27 unknown protein [Arabidopsis thaliana] gi|14423424|gb|AAK62394.1|AF386949_1 Unknown protein [Arabidopsis thaliana] gi|20148369|gb|AAM10075.1| unknown protein [Arabidopsis thaliana] gi|21555779|gb|AAM63932.1| unknown [Arabidopsis thaliana] gi|297328371|gb|EFH58790.1| electron carrier/ iron ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|332641027|gb|AEE74548.1| 2Fe-2S ferredoxin-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356527279|ref|XP_003532239.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|297609803|ref|NP_001063661.2| Os09g0514600 [Oryza sativa Japonica Group] gi|50725356|dbj|BAD34428.1| unknown protein [Oryza sativa Japonica Group] gi|125564363|gb|EAZ09743.1| hypothetical protein OsI_32031 [Oryza sativa Indica Group] gi|125606319|gb|EAZ45355.1| hypothetical protein OsJ_30000 [Oryza sativa Japonica Group] gi|255679060|dbj|BAF25575.2| Os09g0514600 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|388496842|gb|AFK36487.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357504857|ref|XP_003622717.1| Ferredoxin [Medicago truncatula] gi|355497732|gb|AES78935.1| Ferredoxin [Medicago truncatula] Back     alignment and taxonomy information
>gi|242049828|ref|XP_002462658.1| hypothetical protein SORBIDRAFT_02g029800 [Sorghum bicolor] gi|241926035|gb|EER99179.1| hypothetical protein SORBIDRAFT_02g029800 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|359494751|ref|XP_003634833.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|195623466|gb|ACG33563.1| ferredoxin [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
TAIR|locus:2079611159 AT3G07480 [Arabidopsis thalian 0.838 0.553 0.715 1e-29
TIGR_CMR|NSE_0297111 NSE_0297 "iron-sulfur cluster 0.619 0.585 0.352 0.00021
TAIR|locus:2079611 AT3G07480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 329 (120.9 bits), Expect = 1.0e-29, P = 1.0e-29
 Identities = 63/88 (71%), Positives = 78/88 (88%)

Query:    15 SAKVAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEV 74
             S KV+ RIV L AIDPDG K+ IIGL+ QTLL+ALT++GLIDPASHRL++I+ACS ECEV
Sbjct:    38 SKKVSDRIVKLSAIDPDGYKQDIIGLSGQTLLRALTHTGLIDPASHRLDDIEACSAECEV 97

Query:    75 NIAQEWLDRLPPRSYEEEYVLKRISRAR 102
              IA+EWL++LPPR+Y+EEYVLKR SR+R
Sbjct:    98 QIAEEWLEKLPPRTYDEEYVLKRSSRSR 125
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
TIGR_CMR|NSE_0297 NSE_0297 "iron-sulfur cluster binding protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 105
KOG3309159 consensus Ferredoxin [Energy production and conver 99.9
PTZ00490143 Ferredoxin superfamily; Provisional 99.81
PLN02593117 adrenodoxin-like ferredoxin protein 99.76
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.45
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.32
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 98.84
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 98.55
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 98.39
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 98.32
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 98.29
CHL0013499 petF ferredoxin; Validated 97.9
PLN03136148 Ferredoxin; Provisional 97.89
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 97.8
PTZ00038191 ferredoxin; Provisional 97.48
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 97.41
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.34
PRK05713 312 hypothetical protein; Provisional 97.2
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 97.07
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 96.99
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 96.67
PRK08166 847 NADH dehydrogenase subunit G; Validated 96.36
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 96.33
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 96.23
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 96.13
COG3894 614 Uncharacterized metal-binding protein [General fun 95.67
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 95.49
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 95.26
PRK09800 956 putative hypoxanthine oxidase; Provisional 94.75
PRK12814 652 putative NADPH-dependent glutamate synthase small 94.5
PRK09130 687 NADH dehydrogenase subunit G; Validated 94.4
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 94.05
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 94.0
PRK07860 797 NADH dehydrogenase subunit G; Validated 93.97
PRK08493 819 NADH dehydrogenase subunit G; Validated 93.91
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 93.9
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 93.69
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 93.52
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 92.77
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 92.7
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 92.42
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 92.28
PRK09129 776 NADH dehydrogenase subunit G; Validated 91.93
PLN00192 1344 aldehyde oxidase 88.07
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 88.07
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 87.48
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 84.72
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 84.52
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 84.52
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 83.34
COG4630 493 XdhA Xanthine dehydrogenase, iron-sulfur cluster a 80.49
cd0181773 RGS12_RBD Ubiquitin domain of RGS12 and RGS14. RGS 80.24
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information 
Probab=99.90  E-value=6.7e-24  Score=158.32  Aligned_cols=77  Identities=30%  Similarity=0.406  Sum_probs=68.6

Q ss_pred             eEEEEECCCCCEEEEEccccHHHHHHHHHCCCCCccccCCCccccccCceeEEeCccccccCCCCChHHHHHHHhhhhhc
Q 036055           23 VHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVLKRISRAR  102 (105)
Q Consensus        23 ~~Itfid~DG~~~~V~a~~G~SLMeaa~~nGv~g~~~~~i~gi~~CGATCHVyVd~ew~~klp~~~e~E~dMLd~~~R~~  102 (105)
                      +|||||++||.+..+.+.+|+|||++|++|||+.  .+.+++.-+|. ||||||+++|+.+||+|+|+|.||||.|+=|+
T Consensus        44 i~Itfv~~dG~~~~i~g~vGdtlLd~ah~n~idl--eGACEgslACS-TCHViv~~~~yekl~ep~DeE~DmLDlA~gLt  120 (159)
T KOG3309|consen   44 IKITFVDPDGEEIKIKGKVGDTLLDAAHENNLDL--EGACEGSLACS-TCHVIVDEEYYEKLPEPEDEENDMLDLAFGLT  120 (159)
T ss_pred             EEEEEECCCCCEEEeeeecchHHHHHHHHcCCCc--ccccccccccc-ceEEEEcHHHHhcCCCCcchHHHHHHhhhccc
Confidence            8999999999999999999999999999999953  34566666675 99999999999999999999999999876554

>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01817 RGS12_RBD Ubiquitin domain of RGS12 and RGS14 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 2e-06
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 4e-06
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 4e-06
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 7e-06
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 7e-06
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 9e-06
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 2e-05
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 2e-05
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 4e-05
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
 Score = 41.8 bits (99), Expect = 2e-06
 Identities = 18/84 (21%), Positives = 33/84 (39%), Gaps = 23/84 (27%)

Query: 16 AKVAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEID-------AC 68
          AK+ +       I+ +G +  +      T+++A  ++G+          ID       AC
Sbjct: 1  AKIIF-------IEHNGTRHEVEAKPGLTVMEAARDNGV--------PGIDADCGGACAC 45

Query: 69 SVECEVNIAQEWLDRLPPRSYEEE 92
          S  C   +   W+D+LP     E 
Sbjct: 46 ST-CHAYVDPAWVDKLPKALPTET 68
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.84
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.81
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.79
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.78
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.78
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.75
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.73
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.71
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.65
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.63
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.48
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.43
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 98.99
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 98.99
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 98.81
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 98.73
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 98.67
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 98.61
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 98.61
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 98.56
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 98.55
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 98.54
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 98.29
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 97.33
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 97.17
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 96.84
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 96.82
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 96.81
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 96.6
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 95.62
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 95.51
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 95.17
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 94.66
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 94.54
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 94.21
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 92.85
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 92.74
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 92.05
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 90.8
1wxm_A86 A-RAF proto-oncogene serine/threonine-protein kina 89.81
1c1y_B77 Proto-onkogene serine/threonine protein kinase RAF 88.78
2l05_A95 Serine/threonine-protein kinase B-RAF; structural 86.61
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 86.07
1rrb_A107 RAF-1 RBD, RAF proto-oncogene serine/threonine-pro 85.4
3ny5_A96 Serine/threonine-protein kinase B-RAF; NESG, struc 84.05
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 83.91
3u7z_A101 Putative metal binding protein rumgna_00854; the b 83.86
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 81.38
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
Probab=99.84  E-value=1.6e-22  Score=142.47  Aligned_cols=78  Identities=19%  Similarity=0.236  Sum_probs=17.2

Q ss_pred             cCcceEEEEECCCCCEEEEEccccHHHHHHHHHCCCCCccccCCCccccccCceeEEeCccccccCCCCChHHHHHHHh
Q 036055           19 AYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVLKR   97 (105)
Q Consensus        19 ~~~M~~Itfid~DG~~~~V~a~~G~SLMeaa~~nGv~g~~~~~i~gi~~CGATCHVyVd~ew~~klp~~~e~E~dMLd~   97 (105)
                      .++|++|||+++||.+++|++..|+|||++|++|||+....+.+.|.+.| +||||+|.++|.++|++++++|.+||+.
T Consensus         2 ~~~~v~Vtf~~~~G~~~~v~~~~G~tLl~aa~~~gi~i~g~~~CgG~g~C-gtC~v~v~~~~~~~l~~~~~~E~~~L~~   79 (123)
T 3n9z_C            2 SEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLAC-STCHLIFEDHIYEKLDAITDEENDMLDL   79 (123)
T ss_dssp             -----------------------------------------CTTCSSSSC-STTBC--------------CHHHHHHCC
T ss_pred             CCCcEEEEEEeCCCCEEEEEECCCCcHHHHHHHcCCCCCcCCCCCCCCEe-CCCeeEEeccccccCCCCChHHHhhhcc
Confidence            46899999999999999999999999999999999962101344444556 5999999999999999999999999975
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1wxm_A A-RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain (RBD), ubiquitin-like fold, A-RAF kinase, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>1c1y_B Proto-onkogene serine/threonine protein kinase RAF-1; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: d.15.1.5 PDB: 1gua_B* 1rfa_A 3kud_B* 3kuc_B* Back     alignment and structure
>2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1rrb_A RAF-1 RBD, RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain, transferase, riken structural genomics/proteomics initiative; NMR {Rattus norvegicus} SCOP: d.15.1.5 Back     alignment and structure
>3ny5_A Serine/threonine-protein kinase B-RAF; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; HET: MSE; 1.99A {Homo sapiens} SCOP: d.15.1.0 Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 105
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 5e-10
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 1e-09
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 1e-07
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 2e-07
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 0.001
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 50.0 bits (119), Expect = 5e-10
 Identities = 19/78 (24%), Positives = 29/78 (37%), Gaps = 1/78 (1%)

Query: 28  IDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPR 87
           I+ DG+     G    +LL  +  + L        E   ACS  C +   Q   ++L   
Sbjct: 8   INRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACS-TCHLIFEQHIFEKLEAI 66

Query: 88  SYEEEYVLKRISRARSRS 105
           + EE  +L        RS
Sbjct: 67  TDEENDMLDLAYGLTDRS 84
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.88
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.88
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.87
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.63
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.56
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 98.85
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 98.84
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 98.5
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 98.42
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 98.25
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 98.22
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 98.2
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 98.15
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 98.13
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 97.71
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.58
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.55
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 97.44
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 97.38
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 97.18
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 96.97
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 96.87
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 96.86
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 96.76
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 96.57
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 96.37
d1wxma173 A-Raf proto-oncogene serine/threonine-protein kina 93.86
d1c1yb_77 c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} 92.4
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 89.54
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 88.83
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 88.78
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 84.02
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.89  E-value=9.4e-24  Score=142.67  Aligned_cols=77  Identities=21%  Similarity=0.248  Sum_probs=64.4

Q ss_pred             ceEEEEECCCCCEEEEEccccHHHHHHHHHCCCCCccccCCCccccccCceeEEeCccccccCCCCChHHHHHHHhhh
Q 036055           22 IVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIAQEWLDRLPPRSYEEEYVLKRIS   99 (105)
Q Consensus        22 M~~Itfid~DG~~~~V~a~~G~SLMeaa~~nGv~g~~~~~i~gi~~CGATCHVyVd~ew~~klp~~~e~E~dMLd~~~   99 (105)
                      .++||||++||++++|++..|+|||++|++|||+.+..+.+.|.+.| +||||||.++|.++|++++++|++||+.+.
T Consensus         2 ~i~i~~i~~dG~~~~i~~~~G~tLl~~~~~~gi~i~~~~~CgG~~~C-~tC~V~v~~~~~~~l~~~~~~E~~~L~~~~   78 (104)
T d2bt6a1           2 KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLAC-STCHLIFEQHIFEKLEAITDEENDMLDLAY   78 (104)
T ss_dssp             EEEEEEECTTSCEEEEEEETTCBHHHHHHHTTCCCTTTTTTSSSSSB-STTEEECCHHHHTTSCCCCHHHHHHHTTCT
T ss_pred             eEEEEEECCCCCEEEEEeCCCchHHHHHHHcCCCcccccccCCcccc-ceEEEEecccchhhcCCCCHHHHHHhhccC
Confidence            46899999999999999999999999999999963222223333334 699999999999999999999999998653
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure