Citrus Sinensis ID: 036661


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-----
MAASSLPPRLNKIYRSSTINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFDDSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHINGKTCTFTVED
cccccccHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHccccccccEEEHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHcHHHccccccccHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEccEEEEEEccc
cHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEcc
maasslpprlnkiyRSSTINQWNSQIREAVDKNEAHKALLLFRRMkkndiepnnltfPFIAKACAKLSDFLYSQMihghivkspfwsdiFVQTTMVDMYAKCDRLDCAYKLfdkmpdrdvaSWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSiiggctygdkfddslNFYRHmiydgfrpdVTTVVSLLSScvcpealvqgRLVHshgihygfdLDVSVINTLISMYskcgdidsaRFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMIsgcgqsgalelgkwfdnyacsgglkdnVMVCNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAgflekgwgYFNLMTKVyqvnpelnhYSCMADLLGRKGKLKEALDFvqsmpiksdagiWGTLLCACKIHRNIEIGEYVAYRLfelephsaapyvEMANIYALGGRWDGVANLRTMMKrnqvkkfpgqslvhingktctftved
maasslpprlnkiyrsstinqwnsqiREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFDDSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNqvkkfpgqslvhingktctftved
MAASSLPPRLNKIYRSSTINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFDDSLNFYRHMIYDGFRPDvttvvsllsscvcPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHINGKTCTFTVED
*****************TINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFDDSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHINGKTCTFT***
***SSLPPRLNKIYRSSTINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFDDSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHINGKTCTFTVED
********RLNKIYRSSTINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFDDSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHINGKTCTFTVED
MAASSLPPRLNKIYRSSTINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFDDSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHINGKTCTFTVED
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASSLPPRLNKIYRSSTxxxxxxxxxxxxxxxxxxxxxLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFDDSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHINGKTCTFTVED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query615 2.2.26 [Sep-21-2011]
P0C8Q2654 Pentatricopeptide repeat- yes no 0.982 0.923 0.586 0.0
Q3E6Q1 809 Pentatricopeptide repeat- no no 0.931 0.708 0.366 1e-116
Q9SN39 871 Pentatricopeptide repeat- no no 0.962 0.679 0.349 1e-110
Q9LFL5 850 Pentatricopeptide repeat- no no 0.978 0.708 0.340 1e-105
Q9SS97660 Putative pentatricopeptid no no 0.969 0.903 0.333 1e-105
Q9LTV8 694 Pentatricopeptide repeat- no no 0.879 0.779 0.352 1e-103
Q9SVP7 1064 Pentatricopeptide repeat- no no 0.941 0.544 0.342 1e-102
O04659691 Pentatricopeptide repeat- no no 0.970 0.863 0.351 1e-101
Q9SIT7697 Pentatricopeptide repeat- no no 0.882 0.779 0.333 1e-100
Q9SMZ2 990 Pentatricopeptide repeat- no no 0.959 0.595 0.340 1e-100
>sp|P0C8Q2|PP323_ARATH Pentatricopeptide repeat-containing protein At4g19191, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E1 PE=2 SV=1 Back     alignment and function desciption
 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/607 (58%), Positives = 450/607 (74%), Gaps = 3/607 (0%)

Query: 9   RLNKIYRSSTINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLS 68
           RL +I   S++N WN QIREAV++N+  ++LLLFR MK+   EPNN TFPF+AKACA+L+
Sbjct: 7   RLYRISGLSSVNAWNLQIREAVNRNDPVESLLLFREMKRGGFEPNNFTFPFVAKACARLA 66

Query: 69  DFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIV 128
           D    +M+H H++KSPFWSD+FV T  VDM+ KC+ +D A K+F++MP+RD  +WNAM+ 
Sbjct: 67  DVGCCEMVHAHLIKSPFWSDVFVGTATVDMFVKCNSVDYAAKVFERMPERDATTWNAMLS 126

Query: 129 GFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDA 188
           GF Q G  +K   LF  MRL  I  D VTVM L Q+A   K L LL+++H+ GI +GVD 
Sbjct: 127 GFCQSGHTDKAFSLFREMRLNEITPDSVTVMTLIQSASFEKSLKLLEAMHAVGIRLGVDV 186

Query: 189 DVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGG-CTYGDKFDDSLNFYR 247
            V+V NTWIS Y KC DL  A+LVF  I+ G RTVVSWNS+      +G+ F D+   Y 
Sbjct: 187 QVTVANTWISTYGKCGDLDSAKLVFEAIDRGDRTVVSWNSMFKAYSVFGEAF-DAFGLYC 245

Query: 248 HMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCG 307
            M+ + F+PD++T ++L +SC  PE L QGRL+HSH IH G D D+  INT ISMYSK  
Sbjct: 246 LMLREEFKPDLSTFINLAASCQNPETLTQGRLIHSHAIHLGTDQDIEAINTFISMYSKSE 305

Query: 308 DIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMIS 367
           D  SAR LFD M  RT VSWT MISGYA+KGD+DEAL LF AM  +GE PDLVT+LS+IS
Sbjct: 306 DTCSARLLFDIMTSRTCVSWTVMISGYAEKGDMDEALALFHAMIKSGEKPDLVTLLSLIS 365

Query: 368 GCGQSGALELGKWFDNYA-CSGGLKDNVMVCNALIDMYSKCGSIGDARELFYALPEKTVV 426
           GCG+ G+LE GKW D  A   G  +DNVM+CNALIDMYSKCGSI +AR++F   PEKTVV
Sbjct: 366 GCGKFGSLETGKWIDARADIYGCKRDNVMICNALIDMYSKCGSIHEARDIFDNTPEKTVV 425

Query: 427 SWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLM 486
           +WTTMIAG ALNG F+EAL LF +M++LD +PN +TFLAVLQAC H+G LEKGW YF++M
Sbjct: 426 TWTTMIAGYALNGIFLEALKLFSKMIDLDYKPNHITFLAVLQACAHSGSLEKGWEYFHIM 485

Query: 487 TKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEI 546
            +VY ++P L+HYSCM DLLGRKGKL+EAL+ +++M  K DAGIWG LL ACKIHRN++I
Sbjct: 486 KQVYNISPGLDHYSCMVDLLGRKGKLEEALELIRNMSAKPDAGIWGALLNACKIHRNVKI 545

Query: 547 GEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHING 606
            E  A  LF LEP  AAPYVEMANIYA  G WDG A +R++MK+  +KK+PG+S++ +NG
Sbjct: 546 AEQAAESLFNLEPQMAAPYVEMANIYAAAGMWDGFARIRSIMKQRNIKKYPGESVIQVNG 605

Query: 607 KTCTFTV 613
           K  +FTV
Sbjct: 606 KNHSFTV 612





Arabidopsis thaliana (taxid: 3702)
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFL5|PP390_ARATH Pentatricopeptide repeat-containing protein At5g16860 OS=Arabidopsis thaliana GN=PCMP-H92 PE=2 SV=1 Back     alignment and function description
>sp|Q9SS97|PP205_ARATH Putative pentatricopeptide repeat-containing protein At3g01580 OS=Arabidopsis thaliana GN=PCMP-E87 PE=3 SV=2 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function description
>sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protein At5g27110 OS=Arabidopsis thaliana GN=PCMP-E14 PE=2 SV=2 Back     alignment and function description
>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=3 SV=1 Back     alignment and function description
>sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protein At4g33170 OS=Arabidopsis thaliana GN=PCMP-H53 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query615
225438593637 PREDICTED: pentatricopeptide repeat-cont 1.0 0.965 0.643 0.0
147769567609 hypothetical protein VITISV_020733 [Viti 0.988 0.998 0.627 0.0
449451649651 PREDICTED: pentatricopeptide repeat-cont 0.995 0.940 0.606 0.0
297804224 1251 putative protein [Arabidopsis lyrata sub 0.969 0.476 0.597 0.0
2828294 1260 putatative protein [Arabidopsis thaliana 0.982 0.479 0.586 0.0
356528513651 PREDICTED: pentatricopeptide repeat-cont 0.980 0.926 0.590 0.0
186512044654 pentatricopeptide repeat-containing prot 0.982 0.923 0.586 0.0
255582516468 pentatricopeptide repeat-containing prot 0.691 0.908 0.647 1e-168
148909481 795 unknown [Picea sitchensis] 0.962 0.744 0.405 1e-132
449523792 821 PREDICTED: pentatricopeptide repeat-cont 0.956 0.716 0.371 1e-121
>gi|225438593|ref|XP_002276456.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Vitis vinifera] gi|296082485|emb|CBI21490.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  838 bits (2165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/615 (64%), Positives = 495/615 (80%)

Query: 1   MAASSLPPRLNKIYRSSTINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFI 60
           M   +     N+     T+ QWNS I E+V++  AHKALLLFR+MK+N +EPNNLTFP +
Sbjct: 1   MVTPAATQSFNRFSNLWTVAQWNSSITESVNQGYAHKALLLFRQMKQNGLEPNNLTFPSV 60

Query: 61  AKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDV 120
           AKAC+KL +  YSQ++H H+VKS F +D+FVQT++VDMY KC +L  AY LF +MP RDV
Sbjct: 61  AKACSKLLNLKYSQIVHTHVVKSRFQADLFVQTSVVDMYVKCSQLGFAYNLFSRMPKRDV 120

Query: 121 ASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSF 180
           ASWN+MI+GFAQ+GF+++V+ LF  M + GI+AD VTV+GLT +A+  K L +L+S+HSF
Sbjct: 121 ASWNSMILGFAQLGFVDRVVSLFCEMGIEGIRADSVTVIGLTHSALSLKDLKMLESIHSF 180

Query: 181 GIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFD 240
           GI IG+D DVSV NTWI+AYAKC +  +AE VF GI++GL+T VSWNS+I G  + ++  
Sbjct: 181 GIKIGIDTDVSVSNTWIAAYAKCGEFGLAETVFDGIDKGLKTGVSWNSMIAGYAHFEQCS 240

Query: 241 DSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLI 300
            ++ F++ M+  GFR D++T++SLLSSCV PE L  G+L+H+HGI  G D D+ VINTLI
Sbjct: 241 KAVGFFKKMLCGGFRADLSTILSLLSSCVQPEVLFHGKLIHAHGIQVGCDSDIQVINTLI 300

Query: 301 SMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLV 360
           SMYSKCGDI SAR+LFD M  +TRVSWTAMI+GYA+KGDLDEA+ LF AMEA GE PDLV
Sbjct: 301 SMYSKCGDIGSARYLFDNMLGKTRVSWTAMIAGYAEKGDLDEAMTLFSAMEAVGEKPDLV 360

Query: 361 TVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMYSKCGSIGDARELFYAL 420
           T++S++SGCGQ+GALELGKW D YA + GLKDN+MVCNALID+Y+KCGS+ +ARELFY +
Sbjct: 361 TIISLMSGCGQTGALELGKWIDTYATANGLKDNLMVCNALIDVYAKCGSMDNARELFYTM 420

Query: 421 PEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGW 480
           PEK++VSWTT+IAGCALNGEF EAL LF QM+EL L+PN +TFLAVLQAC HAGFLEKGW
Sbjct: 421 PEKSLVSWTTLIAGCALNGEFKEALGLFFQMVELGLKPNHITFLAVLQACNHAGFLEKGW 480

Query: 481 GYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKI 540
             FNLMTKVY++NP L+HYSCMADLLGRKG+LKEA +F+Q+MP K D GIW  LL ACKI
Sbjct: 481 ECFNLMTKVYKINPGLDHYSCMADLLGRKGRLKEAFEFIQNMPFKPDVGIWSVLLSACKI 540

Query: 541 HRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQS 600
           H+N+ IGE VAY LFELEP +A PYV+MANIYA  G+WD VA +RTMMK N+  K PG+S
Sbjct: 541 HQNVVIGECVAYHLFELEPQTAVPYVQMANIYASAGKWDRVAAIRTMMKCNKAMKSPGKS 600

Query: 601 LVHINGKTCTFTVED 615
           LV +NGKT  FTVED
Sbjct: 601 LVQVNGKTHEFTVED 615




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147769567|emb|CAN65709.1| hypothetical protein VITISV_020733 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449451649|ref|XP_004143574.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial-like [Cucumis sativus] gi|449516723|ref|XP_004165396.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297804224|ref|XP_002869996.1| putative protein [Arabidopsis lyrata subsp. lyrata] gi|297315832|gb|EFH46255.1| putative protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|2828294|emb|CAA16708.1| putatative protein [Arabidopsis thaliana] gi|7268714|emb|CAB78921.1| putatative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356528513|ref|XP_003532847.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|186512044|ref|NP_001119013.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635616|sp|P0C8Q2.1|PP323_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g19191, mitochondrial; Flags: Precursor gi|332658758|gb|AEE84158.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255582516|ref|XP_002532043.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528286|gb|EEF30333.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|148909481|gb|ABR17838.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|449523792|ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query615
TAIR|locus:4515103421654 AT4G19191 "AT4G19191" [Arabido 0.982 0.923 0.581 3.6e-192
TAIR|locus:2202074 809 CRR22 "CHLORORESPIRATORY REDUC 0.956 0.726 0.352 1.6e-104
TAIR|locus:2124137 871 DOT4 "DEFECTIVELY ORGANIZED TR 0.962 0.679 0.341 9.1e-100
TAIR|locus:2054131697 SLO2 "AT2G13600" [Arabidopsis 0.517 0.456 0.413 1.1e-95
TAIR|locus:2141171857 AT4G21300 [Arabidopsis thalian 0.960 0.689 0.327 3e-92
TAIR|locus:2181201691 AT5G27110 [Arabidopsis thalian 0.967 0.861 0.348 3e-92
TAIR|locus:2125899 990 AT4G33170 [Arabidopsis thalian 0.959 0.595 0.336 3.9e-92
TAIR|locus:2119440 1064 AT4G13650 [Arabidopsis thalian 0.959 0.554 0.338 1e-91
TAIR|locus:2089333654 AT3G16610 "AT3G16610" [Arabido 0.954 0.897 0.342 7.3e-91
TAIR|locus:2007116787 AT1G69350 "AT1G69350" [Arabido 0.951 0.743 0.329 1.9e-90
TAIR|locus:4515103421 AT4G19191 "AT4G19191" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1862 (660.5 bits), Expect = 3.6e-192, P = 3.6e-192
 Identities = 353/607 (58%), Positives = 442/607 (72%)

Query:     9 RLNKIYRSSTINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLS 68
             RL +I   S++N WN QIREAV++N+  ++LLLFR MK+   EPNN TFPF+AKACA+L+
Sbjct:     7 RLYRISGLSSVNAWNLQIREAVNRNDPVESLLLFREMKRGGFEPNNFTFPFVAKACARLA 66

Query:    69 DFLYSQMIHGHIVKSPFWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIV 128
             D    +M+H H++KSPFWSD+FV T  VDM+ KC+ +D A K+F++MP+RD  +WNAM+ 
Sbjct:    67 DVGCCEMVHAHLIKSPFWSDVFVGTATVDMFVKCNSVDYAAKVFERMPERDATTWNAMLS 126

Query:   129 GFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDA 188
             GF Q G  +K   LF  MRL  I  D VTVM L Q+A   K L LL+++H+ GI +GVD 
Sbjct:   127 GFCQSGHTDKAFSLFREMRLNEITPDSVTVMTLIQSASFEKSLKLLEAMHAVGIRLGVDV 186

Query:   189 DVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCT-YGDKFDDSLNFYR 247
              V+V NTWIS Y KC DL  A+LVF  I+ G RTVVSWNS+    + +G+ FD +   Y 
Sbjct:   187 QVTVANTWISTYGKCGDLDSAKLVFEAIDRGDRTVVSWNSMFKAYSVFGEAFD-AFGLYC 245

Query:   248 HMIYDGFRPDXXXXXXXXXXXXXPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCG 307
              M+ + F+PD             PE L QGRL+HSH IH G D D+  INT ISMYSK  
Sbjct:   246 LMLREEFKPDLSTFINLAASCQNPETLTQGRLIHSHAIHLGTDQDIEAINTFISMYSKSE 305

Query:   308 DIDSARFLFDGMCDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMIS 367
             D  SAR LFD M  RT VSWT MISGYA+KGD+DEAL LF AM  +GE PDLVT+LS+IS
Sbjct:   306 DTCSARLLFDIMTSRTCVSWTVMISGYAEKGDMDEALALFHAMIKSGEKPDLVTLLSLIS 365

Query:   368 GCGQSGALELGKWFDNYACSGGLK-DNVMVCNALIDMYSKCGSIGDARELFYALPEKTVV 426
             GCG+ G+LE GKW D  A   G K DNVM+CNALIDMYSKCGSI +AR++F   PEKTVV
Sbjct:   366 GCGKFGSLETGKWIDARADIYGCKRDNVMICNALIDMYSKCGSIHEARDIFDNTPEKTVV 425

Query:   427 SWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLM 486
             +WTTMIAG ALNG F+EAL LF +M++LD +PN +TFLAVLQAC H+G LEKGW YF++M
Sbjct:   426 TWTTMIAGYALNGIFLEALKLFSKMIDLDYKPNHITFLAVLQACAHSGSLEKGWEYFHIM 485

Query:   487 TKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEI 546
              +VY ++P L+HYSCM DLLGRKGKL+EAL+ +++M  K DAGIWG LL ACKIHRN++I
Sbjct:   486 KQVYNISPGLDHYSCMVDLLGRKGKLEEALELIRNMSAKPDAGIWGALLNACKIHRNVKI 545

Query:   547 GEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHING 606
              E  A  LF LEP  AAPYVEMANIYA  G WDG A +R++MK+  +KK+PG+S++ +NG
Sbjct:   546 AEQAAESLFNLEPQMAAPYVEMANIYAAAGMWDGFARIRSIMKQRNIKKYPGESVIQVNG 605

Query:   607 KTCTFTV 613
             K  +FTV
Sbjct:   606 KNHSFTV 612




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124137 DOT4 "DEFECTIVELY ORGANIZED TRIBUTARIES 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054131 SLO2 "AT2G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141171 AT4G21300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181201 AT5G27110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125899 AT4G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089333 AT3G16610 "AT3G16610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007116 AT1G69350 "AT1G69350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C8Q2PP323_ARATHNo assigned EC number0.58640.98210.9235yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query615
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-146
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-92
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-88
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-75
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-60
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-48
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-30
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-17
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-13
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-08
pfam0153531 pfam01535, PPR, PPR repeat 4e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-04
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.003
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  445 bits (1146), Expect = e-146
 Identities = 210/579 (36%), Positives = 315/579 (54%), Gaps = 4/579 (0%)

Query: 37  KALLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSPFWSDIFVQTTMV 96
           +AL L+ RM    + P+  TFP + + C  + D    + +H H+V+  F  D+ V   ++
Sbjct: 170 EALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALI 229

Query: 97  DMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFV 156
            MY KC  +  A  +FD+MP RD  SWNAMI G+ + G   + L LF+ MR + +  D +
Sbjct: 230 TMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLM 289

Query: 157 TVMGLTQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGI 216
           T+  +  A        L + +H + +  G   DVSVCN+ I  Y        AE VF  +
Sbjct: 290 TITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRM 349

Query: 217 EEGLRTVVSWNSIIGGCTYGDKFDDSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQ 276
           E   +  VSW ++I G       D +L  Y  M  D   PD  T+ S+LS+C C   L  
Sbjct: 350 E--TKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDV 407

Query: 277 GRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTRVSWTAMISGYAQ 336
           G  +H      G    V V N LI MYSKC  ID A  +F  + ++  +SWT++I+G   
Sbjct: 408 GVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRL 467

Query: 337 KGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMV 396
                EAL  F  M    + P+ VT+++ +S C + GAL  GK    +    G+  +  +
Sbjct: 468 NNRCFEALIFFRQMLLTLK-PNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFL 526

Query: 397 CNALIDMYSKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDL 456
            NAL+D+Y +CG +  A   F    EK VVSW  ++ G   +G+   A++LF++M+E  +
Sbjct: 527 PNALLDLYVRCGRMNYAWNQF-NSHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGV 585

Query: 457 RPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEAL 516
            P+ VTF+++L AC+ +G + +G  YF+ M + Y + P L HY+C+ DLLGR GKL EA 
Sbjct: 586 NPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAY 645

Query: 517 DFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAPYVEMANIYALGG 576
           +F+  MPI  D  +WG LL AC+IHR++E+GE  A  +FEL+P+S   Y+ + N+YA  G
Sbjct: 646 NFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAG 705

Query: 577 RWDGVANLRTMMKRNQVKKFPGQSLVHINGKTCTFTVED 615
           +WD VA +R  M+ N +   PG S V + GK   F  +D
Sbjct: 706 KWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDD 744


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 615
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.91
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.86
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.86
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.86
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
PRK14574 822 hmsH outer membrane protein; Provisional 99.83
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.82
KOG2003840 consensus TPR repeat-containing protein [General f 99.8
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.79
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.79
KOG2076895 consensus RNA polymerase III transcription factor 99.78
KOG2076 895 consensus RNA polymerase III transcription factor 99.77
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.77
KOG2003 840 consensus TPR repeat-containing protein [General f 99.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.71
KOG0547606 consensus Translocase of outer mitochondrial membr 99.68
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.68
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.65
KOG1915677 consensus Cell cycle control protein (crooked neck 99.63
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.61
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.6
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.6
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.59
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.58
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.58
KOG1126638 consensus DNA-binding cell division cycle control 99.58
KOG1126638 consensus DNA-binding cell division cycle control 99.57
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.57
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.56
KOG0547606 consensus Translocase of outer mitochondrial membr 99.56
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.54
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.53
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.51
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.51
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.5
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.48
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.47
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.45
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.45
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.44
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.42
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.39
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.38
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.38
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.36
PRK12370553 invasion protein regulator; Provisional 99.36
KOG1129478 consensus TPR repeat-containing protein [General f 99.34
PRK11189296 lipoprotein NlpI; Provisional 99.33
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.33
KOG1129478 consensus TPR repeat-containing protein [General f 99.33
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.33
PRK12370553 invasion protein regulator; Provisional 99.32
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.31
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.29
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.29
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.28
PF1304150 PPR_2: PPR repeat family 99.25
PRK11189296 lipoprotein NlpI; Provisional 99.21
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.21
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.2
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.18
PF1304150 PPR_2: PPR repeat family 99.17
KOG2376652 consensus Signal recognition particle, subunit Srp 99.14
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.13
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.13
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.13
KOG1125579 consensus TPR repeat-containing protein [General f 99.07
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.07
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.06
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.06
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.05
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.04
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.03
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.03
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.02
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.01
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.01
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.0
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.0
PRK10370198 formate-dependent nitrite reductase complex subuni 98.99
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.99
PRK15359144 type III secretion system chaperone protein SscB; 98.93
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.93
PRK04841 903 transcriptional regulator MalT; Provisional 98.9
PRK15359144 type III secretion system chaperone protein SscB; 98.86
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.85
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.8
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.79
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.78
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.76
PLN02789320 farnesyltranstransferase 98.75
PRK04841903 transcriptional regulator MalT; Provisional 98.72
KOG1125579 consensus TPR repeat-containing protein [General f 98.72
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.71
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.71
PLN02789320 farnesyltranstransferase 98.7
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.7
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.69
PRK10370198 formate-dependent nitrite reductase complex subuni 98.69
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.66
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.66
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.65
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.6
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.6
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.59
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.56
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.53
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.53
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.49
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.46
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.46
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.45
PF1285434 PPR_1: PPR repeat 98.43
PF1285434 PPR_1: PPR repeat 98.35
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.35
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.33
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.32
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.32
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.32
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.32
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.31
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.27
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.25
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.23
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.23
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.22
KOG0553304 consensus TPR repeat-containing protein [General f 98.22
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.2
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.19
KOG0553304 consensus TPR repeat-containing protein [General f 98.19
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.18
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.17
COG4700251 Uncharacterized protein conserved in bacteria cont 98.15
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.13
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.1
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.1
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.1
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.05
PF1337173 TPR_9: Tetratricopeptide repeat 98.04
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.04
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.02
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.02
PRK15331165 chaperone protein SicA; Provisional 97.99
COG4700251 Uncharacterized protein conserved in bacteria cont 97.98
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.95
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.95
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.95
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.94
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.92
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.91
PF1343134 TPR_17: Tetratricopeptide repeat 97.91
PRK10803263 tol-pal system protein YbgF; Provisional 97.85
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.8
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.78
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.77
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.74
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.72
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.71
PF12688120 TPR_5: Tetratrico peptide repeat 97.71
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.69
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.66
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.66
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.66
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.65
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.65
KOG20411189 consensus WD40 repeat protein [General function pr 97.64
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.61
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.6
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.56
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.55
PF1342844 TPR_14: Tetratricopeptide repeat 97.52
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.49
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.49
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.49
PF1337173 TPR_9: Tetratricopeptide repeat 97.46
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.45
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.45
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.44
PRK10803263 tol-pal system protein YbgF; Provisional 97.43
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.43
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.42
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.4
PF12688120 TPR_5: Tetratrico peptide repeat 97.38
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.35
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.34
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.33
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.3
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.23
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.22
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.2
PF13512142 TPR_18: Tetratricopeptide repeat 97.18
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.17
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.17
PRK11906458 transcriptional regulator; Provisional 97.08
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.06
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.98
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.97
KOG1258577 consensus mRNA processing protein [RNA processing 96.97
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.96
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.94
KOG20411189 consensus WD40 repeat protein [General function pr 96.94
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.87
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.83
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.82
KOG4555175 consensus TPR repeat-containing protein [Function 96.82
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.81
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.79
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.78
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.71
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.69
PRK15331165 chaperone protein SicA; Provisional 96.68
KOG4234271 consensus TPR repeat-containing protein [General f 96.55
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.51
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.46
PRK11906458 transcriptional regulator; Provisional 96.44
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.43
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.41
PRK11619 644 lytic murein transglycosylase; Provisional 96.37
KOG1585308 consensus Protein required for fusion of vesicles 96.36
PF13512142 TPR_18: Tetratricopeptide repeat 96.31
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.23
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.19
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.14
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.05
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.05
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.04
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.0
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.97
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.91
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.85
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.85
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.76
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.7
smart00299140 CLH Clathrin heavy chain repeat homology. 95.68
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.65
KOG3941406 consensus Intermediate in Toll signal transduction 95.58
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.53
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.48
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.4
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.39
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.38
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.37
KOG4555175 consensus TPR repeat-containing protein [Function 95.35
PF1342844 TPR_14: Tetratricopeptide repeat 95.33
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.25
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.13
KOG3941406 consensus Intermediate in Toll signal transduction 95.12
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.0
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.98
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.81
KOG4648 536 consensus Uncharacterized conserved protein, conta 94.76
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.72
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.6
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.58
KOG4234271 consensus TPR repeat-containing protein [General f 94.48
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.21
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.15
PRK09687280 putative lyase; Provisional 94.11
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.09
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.05
smart00299140 CLH Clathrin heavy chain repeat homology. 94.05
KOG1585308 consensus Protein required for fusion of vesicles 94.05
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.88
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.86
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.81
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 93.8
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.49
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.47
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.44
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.31
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.3
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 93.29
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.25
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 93.18
PF06552186 TOM20_plant: Plant specific mitochondrial import r 93.0
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.95
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.88
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.85
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 92.72
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.7
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 92.63
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 92.6
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.48
KOG1586288 consensus Protein required for fusion of vesicles 92.42
KOG1258577 consensus mRNA processing protein [RNA processing 92.41
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.33
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.28
COG3629280 DnrI DNA-binding transcriptional activator of the 92.19
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 92.07
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.06
COG3947361 Response regulator containing CheY-like receiver a 91.78
COG3629280 DnrI DNA-binding transcriptional activator of the 91.56
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 91.32
PRK10941269 hypothetical protein; Provisional 91.19
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.16
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 91.12
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.72
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.58
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 90.57
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.52
KOG3364149 consensus Membrane protein involved in organellar 90.4
COG1747 711 Uncharacterized N-terminal domain of the transcrip 90.04
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 89.83
KOG1586288 consensus Protein required for fusion of vesicles 89.61
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.5
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 89.24
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 88.87
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 88.78
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 88.78
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 88.74
COG1747 711 Uncharacterized N-terminal domain of the transcrip 88.62
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.49
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.46
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 88.33
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.19
PRK11619 644 lytic murein transglycosylase; Provisional 87.8
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 87.54
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.92
COG4455 273 ImpE Protein of avirulence locus involved in tempe 86.89
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 86.87
COG4455273 ImpE Protein of avirulence locus involved in tempe 86.86
PF1343134 TPR_17: Tetratricopeptide repeat 86.85
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 86.71
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.7
KOG1550552 consensus Extracellular protein SEL-1 and related 86.62
KOG4570 418 consensus Uncharacterized conserved protein [Funct 86.44
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.15
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.98
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 85.97
KOG4507 886 consensus Uncharacterized conserved protein, conta 85.81
PRK09687280 putative lyase; Provisional 85.74
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 85.37
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 85.3
KOG1550 552 consensus Extracellular protein SEL-1 and related 85.28
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 85.17
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 84.78
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.43
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 84.03
KOG2422 665 consensus Uncharacterized conserved protein [Funct 83.24
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.6
COG5159 421 RPN6 26S proteasome regulatory complex component [ 82.41
KOG4507 886 consensus Uncharacterized conserved protein, conta 82.38
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 82.22
PF1286294 Apc5: Anaphase-promoting complex subunit 5 82.2
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 81.85
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 81.11
COG4976 287 Predicted methyltransferase (contains TPR repeat) 81.11
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.4e-92  Score=753.70  Aligned_cols=606  Identities=35%  Similarity=0.621  Sum_probs=597.8

Q ss_pred             CcchhhhhccCCCchhcHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCcccHHHHHHHHHhcCCchhHhHHHHHHhhcC
Q 036661            5 SLPPRLNKIYRSSTINQWNSQIREAVDKNEAHKALLLFRRMKKNDIEPNNLTFPFIAKACAKLSDFLYSQMIHGHIVKSP   84 (615)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~   84 (615)
                      .+.++|+.|+.|+.. +||.+|.+|.+.|++++|+++|++|...|+.||..||+.++.+|+..+++..+.+++..+.+.|
T Consensus       139 ~A~~~f~~m~~~d~~-~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g  217 (857)
T PLN03077        139 HAWYVFGKMPERDLF-SWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFG  217 (857)
T ss_pred             HHHHHHhcCCCCCee-EHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcC
Confidence            467899999999999 9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCChHHHHHHHHHhhcCCChhHHHHhhccCCCCCchhHHHHHHHHHhcCChHHHHHHHHHhHHcCCcCChhHHHHHHHH
Q 036661           85 FWSDIFVQTTMVDMYAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQA  164 (615)
Q Consensus        85 ~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~  164 (615)
                      +.||..++|.|+.+|++.|++++|.++|++|++||..+||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+
T Consensus       218 ~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a  297 (857)
T PLN03077        218 FELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISA  297 (857)
T ss_pred             CCcccchHhHHHHHHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCChhHHHHHHHHHHHhcCCCccchHHHHHHHHHccCCHHHHHHHHHhcccCCCCcchHHHHHHHHhcCCChhhHHH
Q 036661          165 AIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDKFDDSLN  244 (615)
Q Consensus       165 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~  244 (615)
                      |+..|+.+.+.+++..+.+.|+.||..+|+.++.+|++.|++++|.++|++|.  .|+..+||.+|.+|.+.|++++|++
T Consensus       298 ~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~--~~d~~s~n~li~~~~~~g~~~~A~~  375 (857)
T PLN03077        298 CELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRME--TKDAVSWTAMISGYEKNGLPDKALE  375 (857)
T ss_pred             HHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCC--CCCeeeHHHHHHHHHhCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999998  7999999999999999999999999


Q ss_pred             HHHHHHHCCCCCCHHhHHHHHHhccCchhhhhhhHHHHHHHHhcCCCChhHHHHHHHHHHhcCCHHHHHHHHhccCCCCc
Q 036661          245 FYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGMCDRTR  324 (615)
Q Consensus       245 ~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~  324 (615)
                      +|++|.+.|+.||..||+.++.+|++.|+++.+.+++..+.+.|+.|+..+++.|+.+|++.|++++|.++|++|.++|.
T Consensus       376 lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~  455 (857)
T PLN03077        376 TYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDV  455 (857)
T ss_pred             HHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHhhcccchhhHHHHHHHHHHhcCCCCchHHHHHHHHHH
Q 036661          325 VSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVCNALIDMY  404 (615)
Q Consensus       325 ~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~  404 (615)
                      .+|+.++.+|++.|+.++|+.+|++|.. +++||..||..++.+|++.|+.+.+.+++..+.+.|+.++..++++|+++|
T Consensus       456 vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y  534 (857)
T PLN03077        456 ISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLY  534 (857)
T ss_pred             eeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHH
Confidence            9999999999999999999999999986 599999999999999999999999999999999999999999999999999


Q ss_pred             HhcCChHHHHHHHhcCCCCChHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHhhccCchHHHHHHHH
Q 036661          405 SKCGSIGDARELFYALPEKTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFN  484 (615)
Q Consensus       405 ~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~  484 (615)
                      +++|++++|.++|+.+ .+|..+|+.++.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|.+.|.+++|.++|+
T Consensus       535 ~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~  613 (857)
T PLN03077        535 VRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFH  613 (857)
T ss_pred             HHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHH
Confidence            9999999999999999 899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhCCCCChhHHHHHHHHHHhcCChHHHHHHHHhCCCCCChhhHHHHHHHHHHhCChhHHHHHHHHHhccCCCCCCC
Q 036661          485 LMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRLFELEPHSAAP  564 (615)
Q Consensus       485 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~p~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~p~~~~~  564 (615)
                      .|.+.+++.|+..+|+.++++|.+.|++++|.+++++|+.+|+..+|..++.+|..+|+.+.++...+++++++|+++..
T Consensus       614 ~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~  693 (857)
T PLN03077        614 SMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGY  693 (857)
T ss_pred             HHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcch
Confidence            99977899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHhHHHHHHccCChHHHHHHHHHHHhcCcccCCceeEEEecCeEEEEecCC
Q 036661          565 YVEMANIYALGGRWDGVANLRTMMKRNQVKKFPGQSLVHINGKTCTFTVED  615 (615)
Q Consensus       565 ~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  615 (615)
                      |..++++|...|+|++|.++.+.|.++|++++||+|||.+++.+|.|.+||
T Consensus       694 y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d  744 (857)
T PLN03077        694 YILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDD  744 (857)
T ss_pred             HHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEECCEEEEEecCC
Confidence            999999999999999999999999999999999999999999999999998



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query615
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 65.3 bits (158), Expect = 4e-11
 Identities = 91/624 (14%), Positives = 168/624 (26%), Gaps = 225/624 (36%)

Query: 44  RMKKNDIEPNNLTFPFIAKA-CAKLSDFL---YSQMIHGHIVKSP---------FWSDIF 90
           + +  DI        F+    C  + D      S+    HI+ S          FW+ + 
Sbjct: 15  QYQYKDILSVFED-AFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLS 73

Query: 91  VQTTMVDMYAKCDRLDCAYK-LFDKM------PDRDVAS--------WNAMIVGFAQMGF 135
            Q  MV  + + + L   YK L   +      P              +N   V FA+   
Sbjct: 74  KQEEMVQKFVE-EVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQV-FAKYNV 131

Query: 136 --LEKVLCL---FYNMRLVGIQADFVTV--MG------LTQAAIHAKHLSLLKSVHSFGI 182
             L+  L L      +R     A  V +  +       +      +  +   +    F I
Sbjct: 132 SRLQPYLKLRQALLELR----PAKNVLIDGVLGSGKTWVALDVCLSYKV---QCKMDFKI 184

Query: 183 HIGVDADVSVCNTWISAYAKCND----LKMAELVFRGIEEGLRTVVSWNSIIGGCTYGDK 238
                        W++    CN     L+M + +   I+                +  D 
Sbjct: 185 F------------WLN-LKNCNSPETVLEMLQKLLYQIDPNW------------TSRSD- 218

Query: 239 FDDSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINT 298
              ++    H I    R        LL S      L    LV          L       
Sbjct: 219 HSSNIKLRIHSIQAELR-------RLLKSKPYENCL----LV----------LL------ 251

Query: 299 LISMYSKCGDIDSARFL--FDGMCDR----TR-VSWTAMISGYAQKG----------DLD 341
                    ++ +A+    F+  C +    TR    T  +S                  D
Sbjct: 252 ---------NVQNAKAWNAFNLSC-KILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPD 301

Query: 342 EALRLF--FAMEAAGEVPDLVT-----VLSMISGCGQSGAL---ELGKWFDNYACSGGLK 391
           E   L   +      ++P  V       LS+I             L  W DN+       
Sbjct: 302 EVKSLLLKYLDCRPQDLPREVLTTNPRRLSII------AESIRDGLATW-DNW-----KH 349

Query: 392 DNVMVCNALIDMYSKCGSIGDARELFYAL---------PEKT-VVSWTTMIAGCALNGEF 441
            N      +I+         + R++F  L         P     + W  +I         
Sbjct: 350 VNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIK------SD 403

Query: 442 VEA-LDLFHQ--MMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKV---YQVNPE 495
           V   ++  H+  ++E   + + ++  ++               Y  L  K+   Y ++  
Sbjct: 404 VMVVVNKLHKYSLVEKQPKESTISIPSI---------------YLELKVKLENEYALHRS 448

Query: 496 L-NHYSCMADLLGRKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAYRL 554
           + +HY            + +  D    +P   D   +                 ++ + L
Sbjct: 449 IVDHY-----------NIPKTFDSDDLIPPYLDQYFY----------------SHIGHHL 481

Query: 555 FELEPHSAAPYVEMANIYALGGRW 578
             +E            ++ L  R+
Sbjct: 482 KNIEH--PERMTLFRMVF-LDFRF 502


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query615
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.81
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.76
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.76
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.73
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.72
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
3u4t_A272 TPR repeat-containing protein; structural genomics 99.64
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.64
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.64
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.62
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.62
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.62
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.62
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.62
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.61
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.61
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.59
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.59
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.58
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.57
3u4t_A272 TPR repeat-containing protein; structural genomics 99.57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.57
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.57
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.56
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.55
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.55
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.52
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.51
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.45
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.44
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.44
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.43
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.43
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.43
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.42
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.42
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.39
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.39
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.38
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.34
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.31
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.29
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.27
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.25
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.24
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.24
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.21
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.21
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.21
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.19
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.19
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.17
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.17
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.17
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.14
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.13
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.12
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.1
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.1
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.08
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.06
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.05
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.03
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.0
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.0
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.0
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.0
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.98
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.97
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.97
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.97
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.95
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.95
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.91
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.91
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.91
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.9
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.89
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.89
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.87
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.86
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.86
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.85
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.85
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.85
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.83
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.83
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.82
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.82
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.82
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.81
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.8
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.79
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.79
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.77
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.74
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.73
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.73
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.73
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.73
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.72
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.72
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.71
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.71
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.7
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.67
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.67
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.67
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.66
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.65
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.65
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.64
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.63
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.63
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.61
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.61
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.6
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.56
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.55
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.52
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.52
3k9i_A117 BH0479 protein; putative protein binding protein, 98.51
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.5
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.5
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.5
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.49
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.48
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.48
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.47
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.43
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.42
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.42
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.42
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.41
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.41
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.4
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.39
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.38
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.38
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.38
3k9i_A117 BH0479 protein; putative protein binding protein, 98.37
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.37
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.35
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.31
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.29
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.28
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.26
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.24
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.22
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.22
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.21
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.18
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.18
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.09
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.06
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.0
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.95
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.86
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.86
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.85
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.84
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.84
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.74
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.68
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.65
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.62
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.58
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.5
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.5
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.46
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.27
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.18
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.18
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.15
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.14
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 97.11
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.06
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.05
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.04
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.01
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.5
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.49
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.36
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.35
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.25
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.22
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.19
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.03
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.84
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.76
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.59
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.44
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.68
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.65
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.26
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.15
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.06
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.86
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.83
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.21
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.41
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 92.29
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 91.36
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 91.06
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.82
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 90.33
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 90.33
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 90.06
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.36
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 88.23
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 87.7
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.59
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 87.56
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.13
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 85.96
2uwj_G115 Type III export protein PSCG; virulence, chaperone 82.37
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 81.67
2p58_C116 Putative type III secretion protein YSCG; type III 81.61
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.5
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3.4e-41  Score=352.95  Aligned_cols=486  Identities=10%  Similarity=-0.038  Sum_probs=403.2

Q ss_pred             hhcCCChhHHHHhhccCCCCCchhHHHHHHHHHhcCChHHHHHHHHHhHHcCCcCChhHHHHHHHHHHhcCChhHHHHHH
Q 036661           99 YAKCDRLDCAYKLFDKMPDRDVASWNAMIVGFAQMGFLEKVLCLFYNMRLVGIQADFVTVMGLTQAAIHAKHLSLLKSVH  178 (615)
Q Consensus        99 ~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~  178 (615)
                      +...|.+..+...+..++.++...|+.++..+.+.|++++|+++|++|..  ..|+..++..+..+|...|+++.|..++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~  140 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLL  140 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHH
Confidence            45567777788888888888899999999999999999999999999985  5688899999999999999999999999


Q ss_pred             HHHHHhcCCCccchHHHHHHHHHccCCHHHHHHHHHhcccCC-----------------CCcchHHHHHHHHhcCCChhh
Q 036661          179 SFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGL-----------------RTVVSWNSIIGGCTYGDKFDD  241 (615)
Q Consensus       179 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-----------------~~~~~~~~li~~~~~~~~~~~  241 (615)
                      +.+...  +++..+++.++.+|.+.|++++|.++|+++....                 .+..+|+.++.+|.+.|++++
T Consensus       141 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  218 (597)
T 2xpi_A          141 TKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDR  218 (597)
T ss_dssp             HHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHH
Confidence            988653  6788899999999999999999999999644211                 247889999999999999999


Q ss_pred             HHHHHHHHHHCCCCCCHHhHHHHHHhccCchhhhhhh--HH-HHHHHHhcCCCChhHHHHHHHHHHhcCCHHHHHHHHhc
Q 036661          242 SLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGR--LV-HSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDG  318 (615)
Q Consensus       242 a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~--~~-~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~  318 (615)
                      |++.|++|.+.+. .+...+..+...+...+..+...  .+ +..+...+..+...+++.++..|.+.|++++|.++|+.
T Consensus       219 A~~~~~~~~~~~p-~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~  297 (597)
T 2xpi_A          219 AKECYKEALMVDA-KCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSS  297 (597)
T ss_dssp             HHHHHHHHHHHCT-TCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHhCc-hhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHH
Confidence            9999999998652 24455555665555544433322  11 44444444445556677778899999999999999999


Q ss_pred             cCC--CCcccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHhhcccchhhHHHHHHHHHHhcCCCCchHH
Q 036661          319 MCD--RTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMV  396 (615)
Q Consensus       319 ~~~--~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~  396 (615)
                      +..  ++..+|+.++..|.+.|++++|.++|+++.+.+ +.+..++..++.++...|+.++|..+++.+.+.. +.+..+
T Consensus       298 ~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~  375 (597)
T 2xpi_A          298 INGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVT  375 (597)
T ss_dssp             STTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHH
T ss_pred             hhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHH
Confidence            966  788899999999999999999999999999865 4477788999999999999999999999998665 667889


Q ss_pred             HHHHHHHHHhcCChHHHHHHHhcCCC---CChHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHhhcc
Q 036661          397 CNALIDMYSKCGSIGDARELFYALPE---KTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHA  473 (615)
Q Consensus       397 ~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~  473 (615)
                      ++.++.+|.+.|++++|.++|+++.+   .+..+|+.++.+|.+.|++++|+++|+++.+.+ +.+..++..++.+|.+.
T Consensus       376 ~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~  454 (597)
T 2xpi_A          376 WLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQL  454 (597)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHc
Confidence            99999999999999999999998754   467899999999999999999999999999874 45778999999999999


Q ss_pred             CchHHHHHHHHHHHHhhCCCCChhHHHHHHHHHHhcCChHHHHHHHHhCC-------CCCC--hhhHHHHHHHHHHhCCh
Q 036661          474 GFLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMP-------IKSD--AGIWGTLLCACKIHRNI  544 (615)
Q Consensus       474 ~~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~-------~~p~--~~~~~~l~~~~~~~~~~  544 (615)
                      |++++|.++|+++.+.  .+.+..+|..++.+|.+.|++++|.++|+++.       ..|+  ..+|..++.+|.+.|++
T Consensus       455 g~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~  532 (597)
T 2xpi_A          455 GNILLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMY  532 (597)
T ss_dssp             TCHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCH
T ss_pred             CCHHHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCH
Confidence            9999999999999853  34467889999999999999999999999984       3666  67899999999999999


Q ss_pred             hHHHHHHHHHhccCCCCCCChHhHHHHHHccCChHHHHHHHHHHHhcCcc
Q 036661          545 EIGEYVAYRLFELEPHSAAPYVEMANIYALGGRWDGVANLRTMMKRNQVK  594 (615)
Q Consensus       545 ~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~  594 (615)
                      ++|+..++++++.+|+++.+|..++.+|.+.|++++|.+.++++.+..+.
T Consensus       533 ~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~  582 (597)
T 2xpi_A          533 DAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPN  582 (597)
T ss_dssp             HHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             HHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCC
Confidence            99999999999999999999999999999999999999999999886643



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 615
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.6 bits (96), Expect = 2e-04
 Identities = 30/194 (15%), Positives = 64/194 (32%), Gaps = 10/194 (5%)

Query: 392 DNVMVCNALIDMYSKCGSIGDARELFY---ALPEKTVVSWTTMIAGCALNGEFVEALDLF 448
           +  +  + L  +++  G I  A   F     L    + ++  +         F  A+  +
Sbjct: 167 NFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAY 226

Query: 449 HQMMELDLRPNRVTFLAVLQACTHAGFLEKGWGYFNLMTKVYQVNPEL-NHYSCMADLLG 507
            + + L    + V    +       G ++     +    +  ++ P   + Y  +A+ L 
Sbjct: 227 LRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYR---RAIELQPHFPDAYCNLANALK 282

Query: 508 RKGKLKEALDFVQSMPIKSDAGIWGTLLCACKIHRNIEIGEYVAY--RLFELEPHSAAPY 565
            KG + EA D   +               A        I E V    +  E+ P  AA +
Sbjct: 283 EKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAH 342

Query: 566 VEMANIYALGGRWD 579
             +A++    G+  
Sbjct: 343 SNLASVLQQQGKLQ 356


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query615
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.67
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.29
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.23
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.19
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.17
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.14
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.13
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.1
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.09
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.07
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.05
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.97
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.88
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.8
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.77
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.77
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.76
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.74
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.74
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.72
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.66
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.57
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.51
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.47
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.47
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.44
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.4
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.39
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.29
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.27
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.09
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.09
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.07
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.07
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.05
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.05
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.05
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.03
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.03
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.86
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.75
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.73
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.54
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.53
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.32
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.96
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.43
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.31
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.1
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.07
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.32
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.11
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.65
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 80.36
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=5.1e-23  Score=200.16  Aligned_cols=374  Identities=11%  Similarity=0.058  Sum_probs=264.4

Q ss_pred             HHHHHhcCChhHHHHHHHHHHHhcCCCccchHHHHHHHHHccCCHHHHHHHHHhcccCCC-CcchHHHHHHHHhcCCChh
Q 036661          162 TQAAIHAKHLSLLKSVHSFGIHIGVDADVSVCNTWISAYAKCNDLKMAELVFRGIEEGLR-TVVSWNSIIGGCTYGDKFD  240 (615)
Q Consensus       162 l~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~-~~~~~~~li~~~~~~~~~~  240 (615)
                      ...+.+.|+++.|.+.++.+++.. +-+..++..+..+|.+.|++++|...|+++.+..| +..+|..+...+...|+++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~   84 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQ   84 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccc
Confidence            344566777777777777777653 22455667777777777777777777777655434 4556667777777777777


Q ss_pred             hHHHHHHHHHHCCCCCCHHhHHHHHHhccCchhhhhhhHHHHHHHHhcCCCChhHHHHHHHHHHhcCCHHHHHHHHhcc-
Q 036661          241 DSLNFYRHMIYDGFRPDVTTVVSLLSSCVCPEALVQGRLVHSHGIHYGFDLDVSVINTLISMYSKCGDIDSARFLFDGM-  319 (615)
Q Consensus       241 ~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~-  319 (615)
                      +|+..+......... +..                                   ............+....+....... 
T Consensus        85 ~A~~~~~~~~~~~~~-~~~-----------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~  128 (388)
T d1w3ba_          85 EAIEHYRHALRLKPD-FID-----------------------------------GYINLAAALVAAGDMEGAVQAYVSAL  128 (388)
T ss_dssp             HHHHHHHHHHHHCTT-CHH-----------------------------------HHHHHHHHHHHHSCSSHHHHHHHHHH
T ss_pred             ccccccccccccccc-ccc-----------------------------------cccccccccccccccccccccccccc
Confidence            777777776654321 111                                   1122222222222222222222211 


Q ss_pred             --CCCCcccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHhhcccchhhHHHHHHHHHHhcCCCCchHHH
Q 036661          320 --CDRTRVSWTAMISGYAQKGDLDEALRLFFAMEAAGEVPDLVTVLSMISGCGQSGALELGKWFDNYACSGGLKDNVMVC  397 (615)
Q Consensus       320 --~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~  397 (615)
                        ..................+....+...+....... +.+...+..+...+...|+.+.|...++...+.. +.+...+
T Consensus       129 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~  206 (388)
T d1w3ba_         129 QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAY  206 (388)
T ss_dssp             HHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHH
T ss_pred             ccccccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHH
Confidence              22233344444555556666666666666655542 3345566666667777777777777777776654 4456677


Q ss_pred             HHHHHHHHhcCChHHHHHHHhcCCC---CChHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHhhccC
Q 036661          398 NALIDMYSKCGSIGDARELFYALPE---KTVVSWTTMIAGCALNGEFVEALDLFHQMMELDLRPNRVTFLAVLQACTHAG  474 (615)
Q Consensus       398 ~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~~  474 (615)
                      ..+...+...|++++|...++....   .+...+..+...+.+.|++++|+..+++..+.. +-+..++..+..++...|
T Consensus       207 ~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~  285 (388)
T d1w3ba_         207 INLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKG  285 (388)
T ss_dssp             HHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHS
T ss_pred             HHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcC
Confidence            7788888888888888888876544   456678888889999999999999999998863 334578888999999999


Q ss_pred             chHHHHHHHHHHHHhhCCCCChhHHHHHHHHHHhcCChHHHHHHHHhCC-CCC-ChhhHHHHHHHHHHhCChhHHHHHHH
Q 036661          475 FLEKGWGYFNLMTKVYQVNPELNHYSCMADLLGRKGKLKEALDFVQSMP-IKS-DAGIWGTLLCACKIHRNIEIGEYVAY  552 (615)
Q Consensus       475 ~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~-~~p-~~~~~~~l~~~~~~~~~~~~A~~~~~  552 (615)
                      ++++|.+.++....  ..+.+...+..++.++.+.|++++|++.+++.. ..| +..++..++.++...|++++|+..++
T Consensus       286 ~~~~A~~~~~~~~~--~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~  363 (388)
T d1w3ba_         286 SVAEAEDCYNTALR--LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYK  363 (388)
T ss_dssp             CHHHHHHHHHHHHH--HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHH
T ss_pred             CHHHHHHHHHhhhc--cCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            99999999999885  345566788889999999999999999999876 455 45678889999999999999999999


Q ss_pred             HHhccCCCCCCChHhHHHHHHccCC
Q 036661          553 RLFELEPHSAAPYVEMANIYALGGR  577 (615)
Q Consensus       553 ~~~~~~p~~~~~~~~l~~~~~~~g~  577 (615)
                      ++++++|+++.+|..+|.+|.+.||
T Consensus       364 ~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         364 EAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            9999999999999999999998886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure