Citrus Sinensis ID: 036068


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MKNKDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSACTHN
cccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccHHcHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHccccc
ccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHccc
MKNKDVISWTAIVSRYINRGQVDIARQcfdqmperdYVLWTAMIDGYLRVNRFREALTLFQEMqtsnimgdefTIVSILTARANLRALDLGEWIKTYidknkvkndifAGNALIDMYCICADVEKAQKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSACTHN
mknkdvisWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEmqtsnimgdEFTIVSILTARANLRALDLGEWIktyidknkvkNDIFAGNALIDMYCICADVEKAQKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSACTHN
MKNKDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSACTHN
*****VISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSAC***
*KNKDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSACTHN
MKNKDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSACTHN
***KDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSACTHN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNKDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSACTHN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
Q9LSB8 687 Putative pentatricopeptid yes no 1.0 0.259 0.575 7e-59
Q9C866 570 Pentatricopeptide repeat- no no 1.0 0.312 0.430 3e-41
Q9SJZ3 681 Pentatricopeptide repeat- no no 0.994 0.259 0.4 1e-39
Q9SJG6 559 Pentatricopeptide repeat- no no 0.977 0.311 0.406 3e-38
Q9MA50 500 Pentatricopeptide repeat- no no 0.994 0.354 0.394 1e-36
Q9FG16 622 Pentatricopeptide repeat- no no 1.0 0.286 0.381 3e-36
Q683I9 573 Pentatricopeptide repeat- no no 0.983 0.305 0.389 6e-36
Q9SIL5 534 Pentatricopeptide repeat- no no 0.994 0.331 0.389 8e-35
Q38959455 Pentatricopeptide repeat- no no 0.983 0.384 0.391 2e-34
Q1PEU4 555 Pentatricopeptide repeat- no no 0.988 0.317 0.397 2e-34
>sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containing protein At3g15930 OS=Arabidopsis thaliana GN=PCMP-E51 PE=3 SV=2 Back     alignment and function desciption
 Score =  226 bits (575), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 107/186 (57%), Positives = 139/186 (74%), Gaps = 8/186 (4%)

Query: 1   MKNKDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLF 60
           MK +DVISWT+IV  Y+ RG + +AR  FDQMP RD + WT MIDGYLR   F E+L +F
Sbjct: 297 MKARDVISWTSIVKGYVERGNLKLARTYFDQMPVRDRISWTIMIDGYLRAGCFNESLEIF 356

Query: 61  QEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCIC 120
           +EMQ++ ++ DEFT+VS+LTA A+L +L++GEWIKTYIDKNK+KND+  GNALIDMY  C
Sbjct: 357 REMQSAGMIPDEFTMVSVLTACAHLGSLEIGEWIKTYIDKNKIKNDVVVGNALIDMYFKC 416

Query: 121 ADVEKAQK--------DKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVL 172
              EKAQK        DKF+WT M+VGLA +G G +A+ +F QM   SI+PD++ Y+GVL
Sbjct: 417 GCSEKAQKVFHDMDQRDKFTWTAMVVGLANNGQGQEAIKVFFQMQDMSIQPDDITYLGVL 476

Query: 173 SACTHN 178
           SAC H+
Sbjct: 477 SACNHS 482





Arabidopsis thaliana (taxid: 3702)
>sp|Q9C866|PPR65_ARATH Pentatricopeptide repeat-containing protein At1g31430 OS=Arabidopsis thaliana GN=PCMP-E55 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protein At2g22410, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E28 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E75 PE=2 SV=1 Back     alignment and function description
>sp|Q9MA50|PPR13_ARATH Pentatricopeptide repeat-containing protein At1g05750, chloroplastic OS=Arabidopsis thaliana GN=PDE247 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIL5|PP165_ARATH Pentatricopeptide repeat-containing protein At2g20540 OS=Arabidopsis thaliana GN=PCMP-E78 PE=2 SV=1 Back     alignment and function description
>sp|Q38959|PP257_ARATH Pentatricopeptide repeat-containing protein At3g26630, chloroplastic OS=Arabidopsis thaliana GN=PCMP-A6 PE=2 SV=1 Back     alignment and function description
>sp|Q1PEU4|PP201_ARATH Pentatricopeptide repeat-containing protein At2g44880 OS=Arabidopsis thaliana GN=PCMP-E9 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
255553251 512 pentatricopeptide repeat-containing prot 0.994 0.345 0.697 4e-70
449491161 744 PREDICTED: LOW QUALITY PROTEIN: putative 0.994 0.237 0.654 8e-69
356528966 712 PREDICTED: putative pentatricopeptide re 0.994 0.248 0.675 9e-69
449436619 723 PREDICTED: putative pentatricopeptide re 0.994 0.244 0.654 1e-68
224134923 635 predicted protein [Populus trichocarpa] 0.977 0.274 0.692 3e-68
357468161 874 Pentatricopeptide repeat-containing prot 0.994 0.202 0.659 4e-67
225442904 724 PREDICTED: putative pentatricopeptide re 1.0 0.245 0.661 9e-66
15233234 687 pentatricopeptide repeat-containing prot 1.0 0.259 0.575 3e-57
9294596 695 unnamed protein product [Arabidopsis tha 1.0 0.256 0.575 4e-57
242051881 627 hypothetical protein SORBIDRAFT_03g00412 0.994 0.282 0.524 2e-53
>gi|255553251|ref|XP_002517668.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543300|gb|EEF44832.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 129/185 (69%), Positives = 152/185 (82%), Gaps = 8/185 (4%)

Query: 1   MKNKDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLF 60
           MK++DVISWTAIV+ + N GQ+DIAR+ FDQMPERDYV WTAMIDGYL+VN F+EAL LF
Sbjct: 250 MKSRDVISWTAIVTGFANIGQLDIARKYFDQMPERDYVSWTAMIDGYLQVNCFKEALVLF 309

Query: 61  QEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCIC 120
            EMQTSN+  DEFT+VSILTA A L AL+LGEW++TYIDKNKVKND + GNALIDMY  C
Sbjct: 310 HEMQTSNVKPDEFTMVSILTACAQLGALELGEWVRTYIDKNKVKNDAYVGNALIDMYFKC 369

Query: 121 ADVEKA--------QKDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVL 172
            +VEKA        + DKF+WT MIVGLAI+G G++ALDMF QML+AS+ PDE+ YVGVL
Sbjct: 370 GNVEKARSIFNSMPRPDKFTWTAMIVGLAINGYGEEALDMFVQMLKASVTPDEITYVGVL 429

Query: 173 SACTH 177
            ACTH
Sbjct: 430 CACTH 434




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449491161|ref|XP_004158817.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g15930-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356528966|ref|XP_003533068.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Glycine max] Back     alignment and taxonomy information
>gi|449436619|ref|XP_004136090.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224134923|ref|XP_002327523.1| predicted protein [Populus trichocarpa] gi|222836077|gb|EEE74498.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357468161|ref|XP_003604365.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355505420|gb|AES86562.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225442904|ref|XP_002264123.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15233234|ref|NP_188214.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546758|sp|Q9LSB8.2|PP235_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g15930 gi|332642227|gb|AEE75748.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9294596|dbj|BAB02877.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|242051881|ref|XP_002455086.1| hypothetical protein SORBIDRAFT_03g004125 [Sorghum bicolor] gi|241927061|gb|EES00206.1| hypothetical protein SORBIDRAFT_03g004125 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
TAIR|locus:2093920 687 AT3G15930 "AT3G15930" [Arabido 1.0 0.259 0.575 2.6e-54
TAIR|locus:2206164 570 AT1G31430 [Arabidopsis thalian 0.994 0.310 0.432 2.6e-38
TAIR|locus:2041198 681 SLO1 "SLOW GROWTH 1" [Arabidop 0.994 0.259 0.4 3.5e-36
TAIR|locus:2045580 559 AT2G42920 [Arabidopsis thalian 0.977 0.311 0.406 9.7e-36
TAIR|locus:2198678 500 PDE247 "pigment defective 247" 0.994 0.354 0.4 2.8e-34
TAIR|locus:2090857455 AT3G26630 "AT3G26630" [Arabido 0.994 0.389 0.397 6.7e-33
TAIR|locus:2144143 622 AT5G06540 [Arabidopsis thalian 0.977 0.279 0.384 9.8e-33
TAIR|locus:2081635 573 AT3G62890 [Arabidopsis thalian 0.983 0.305 0.389 1.3e-32
TAIR|locus:2054966 555 AHG11 "ABA hypersensitive germ 0.988 0.317 0.397 1.8e-32
TAIR|locus:2117084 545 AT4G18840 "AT4G18840" [Arabido 0.994 0.324 0.387 4.4e-32
TAIR|locus:2093920 AT3G15930 "AT3G15930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 561 (202.5 bits), Expect = 2.6e-54, P = 2.6e-54
 Identities = 107/186 (57%), Positives = 139/186 (74%)

Query:     1 MKNKDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLF 60
             MK +DVISWT+IV  Y+ RG + +AR  FDQMP RD + WT MIDGYLR   F E+L +F
Sbjct:   297 MKARDVISWTSIVKGYVERGNLKLARTYFDQMPVRDRISWTIMIDGYLRAGCFNESLEIF 356

Query:    61 QEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCIC 120
             +EMQ++ ++ DEFT+VS+LTA A+L +L++GEWIKTYIDKNK+KND+  GNALIDMY  C
Sbjct:   357 REMQSAGMIPDEFTMVSVLTACAHLGSLEIGEWIKTYIDKNKIKNDVVVGNALIDMYFKC 416

Query:   121 ADVEKAQK--------DKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVL 172
                EKAQK        DKF+WT M+VGLA +G G +A+ +F QM   SI+PD++ Y+GVL
Sbjct:   417 GCSEKAQKVFHDMDQRDKFTWTAMVVGLANNGQGQEAIKVFFQMQDMSIQPDDITYLGVL 476

Query:   173 SACTHN 178
             SAC H+
Sbjct:   477 SACNHS 482


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2206164 AT1G31430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041198 SLO1 "SLOW GROWTH 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045580 AT2G42920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198678 PDE247 "pigment defective 247" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090857 AT3G26630 "AT3G26630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144143 AT5G06540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081635 AT3G62890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054966 AHG11 "ABA hypersensitive germination 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117084 AT4G18840 "AT4G18840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-29
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-28
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-28
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-27
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-22
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-21
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-12
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 7e-04
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  112 bits (281), Expect = 3e-29
 Identities = 55/173 (31%), Positives = 87/173 (50%), Gaps = 8/173 (4%)

Query: 11  AIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMG 70
           A++  Y   G ++ AR  FD MPE+  V W +M+ GY       EAL L+ EM+ S +  
Sbjct: 264 ALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSI 323

Query: 71  DEFTIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQ--- 127
           D+FT   ++   + L  L+  +     + +     DI A  AL+D+Y     +E A+   
Sbjct: 324 DQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVF 383

Query: 128 -----KDKFSWTTMIVGLAISGNGDKALDMFSQMLRASIKPDEVAYVGVLSAC 175
                K+  SW  +I G    G G KA++MF +M+   + P+ V ++ VLSAC
Sbjct: 384 DRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSAC 436


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PF1304150 PPR_2: PPR repeat family 99.73
PF1304150 PPR_2: PPR repeat family 99.69
PRK11788389 tetratricopeptide repeat protein; Provisional 99.61
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.58
PRK11788389 tetratricopeptide repeat protein; Provisional 99.53
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.42
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.39
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.37
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.25
PF1285434 PPR_1: PPR repeat 99.1
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.1
PF1285434 PPR_1: PPR repeat 99.08
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.07
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.01
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 99.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.99
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.98
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.94
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.93
PRK12370553 invasion protein regulator; Provisional 98.89
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.88
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.86
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.84
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.81
PRK12370553 invasion protein regulator; Provisional 98.81
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.8
KOG1126638 consensus DNA-binding cell division cycle control 98.78
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.77
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.76
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.76
KOG2003 840 consensus TPR repeat-containing protein [General f 98.73
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.73
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.73
PRK11189296 lipoprotein NlpI; Provisional 98.7
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.68
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.63
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.63
PRK14574 822 hmsH outer membrane protein; Provisional 98.6
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.58
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.58
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.57
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.56
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.54
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.52
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.52
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.52
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.51
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.47
KOG1129478 consensus TPR repeat-containing protein [General f 98.47
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.47
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.46
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.46
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.46
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.44
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.43
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.39
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.38
PRK15359144 type III secretion system chaperone protein SscB; 98.36
KOG1126638 consensus DNA-binding cell division cycle control 98.34
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.32
PRK10370198 formate-dependent nitrite reductase complex subuni 98.32
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.29
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.29
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.29
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.27
PRK15359144 type III secretion system chaperone protein SscB; 98.27
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.22
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.17
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.16
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.15
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.11
PRK14574 822 hmsH outer membrane protein; Provisional 98.1
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.09
PRK10370198 formate-dependent nitrite reductase complex subuni 98.09
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.09
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.06
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.03
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.03
PRK11189296 lipoprotein NlpI; Provisional 98.02
KOG0547606 consensus Translocase of outer mitochondrial membr 98.0
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.0
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.99
KOG1129478 consensus TPR repeat-containing protein [General f 97.94
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.9
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.9
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.9
KOG2076 895 consensus RNA polymerase III transcription factor 97.88
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 97.88
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.86
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.83
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.79
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.76
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.76
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.73
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.71
PLN02789320 farnesyltranstransferase 97.71
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.71
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.69
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.65
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.63
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.6
KOG2076 895 consensus RNA polymerase III transcription factor 97.59
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.57
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.55
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.55
KOG3941 406 consensus Intermediate in Toll signal transduction 97.55
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.53
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.52
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.52
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.52
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.51
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.46
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.44
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.43
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.4
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.4
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.4
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.39
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.38
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.36
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.35
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.33
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.31
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.31
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.31
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.26
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.24
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.21
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.2
KOG3941 406 consensus Intermediate in Toll signal transduction 97.19
PRK10803263 tol-pal system protein YbgF; Provisional 97.16
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.15
PF12688120 TPR_5: Tetratrico peptide repeat 97.14
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.14
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.11
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.11
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.11
KOG0553 304 consensus TPR repeat-containing protein [General f 97.08
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.05
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.04
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.99
PF1337173 TPR_9: Tetratricopeptide repeat 96.98
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.97
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.96
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.93
PLN02789 320 farnesyltranstransferase 96.92
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.91
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.89
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.82
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.82
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.8
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.76
PRK10803263 tol-pal system protein YbgF; Provisional 96.75
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.72
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 96.67
PF13512142 TPR_18: Tetratricopeptide repeat 96.56
KOG0547606 consensus Translocase of outer mitochondrial membr 96.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.53
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.49
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.48
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.47
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.44
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.44
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.44
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.41
KOG0495 913 consensus HAT repeat protein [RNA processing and m 96.41
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.41
KOG4570 418 consensus Uncharacterized conserved protein [Funct 96.4
KOG1125579 consensus TPR repeat-containing protein [General f 96.39
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.38
KOG2003840 consensus TPR repeat-containing protein [General f 96.37
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.34
KOG3785557 consensus Uncharacterized conserved protein [Funct 96.33
PF1337173 TPR_9: Tetratricopeptide repeat 96.26
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.16
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.09
PRK04841 903 transcriptional regulator MalT; Provisional 96.06
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 95.91
KOG1125579 consensus TPR repeat-containing protein [General f 95.9
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.9
COG3629280 DnrI DNA-binding transcriptional activator of the 95.83
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.81
PRK15331165 chaperone protein SicA; Provisional 95.8
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.72
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 95.71
KOG0553304 consensus TPR repeat-containing protein [General f 95.66
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 95.65
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.65
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 95.62
PRK04841 903 transcriptional regulator MalT; Provisional 95.58
COG4700251 Uncharacterized protein conserved in bacteria cont 95.56
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.55
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 95.53
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.53
COG4700251 Uncharacterized protein conserved in bacteria cont 95.49
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.48
COG3629280 DnrI DNA-binding transcriptional activator of the 95.44
KOG2047 835 consensus mRNA splicing factor [RNA processing and 95.39
PF13512142 TPR_18: Tetratricopeptide repeat 95.36
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 95.29
KOG4340 459 consensus Uncharacterized conserved protein [Funct 95.05
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.02
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 94.87
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.69
PF1342844 TPR_14: Tetratricopeptide repeat 94.69
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.68
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.65
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.56
smart00299140 CLH Clathrin heavy chain repeat homology. 94.52
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 94.51
PF13762145 MNE1: Mitochondrial splicing apparatus component 94.49
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.45
KOG2376 652 consensus Signal recognition particle, subunit Srp 94.44
PF1342844 TPR_14: Tetratricopeptide repeat 94.4
smart00299140 CLH Clathrin heavy chain repeat homology. 94.38
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.09
KOG4162799 consensus Predicted calmodulin-binding protein [Si 94.04
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 94.02
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.02
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.01
PRK15331165 chaperone protein SicA; Provisional 93.88
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.79
KOG3785 557 consensus Uncharacterized conserved protein [Funct 93.77
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 93.73
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 93.73
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.65
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 93.54
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.47
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.46
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.39
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 93.38
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 93.33
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 93.03
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.84
PF13929292 mRNA_stabil: mRNA stabilisation 92.78
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 92.68
PF12688120 TPR_5: Tetratrico peptide repeat 92.61
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 92.5
PF13762145 MNE1: Mitochondrial splicing apparatus component 92.5
PF13929292 mRNA_stabil: mRNA stabilisation 92.34
KOG2796366 consensus Uncharacterized conserved protein [Funct 92.32
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 92.18
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 91.91
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 91.88
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.83
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.79
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.73
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 91.52
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 91.28
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 90.9
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.86
cd00280200 TRFH Telomeric Repeat binding Factor or TTAGGG Rep 90.76
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 90.74
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.59
COG1729262 Uncharacterized protein conserved in bacteria [Fun 90.56
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.51
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.31
PRK10564303 maltose regulon periplasmic protein; Provisional 90.24
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.22
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.08
KOG4555175 consensus TPR repeat-containing protein [Function 90.01
COG3118304 Thioredoxin domain-containing protein [Posttransla 89.9
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 89.76
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 89.62
KOG4555175 consensus TPR repeat-containing protein [Function 89.49
PF1343134 TPR_17: Tetratricopeptide repeat 89.49
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.35
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.95
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.58
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.58
COG4105254 ComL DNA uptake lipoprotein [General function pred 88.38
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 87.98
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 87.79
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 87.48
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 87.25
COG3898 531 Uncharacterized membrane-bound protein [Function u 87.18
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 86.99
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 86.85
PF13170297 DUF4003: Protein of unknown function (DUF4003) 86.83
KOG4570 418 consensus Uncharacterized conserved protein [Funct 86.49
KOG2041 1189 consensus WD40 repeat protein [General function pr 86.39
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.32
COG4455 273 ImpE Protein of avirulence locus involved in tempe 86.05
PF13281374 DUF4071: Domain of unknown function (DUF4071) 86.04
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 85.45
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 85.11
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 84.49
PF02847113 MA3: MA3 domain; InterPro: IPR003891 This entry re 84.43
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 84.01
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 83.44
KOG2063 877 consensus Vacuolar assembly/sorting proteins VPS39 83.41
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 83.38
PRK10564303 maltose regulon periplasmic protein; Provisional 83.3
PRK11639169 zinc uptake transcriptional repressor; Provisional 83.28
PF02847113 MA3: MA3 domain; InterPro: IPR003891 This entry re 82.31
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 81.91
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 81.67
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 81.12
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 81.02
COG1747 711 Uncharacterized N-terminal domain of the transcrip 80.98
PRK13342 413 recombination factor protein RarA; Reviewed 80.84
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 80.8
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 80.77
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 80.63
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.9e-39  Score=255.28  Aligned_cols=176  Identities=32%  Similarity=0.549  Sum_probs=172.3

Q ss_pred             CcchhHHHHHHHHHHhcCChhHHHHHhccCCCCChhHHHHHHHHHhhcCChhHHHHHHHHhHhCCCCCcHHHHHHHHHHh
Q 036068            3 NKDVISWTAIVSRYINRGQVDIARQCFDQMPERDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILTAR   82 (178)
Q Consensus         3 ~p~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~   82 (178)
                      .||..+|++||++|++.|++++|.++|++|+++|+.+||+||.+|++.|+.++|.++|++|.+.|+.||..||++++++|
T Consensus       256 ~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~  335 (697)
T PLN03081        256 VGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIF  335 (697)
T ss_pred             CccceeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHH
Confidence            47888999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccchhhHHHHHHHHHHhCcccchHHHHHHHHHHHhcCChhhhc--------cchhhHHHHHHHHHhcCChhHHHHHHH
Q 036068           83 ANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQ--------KDKFSWTTMIVGLAISGNGDKALDMFS  154 (178)
Q Consensus        83 ~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~~~~~~a~--------~~~~~~~~li~~~~~~~~~~~a~~~~~  154 (178)
                      ++.|++++|.++++.|.+.|+.|+..++++|+++|+++|++++|.        ||..+||+||.+|++.|+.++|+++|+
T Consensus       336 ~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~  415 (697)
T PLN03081        336 SRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFE  415 (697)
T ss_pred             HhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHH
Confidence            999999999999999999999999999999999999999999998        899999999999999999999999999


Q ss_pred             HHHHcCCCCChhHHHHHHhhhhcC
Q 036068          155 QMLRASIKPDEVAYVGVLSACTHN  178 (178)
Q Consensus       155 ~m~~~g~~p~~~t~~~li~a~~~~  178 (178)
                      +|.+.|+.||..||+.+|.+|+++
T Consensus       416 ~M~~~g~~Pd~~T~~~ll~a~~~~  439 (697)
T PLN03081        416 RMIAEGVAPNHVTFLAVLSACRYS  439 (697)
T ss_pred             HHHHhCCCCCHHHHHHHHHHHhcC
Confidence            999999999999999999999874



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00280 TRFH Telomeric Repeat binding Factor or TTAGGG Repeat binding Factor, central (dimerization) domain Homology; TRFH Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>PF02847 MA3: MA3 domain; InterPro: IPR003891 This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [, , ] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>PF02847 MA3: MA3 domain; InterPro: IPR003891 This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [, , ] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 45.2 bits (105), Expect = 4e-06
 Identities = 18/153 (11%), Positives = 44/153 (28%), Gaps = 15/153 (9%)

Query: 40  WTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILTARANLRALDLGEWIKTYID 99
            T  +    R+   + A  L    + +     E  +  +L       +LD+ +       
Sbjct: 60  LTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHS 119

Query: 100 KNKVKNDIFAGNALIDMYCICADVEKAQK---------------DKFSWTTMIVGLAISG 144
           + ++        A      +   +  A                     +  +++G A  G
Sbjct: 120 QAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQG 179

Query: 145 NGDKALDMFSQMLRASIKPDEVAYVGVLSACTH 177
              + + +   +  A + PD ++Y   L     
Sbjct: 180 AFKELVYVLFMVKDAGLTPDLLSYAAALQCMGR 212


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.91
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.91
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.78
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.77
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.5
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.49
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.49
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.49
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.48
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.47
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.47
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.45
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.45
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.44
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.44
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.42
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.42
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.42
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.39
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.38
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.38
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.37
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.36
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.35
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.33
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.33
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.32
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.31
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.29
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.29
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.27
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.25
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.24
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.22
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.22
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.2
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.2
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.19
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.15
3u4t_A272 TPR repeat-containing protein; structural genomics 99.14
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.13
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.11
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.09
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.07
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.04
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.03
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.03
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.03
3u4t_A272 TPR repeat-containing protein; structural genomics 99.01
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.0
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.99
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.95
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.92
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.92
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.9
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.89
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.88
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.88
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.85
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.85
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.85
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.84
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.84
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.84
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.81
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.77
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.77
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.71
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.71
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.71
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.69
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.66
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.66
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.66
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.66
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.63
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.63
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.63
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.62
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.62
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.62
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.61
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.61
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.61
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.61
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.6
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.59
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.59
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.56
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.56
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.56
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.55
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.54
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.54
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.53
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.53
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.53
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.52
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.52
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.51
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.49
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.48
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.47
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.46
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.44
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.43
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.43
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.43
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.42
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.42
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.4
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.4
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.39
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.39
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.39
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.36
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.36
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.36
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.36
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.35
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.35
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.35
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.33
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.33
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.32
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.31
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.3
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.28
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.28
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.24
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.21
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.19
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.19
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.19
3k9i_A117 BH0479 protein; putative protein binding protein, 98.17
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.16
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.13
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.12
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.11
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.11
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.09
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.09
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.08
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.0
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 98.0
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.0
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.0
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.99
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.98
3k9i_A117 BH0479 protein; putative protein binding protein, 97.97
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.94
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.91
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.9
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.83
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.83
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.82
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.81
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.8
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.8
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.75
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.73
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.73
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.7
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.67
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.67
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.63
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 97.63
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.57
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.55
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.47
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.41
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.37
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.32
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.31
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.27
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.27
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.2
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.16
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.12
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.09
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.03
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.96
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.85
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.84
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.77
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.55
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.53
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.47
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.22
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.21
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.19
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.12
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.09
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.06
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.89
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 95.85
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.84
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 95.83
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.79
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.74
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.23
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.1
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.01
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.76
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.6
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.59
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 94.48
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 94.29
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.14
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 93.93
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.82
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.71
1ug3_A 339 EIF4GI, eukaryotic protein synthesis initiation fa 93.52
2ion_A152 PDCD4, programmed cell death 4, PDCD4; alpha-helic 92.79
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.34
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.28
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.83
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 91.3
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 90.59
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 90.26
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 89.76
2ion_A152 PDCD4, programmed cell death 4, PDCD4; alpha-helic 89.43
2xig_A150 Ferric uptake regulation protein; hpfur, transcrip 89.39
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.27
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.25
2fe3_A145 Peroxide operon regulator; oxidative stress regula 88.9
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 88.65
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.46
1mzb_A136 Ferric uptake regulation protein; ferric uptake re 88.14
2w57_A150 Ferric uptake regulation protein; gene regulation, 88.13
2zu6_B307 Programmed cell death protein 4; protein-protein c 87.44
2uwj_G115 Type III export protein PSCG; virulence, chaperone 87.43
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 87.25
3eiq_C358 Programmed cell death protein 4; PDCD4, anti-oncog 86.74
2p58_C116 Putative type III secretion protein YSCG; type III 86.67
3eyy_A145 Putative iron uptake regulatory protein; NUR, nick 85.53
4ets_A162 Ferric uptake regulation protein; metal binding pr 85.45
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 84.06
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 83.62
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 82.7
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 81.77
1ug3_A 339 EIF4GI, eukaryotic protein synthesis initiation fa 80.91
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=2.3e-37  Score=237.38  Aligned_cols=171  Identities=9%  Similarity=0.078  Sum_probs=163.8

Q ss_pred             hHHHHHHHHHHhcCChhHHHHHhccCC----CCChhHHHHHHHHHhhcCC---------hhHHHHHHHHhHhCCCCCcHH
Q 036068            7 ISWTAIVSRYINRGQVDIARQCFDQMP----ERDYVLWTAMIDGYLRVNR---------FREALTLFQEMQTSNIMGDEF   73 (178)
Q Consensus         7 ~~~~~li~~~~~~~~~~~a~~~~~~m~----~~~~~~~~~li~~~~~~~~---------~~~a~~~~~~m~~~~~~~~~~   73 (178)
                      .+++.+|++|++.|++++|.++|++|+    +||..+||+||.+|++.+.         .++|.++|++|.+.|+.||..
T Consensus        27 ~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd~~  106 (501)
T 4g26_A           27 ALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPNEA  106 (501)
T ss_dssp             HHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCCHH
T ss_pred             HHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCCHH
Confidence            457889999999999999999999997    4899999999999998765         688999999999999999999


Q ss_pred             HHHHHHHHhccccchhhHHHHHHHHHHhCcccchHHHHHHHHHHHhcCChhhhc------------cchhhHHHHHHHHH
Q 036068           74 TIVSILTARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQ------------KDKFSWTTMIVGLA  141 (178)
Q Consensus        74 ~~~~ll~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~~~~~~a~------------~~~~~~~~li~~~~  141 (178)
                      ||+++|.+|++.|++++|.++|++|.+.|+.|+..||+++|.+|++.|++++|.            ||..||++||.+|+
T Consensus       107 tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~  186 (501)
T 4g26_A          107 TFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSM  186 (501)
T ss_dssp             HHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999999999999997            89999999999999


Q ss_pred             hcCChhHHHHHHHHHHHcCCCCChhHHHHHHhhhhc
Q 036068          142 ISGNGDKALDMFSQMLRASIKPDEVAYVGVLSACTH  177 (178)
Q Consensus       142 ~~~~~~~a~~~~~~m~~~g~~p~~~t~~~li~a~~~  177 (178)
                      +.|++++|.+++++|.+.|+.|+..||+.|+..|+.
T Consensus       187 ~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s  222 (501)
T 4g26_A          187 DTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKS  222 (501)
T ss_dssp             HTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHS
T ss_pred             hCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhc
Confidence            999999999999999999999999999999998864



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ug3_A EIF4GI, eukaryotic protein synthesis initiation factor 4G; heat repeat, translation; 2.24A {Homo sapiens} SCOP: a.118.1.14 a.118.1.14 Back     alignment and structure
>2ion_A PDCD4, programmed cell death 4, PDCD4; alpha-helical, antitumor protein; 1.57A {Mus musculus} SCOP: a.118.1.14 PDB: 2ios_A 2iol_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>2ion_A PDCD4, programmed cell death 4, PDCD4; alpha-helical, antitumor protein; 1.57A {Mus musculus} SCOP: a.118.1.14 PDB: 2ios_A 2iol_A Back     alignment and structure
>2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 Back     alignment and structure
>2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} Back     alignment and structure
>2zu6_B Programmed cell death protein 4; protein-protein complex, ATP-binding, helicase, hydrolase, initiation factor, nucleotide-binding; 2.80A {Homo sapiens} PDB: 3eij_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3eiq_C Programmed cell death protein 4; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Mus musculus} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1ug3_A EIF4GI, eukaryotic protein synthesis initiation factor 4G; heat repeat, translation; 2.24A {Homo sapiens} SCOP: a.118.1.14 a.118.1.14 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.3
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.11
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.08
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.01
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.99
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.84
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.75
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.74
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.66
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.56
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.46
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.43
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.42
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.35
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.31
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.29
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.27
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.26
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.18
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.12
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.07
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.04
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.98
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.96
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.94
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.94
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.88
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.85
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.85
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.85
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.8
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 97.71
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.61
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.56
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.43
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.36
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.33
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.22
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.11
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.93
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 96.73
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.59
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.47
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.38
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.19
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.13
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.86
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 95.29
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 95.27
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 94.29
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 93.47
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.38
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.3
d1ug3a1193 Eukaryotic initiation factor eIF4G {Human (Homo sa 91.57
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.16
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 89.76
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 89.4
d1ug3a1193 Eukaryotic initiation factor eIF4G {Human (Homo sa 87.83
d1peqa1162 R1 subunit of ribonucleotide reductase, N-terminal 87.28
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.30  E-value=2e-10  Score=82.19  Aligned_cols=168  Identities=12%  Similarity=0.025  Sum_probs=132.3

Q ss_pred             cchhHHHHHHHHHHhcCChhHHHHHhccCCC---CChhHHHHHHHHHhhcCChhHHHHHHHHhHhCCCCCcHHHHHHHHH
Q 036068            4 KDVISWTAIVSRYINRGQVDIARQCFDQMPE---RDYVLWTAMIDGYLRVNRFREALTLFQEMQTSNIMGDEFTIVSILT   80 (178)
Q Consensus         4 p~~~~~~~li~~~~~~~~~~~a~~~~~~m~~---~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~   80 (178)
                      -++..|..+...+...|++++|...+++..+   .+...+..+...+.+.|++++|.+.|++..+.. +-+..++..+..
T Consensus       201 ~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~  279 (388)
T d1w3ba_         201 NFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLAN  279 (388)
T ss_dssp             TCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHH
T ss_pred             ccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHH
Confidence            3456678888888888999888888887653   466677778888888999999999998887764 235677888888


Q ss_pred             HhccccchhhHHHHHHHHHHhCcccchHHHHHHHHHHHhcCChhhhc----------c-chhhHHHHHHHHHhcCChhHH
Q 036068           81 ARANLRALDLGEWIKTYIDKNKVKNDIFAGNALIDMYCICADVEKAQ----------K-DKFSWTTMIVGLAISGNGDKA  149 (178)
Q Consensus        81 ~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~~~~~~a~----------~-~~~~~~~li~~~~~~~~~~~a  149 (178)
                      ++.+.|++++|.+.++...... +.+...+..+...+.+.|++++|.          | +..+|..+...+.+.|++++|
T Consensus       280 ~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A  358 (388)
T d1w3ba_         280 ALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEA  358 (388)
T ss_dssp             HHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHH
T ss_pred             HHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHH
Confidence            8899999999999998887765 346778888888899999999887          3 466788888999999999999


Q ss_pred             HHHHHHHHHcCCCCC-hhHHHHHHhhh
Q 036068          150 LDMFSQMLRASIKPD-EVAYVGVLSAC  175 (178)
Q Consensus       150 ~~~~~~m~~~g~~p~-~~t~~~li~a~  175 (178)
                      .+.|++.++  +.|+ ...+..+-.+|
T Consensus       359 ~~~~~~al~--l~P~~~~a~~~lg~~~  383 (388)
T d1w3ba_         359 LMHYKEAIR--ISPTFADAYSNMGNTL  383 (388)
T ss_dssp             HHHHHHHHT--TCTTCHHHHHHHHHHH
T ss_pred             HHHHHHHHH--hCCCCHHHHHHHHHHH
Confidence            999999886  3575 45566655544



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ug3a1 a.118.1.14 (A:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ug3a1 a.118.1.14 (A:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1peqa1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure