Citrus Sinensis ID: 036731


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MANGNREFGVVCKPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEISLNSIPQFNRQK
cccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHcc
cHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHcc
mangnrefgvvckpntvtYNTIIDGLCKEGFVDKAKELFLQMkdeninpnvvtynSLIHgfcyandgneaEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIqggvrpdafcEINIVAYGCLIDGLCKIGKLKNARELSQSLtraglmpnvvTYNITIHALCNDEQMDKAHDLFLDMevkgvapncvifttlmpsfirkNETSKVIELLRSMdkrnvmpyASILSIIVDLLVKNEislnsipqfnrqk
mangnrefgvvckpntvtYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSltraglmpnVVTYNITIHALCNDEQMDKAHDLFLDMEVKGVAPNCVIfttlmpsfirkneTSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEislnsipqfnrqk
MANGNREFGVVCKPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEISLNSIPQFNRQK
*******FGVVCKPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEISLN*********
MANG***FGVVCKPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEISLNSIPQFNRQK
MANGNREFGVVCKPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEISLNSIPQFNRQK
MANGNREFGVVCKPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEISLNSIPQFNRQK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANGNREFGVVCKPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEISLNSIPQFNRQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query259 2.2.26 [Sep-21-2011]
Q0WVK7 741 Pentatricopeptide repeat- yes no 0.814 0.284 0.391 7e-41
Q76C99 791 Protein Rf1, mitochondria N/A no 0.915 0.299 0.353 1e-39
Q9LQ14629 Pentatricopeptide repeat- no no 0.814 0.335 0.373 2e-38
Q9LFF1754 Pentatricopeptide repeat- no no 0.857 0.294 0.346 1e-36
Q9SH26577 Pentatricopeptide repeat- no no 0.814 0.365 0.364 2e-36
Q9LUR2507 Putative pentatricopeptid no no 0.891 0.455 0.354 2e-36
Q9T0D6566 Pentatricopeptide repeat- no no 0.907 0.415 0.333 4e-36
Q9CAN0630 Pentatricopeptide repeat- no no 0.868 0.357 0.333 7e-36
Q9LQ16632 Pentatricopeptide repeat- no no 0.849 0.348 0.340 9e-36
Q9LPX2 644 Pentatricopeptide repeat- no no 0.876 0.352 0.347 4e-35
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function desciption
 Score =  167 bits (423), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 124/217 (57%), Gaps = 6/217 (2%)

Query: 14  PNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYL 73
           P+TV Y T+IDG CK G +  A + F +M   +I P+V+TY ++I GFC   D  EA  L
Sbjct: 349 PDTVVYTTLIDGFCKRGDIRAASKFFYEMHSRDITPDVLTYTAIISGFCQIGDMVEAGKL 408

Query: 74  FIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCL 133
           F EM  +GL+ D VTF  +++  CK   M +A R+ + MIQ G  P      N+V Y  L
Sbjct: 409 FHEMFCKGLEPDSVTFTELINGYCKAGHMKDAFRVHNHMIQAGCSP------NVVTYTTL 462

Query: 134 IDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGV 193
           IDGLCK G L +A EL   + + GL PN+ TYN  ++ LC    +++A  L  + E  G+
Sbjct: 463 IDGLCKEGDLDSANELLHEMWKIGLQPNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGL 522

Query: 194 APNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMP 230
             + V +TTLM ++ +  E  K  E+L+ M  + + P
Sbjct: 523 NADTVTYTTLMDAYCKSGEMDKAQEILKEMLGKGLQP 559





Arabidopsis thaliana (taxid: 3702)
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 Back     alignment and function description
>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 Back     alignment and function description
>sp|Q9LUR2|PP238_ARATH Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 Back     alignment and function description
>sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 Back     alignment and function description
>sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query259
359479583 627 PREDICTED: pentatricopeptide repeat-cont 0.922 0.381 0.424 1e-49
449529622 618 PREDICTED: pentatricopeptide repeat-cont 0.976 0.409 0.393 4e-49
449520325 605 PREDICTED: pentatricopeptide repeat-cont 0.976 0.418 0.374 2e-45
302806665 1636 hypothetical protein SELMODRAFT_424099 [ 0.899 0.142 0.372 6e-44
449462483 917 PREDICTED: pentatricopeptide repeat-cont 0.942 0.266 0.362 1e-42
449531171 761 PREDICTED: putative pentatricopeptide re 0.942 0.320 0.362 1e-42
302809105 725 hypothetical protein SELMODRAFT_123660 [ 0.864 0.308 0.378 8e-42
225452994 588 PREDICTED: putative pentatricopeptide re 0.868 0.382 0.402 1e-41
147768816 653 hypothetical protein VITISV_031897 [Viti 0.868 0.344 0.402 1e-41
296087909 1001 unnamed protein product [Vitis vinifera] 0.868 0.224 0.402 2e-41
>gi|359479583|ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 145/245 (59%), Gaps = 6/245 (2%)

Query: 1   MANGNREFGVVCKPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHG 60
           M NGN  FGV  KPN V Y TIID LCK+G +DK KELFL+MK   I+P+VV Y+S+IHG
Sbjct: 223 MLNGNGGFGVTIKPNLVCYCTIIDSLCKDGLIDKGKELFLEMKGRGISPDVVAYSSIIHG 282

Query: 61  FCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPD 120
            C+      A+ LF EM+D G+  +VVTFNV++D LCK  KM+EA  LL LMIQ G  PD
Sbjct: 283 MCHTGRWEGAKGLFNEMVDEGVHPNVVTFNVLIDALCKAGKMEEANHLLKLMIQRGESPD 342

Query: 121 AFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDK 180
            F       Y  LIDG C  G++ +AR+L  S+   G+  + V+YN+ I+  C   +M +
Sbjct: 343 TF------TYNTLIDGFCLEGRIDDARDLFVSMESKGIETDAVSYNVLINGYCKSGRMVE 396

Query: 181 AHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVD 240
           A  L+ +M  K + P  + + TL+    R+ +      L   M   ++ P +   +I++D
Sbjct: 397 AKKLYREMMCKEIMPTVITYNTLLTGLFREGKVRDAWNLFGEMKVHDLTPESCTYNILLD 456

Query: 241 LLVKN 245
            L KN
Sbjct: 457 GLCKN 461




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449529622|ref|XP_004171797.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520325|ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302806665|ref|XP_002985064.1| hypothetical protein SELMODRAFT_424099 [Selaginella moellendorffii] gi|300147274|gb|EFJ13939.1| hypothetical protein SELMODRAFT_424099 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|449462483|ref|XP_004148970.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449531171|ref|XP_004172561.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302809105|ref|XP_002986246.1| hypothetical protein SELMODRAFT_123660 [Selaginella moellendorffii] gi|300146105|gb|EFJ12777.1| hypothetical protein SELMODRAFT_123660 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|225452994|ref|XP_002263091.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147768816|emb|CAN62673.1| hypothetical protein VITISV_031897 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087909|emb|CBI35192.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query259
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.849 0.349 0.358 4.8e-36
TAIR|locus:2139732566 AT4G11690 [Arabidopsis thalian 0.907 0.415 0.333 3.5e-35
TAIR|locus:2089388507 AT3G16710 [Arabidopsis thalian 0.891 0.455 0.354 5.1e-35
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.822 0.282 0.351 1.3e-34
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.868 0.357 0.333 1.4e-34
TAIR|locus:2031301577 AT1G63400 [Arabidopsis thalian 0.814 0.365 0.364 2.8e-34
TAIR|locus:1009023134 644 AT1G12775 [Arabidopsis thalian 0.876 0.352 0.347 3.3e-34
TAIR|locus:2174165504 AT5G16640 [Arabidopsis thalian 0.891 0.458 0.358 9.5e-34
TAIR|locus:2038451323 AT1G63230 [Arabidopsis thalian 0.884 0.708 0.326 9.5e-34
TAIR|locus:2034760 637 AT1G12300 [Arabidopsis thalian 0.922 0.375 0.346 2.4e-33
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 393 (143.4 bits), Expect = 4.8e-36, P = 4.8e-36
 Identities = 81/226 (35%), Positives = 127/226 (56%)

Query:    14 PNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYL 73
             P+  TY+++I+G C    +D+AK +F  M  ++  PNVVTYN+LI GFC A    E   L
Sbjct:   358 PDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMEL 417

Query:    74 FIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCL 133
             F EM  RGL  + VT+N ++  L +    D A ++   M+  GV PD      I+ Y  L
Sbjct:   418 FREMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPD------IITYSIL 471

Query:   134 IDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGV 193
             +DGLCK GKL+ A  + + L ++ + P++ TYNI I  +C   +++   DLF  + +KGV
Sbjct:   472 LDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGV 531

Query:   194 APNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIV 239
              PN +I+TT++  F RK    +   L R M +   +P +   + ++
Sbjct:   532 KPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPNSGTYNTLI 577


GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006397 "mRNA processing" evidence=IMP
TAIR|locus:2139732 AT4G11690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089388 AT3G16710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031301 AT1G63400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023134 AT1G12775 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174165 AT5G16640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038451 AT1G63230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-22
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-21
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-15
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-14
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-12
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-11
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-09
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-08
pfam0153531 pfam01535, PPR, PPR repeat 1e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-07
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 4e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 6e-04
pfam0153531 pfam01535, PPR, PPR repeat 7e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 7e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 96.1 bits (239), Expect = 2e-22
 Identities = 54/229 (23%), Positives = 103/229 (44%), Gaps = 6/229 (2%)

Query: 13  KPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEY 72
            P+ +T   ++      G VD+AKE++  + + NI      Y   ++      D + A  
Sbjct: 576 DPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALS 635

Query: 73  LFIEMMDRGLQSDVVTFNVIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGC 132
           ++ +M  +G++ D V F+ ++D       +D+A  +L    + G++         V+Y  
Sbjct: 636 IYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKL------GTVSYSS 689

Query: 133 LIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKG 192
           L+         K A EL + +    L P V T N  I ALC   Q+ KA ++  +M+  G
Sbjct: 690 LMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLG 749

Query: 193 VAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDL 241
           + PN + ++ L+ +  RK++    ++LL    +  + P   +   I  L
Sbjct: 750 LCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCITGL 798


Length = 1060

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 259
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.82
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.82
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.75
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.74
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.74
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.73
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.69
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.68
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.67
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.67
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.66
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.63
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.63
PF1304150 PPR_2: PPR repeat family 99.62
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 99.61
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.6
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.58
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.58
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.57
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.57
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.56
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.55
KOG1126638 consensus DNA-binding cell division cycle control 99.55
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
PRK12370553 invasion protein regulator; Provisional 99.53
PF1304150 PPR_2: PPR repeat family 99.53
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.53
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.53
KOG1129478 consensus TPR repeat-containing protein [General f 99.52
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.5
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.49
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.48
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.47
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.45
PRK12370553 invasion protein regulator; Provisional 99.45
PRK14574 822 hmsH outer membrane protein; Provisional 99.45
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.44
KOG1129478 consensus TPR repeat-containing protein [General f 99.44
KOG1126638 consensus DNA-binding cell division cycle control 99.43
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.41
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.39
PRK11189296 lipoprotein NlpI; Provisional 99.37
PRK14574 822 hmsH outer membrane protein; Provisional 99.36
PRK11189296 lipoprotein NlpI; Provisional 99.36
KOG2003 840 consensus TPR repeat-containing protein [General f 99.35
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.31
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.3
KOG0547606 consensus Translocase of outer mitochondrial membr 99.3
KOG2076 895 consensus RNA polymerase III transcription factor 99.27
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.26
KOG2003 840 consensus TPR repeat-containing protein [General f 99.23
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.19
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.18
PF1285434 PPR_1: PPR repeat 99.16
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.14
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.13
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.09
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.09
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.07
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.04
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.04
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.04
PLN02789320 farnesyltranstransferase 99.03
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.02
PF1285434 PPR_1: PPR repeat 99.02
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.01
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.0
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.98
KOG2076 895 consensus RNA polymerase III transcription factor 98.98
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.98
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.96
KOG1125579 consensus TPR repeat-containing protein [General f 98.96
PRK10370198 formate-dependent nitrite reductase complex subuni 98.94
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.92
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.9
PRK10370198 formate-dependent nitrite reductase complex subuni 98.89
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.89
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.88
PRK15359144 type III secretion system chaperone protein SscB; 98.86
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.86
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.85
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.85
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.81
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.81
KOG1128777 consensus Uncharacterized conserved protein, conta 98.79
PRK15359144 type III secretion system chaperone protein SscB; 98.79
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.78
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.78
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.72
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.71
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.71
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.7
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.66
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.64
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.64
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.63
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.63
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.63
KOG1125579 consensus TPR repeat-containing protein [General f 98.63
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.63
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.61
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.61
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.61
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.6
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.59
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.58
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.57
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.56
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.56
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.54
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.54
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.52
PLN02789320 farnesyltranstransferase 98.51
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.51
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.49
PRK04841 903 transcriptional regulator MalT; Provisional 98.49
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.48
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.48
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.46
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.42
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.41
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.4
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.39
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.36
PRK04841 903 transcriptional regulator MalT; Provisional 98.35
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.35
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.34
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.33
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.32
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.32
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.31
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.29
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.29
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.29
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.28
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.27
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.26
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 98.25
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.25
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.25
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.25
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.24
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.24
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.23
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.22
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.2
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.18
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.18
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.17
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.17
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.16
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.15
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.15
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.14
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.13
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.13
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.1
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.1
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.09
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.09
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.08
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.06
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.02
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.02
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.01
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 98.0
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.99
PF12688120 TPR_5: Tetratrico peptide repeat 97.95
PF12688120 TPR_5: Tetratrico peptide repeat 97.92
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.9
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.85
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.84
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.82
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.82
KOG0553304 consensus TPR repeat-containing protein [General f 97.81
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.79
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.78
KOG0553304 consensus TPR repeat-containing protein [General f 97.78
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.74
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.74
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.73
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.71
PRK10803263 tol-pal system protein YbgF; Provisional 97.71
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.69
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.68
PRK10803263 tol-pal system protein YbgF; Provisional 97.66
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.63
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.62
COG4700251 Uncharacterized protein conserved in bacteria cont 97.58
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.58
KOG3941406 consensus Intermediate in Toll signal transduction 97.56
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.56
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.55
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.46
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.43
PRK15331165 chaperone protein SicA; Provisional 97.36
PF1337173 TPR_9: Tetratricopeptide repeat 97.32
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.3
PF1337173 TPR_9: Tetratricopeptide repeat 97.27
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.2
PF13170297 DUF4003: Protein of unknown function (DUF4003) 97.13
COG4700251 Uncharacterized protein conserved in bacteria cont 97.11
smart00299140 CLH Clathrin heavy chain repeat homology. 97.09
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.07
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.05
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.01
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.0
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.96
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.94
KOG3941 406 consensus Intermediate in Toll signal transduction 96.92
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.88
PF13512142 TPR_18: Tetratricopeptide repeat 96.86
PRK15331165 chaperone protein SicA; Provisional 96.86
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.78
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 96.76
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.69
PF13512142 TPR_18: Tetratricopeptide repeat 96.65
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.62
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.61
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.6
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.57
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.56
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.49
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.45
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.42
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.4
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.38
COG3629280 DnrI DNA-binding transcriptional activator of the 96.34
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.33
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.28
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.15
COG3629280 DnrI DNA-binding transcriptional activator of the 96.14
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.12
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.07
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.01
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.93
PF1342844 TPR_14: Tetratricopeptide repeat 95.86
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.82
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.81
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.81
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.81
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.75
PF1342844 TPR_14: Tetratricopeptide repeat 95.72
KOG4555175 consensus TPR repeat-containing protein [Function 95.72
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.68
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.49
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.47
COG3898 531 Uncharacterized membrane-bound protein [Function u 95.33
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.21
smart00299140 CLH Clathrin heavy chain repeat homology. 95.21
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.17
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 95.1
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.08
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.05
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 95.0
PRK11906458 transcriptional regulator; Provisional 95.0
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.85
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.81
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 94.74
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 94.73
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.64
KOG4570 418 consensus Uncharacterized conserved protein [Funct 94.63
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.63
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 94.46
KOG1585308 consensus Protein required for fusion of vesicles 94.42
KOG4570 418 consensus Uncharacterized conserved protein [Funct 94.42
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.34
KOG4555175 consensus TPR repeat-containing protein [Function 94.3
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.07
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 94.02
KOG2041 1189 consensus WD40 repeat protein [General function pr 93.99
KOG1550 552 consensus Extracellular protein SEL-1 and related 93.98
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 93.93
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.86
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.48
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.46
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.39
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.37
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.27
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.26
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.25
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.07
PF1343134 TPR_17: Tetratricopeptide repeat 93.03
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.97
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.71
PF13929292 mRNA_stabil: mRNA stabilisation 92.41
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.41
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.41
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.28
PF1343134 TPR_17: Tetratricopeptide repeat 92.23
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 92.22
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 91.9
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 91.87
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.66
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 91.54
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.54
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 91.43
PRK11906458 transcriptional regulator; Provisional 91.41
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.4
COG4455 273 ImpE Protein of avirulence locus involved in tempe 91.38
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 91.02
KOG4234271 consensus TPR repeat-containing protein [General f 90.6
COG4455273 ImpE Protein of avirulence locus involved in tempe 90.58
PF13929292 mRNA_stabil: mRNA stabilisation 90.34
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 90.31
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.3
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.16
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 90.07
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.04
PHA02875 413 ankyrin repeat protein; Provisional 89.98
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.86
KOG1586288 consensus Protein required for fusion of vesicles 89.85
KOG1550552 consensus Extracellular protein SEL-1 and related 89.78
COG3947361 Response regulator containing CheY-like receiver a 89.44
COG1747 711 Uncharacterized N-terminal domain of the transcrip 89.24
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.94
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.94
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.85
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 88.76
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 88.65
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.35
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.27
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 88.21
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 88.07
PF06552186 TOM20_plant: Plant specific mitochondrial import r 87.91
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 87.7
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 87.63
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 87.5
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 87.4
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 87.37
KOG1585308 consensus Protein required for fusion of vesicles 87.08
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 86.98
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.97
COG2976207 Uncharacterized protein conserved in bacteria [Fun 86.62
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.19
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 86.13
PRK10564303 maltose regulon periplasmic protein; Provisional 84.66
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 84.45
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 84.06
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 83.26
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 83.24
PRK10564303 maltose regulon periplasmic protein; Provisional 83.19
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 83.18
PF13762145 MNE1: Mitochondrial splicing apparatus component 83.03
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 82.52
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 82.15
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 82.13
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 81.85
PHA02875 413 ankyrin repeat protein; Provisional 81.47
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 80.75
KOG4648 536 consensus Uncharacterized conserved protein, conta 80.66
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 80.49
KOG4507886 consensus Uncharacterized conserved protein, conta 80.49
cd0881988 CARD_MDA5_2 Caspase activation and recruitment dom 80.26
KOG1258577 consensus mRNA processing protein [RNA processing 80.26
PRK09462148 fur ferric uptake regulator; Provisional 80.07
COG2976207 Uncharacterized protein conserved in bacteria [Fun 80.06
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.8e-47  Score=321.56  Aligned_cols=240  Identities=18%  Similarity=0.333  Sum_probs=129.1

Q ss_pred             cCCHHHHHHHHHHHHhcCChHHHHHHHHHHhhCCCCCchHhHHHHHHHHhhcCChhHHHHHHHHHHH--cCCCCchhhHH
Q 036731           13 KPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMD--RGLQSDVVTFN   90 (259)
Q Consensus        13 ~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~--~~~~~~~~~~~   90 (259)
                      .||..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|..  .|+.||..+|+
T Consensus       504 ~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTyn  583 (1060)
T PLN03218        504 EANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVG  583 (1060)
T ss_pred             CCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHH
Confidence            4444444444444444444444444444444444444444444444444444444444444444443  33444444455


Q ss_pred             HHHHHHHHcCCHHHHHHHHHHHHhCCCCCCCccchhHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCChhhHHHHHH
Q 036731           91 VIMDELCKNRKMDEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIH  170 (259)
Q Consensus        91 ~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~  170 (259)
                      .++.+|++.|++++|.++|++|.+.|+.|      +..+|+.+|.+|++.|++++|..+|++|.+.|+.||..+|+.++.
T Consensus       584 aLI~ay~k~G~ldeA~elf~~M~e~gi~p------~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~  657 (1060)
T PLN03218        584 ALMKACANAGQVDRAKEVYQMIHEYNIKG------TPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVD  657 (1060)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHcCCCC------ChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHH
Confidence            55555555555555555555444444444      235555555555555555555555555555555555555555555


Q ss_pred             HHHhcCChhHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCccchHHHHHHHHHHHHhcccCC
Q 036731          171 ALCNDEQMDKAHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEISLN  250 (259)
Q Consensus       171 ~~~~~~~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  250 (259)
                      +|++.|++++|.+++++|.+.|+.||..+|+.|+.+|++.|++++|.++|++|.+.|+.|+..+|+.++.+|++.|++++
T Consensus       658 a~~k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~ee  737 (1060)
T PLN03218        658 VAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPK  737 (1060)
T ss_pred             HHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHH
Confidence            55555555555555555555555555555555555555555555555555555555555555555555555555555555


Q ss_pred             cchhhhcc
Q 036731          251 SIPQFNRQ  258 (259)
Q Consensus       251 a~~~~~~~  258 (259)
                      |+++|++|
T Consensus       738 Alelf~eM  745 (1060)
T PLN03218        738 ALEVLSEM  745 (1060)
T ss_pred             HHHHHHHH
Confidence            55555554



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>cd08819 CARD_MDA5_2 Caspase activation and recruitment domain found in MDA5, second repeat Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PRK09462 fur ferric uptake regulator; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 80.6 bits (197), Expect = 2e-17
 Identities = 23/181 (12%), Positives = 59/181 (32%), Gaps = 10/181 (5%)

Query: 13  KPNTVTYNTIIDGLCKEGFVDKAKELFLQMKDENIN---PNVVTYNSLIHGFCYANDGNE 69
                              +  A  L +    +        +  YN+++ G+       E
Sbjct: 124 SGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKE 183

Query: 70  AEYLFIEMMDRGLQSDVVTFNVIMDELCK-NRKMDEATRLLDLMIQGGVRPDAFCEINIV 128
             Y+   + D GL  D++++   +  + + ++      R L+ M Q G       ++  +
Sbjct: 184 LVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEG------LKLQAL 237

Query: 129 AYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAHDLFLDM 188
               L+    +   LK   ++  + +    +P  V  +  +  +   +       L L +
Sbjct: 238 FTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPL 297

Query: 189 E 189
           +
Sbjct: 298 K 298


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.89
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.89
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.87
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.87
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.87
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.87
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.86
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.83
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.83
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.82
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.81
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.81
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.81
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.81
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.81
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.8
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.8
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.8
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.79
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.78
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.77
3u4t_A272 TPR repeat-containing protein; structural genomics 99.77
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.76
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.75
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.74
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.73
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.73
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.73
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.72
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.7
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.69
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.68
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.68
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.68
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.68
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.67
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.67
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.65
3u4t_A272 TPR repeat-containing protein; structural genomics 99.63
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.62
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.62
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.62
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.6
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.59
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.58
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.57
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.57
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.57
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.56
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.56
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.56
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.55
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.54
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.54
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.53
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.52
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.51
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.49
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.48
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.46
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.46
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.44
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.44
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.43
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.42
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.42
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.4
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.4
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.4
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.39
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.38
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.36
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.36
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.33
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.33
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.32
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.32
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.32
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.31
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.31
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.3
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 99.3
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.28
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.27
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.24
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.24
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.24
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.23
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.23
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.23
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.23
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.23
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.22
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.22
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.16
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.15
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.15
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.14
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.1
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.1
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.09
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.03
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.03
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.02
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.02
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.01
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.01
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.01
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.01
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.0
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.0
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.0
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.99
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.99
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.98
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.98
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.97
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.97
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.95
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.95
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.94
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.92
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.91
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.91
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.87
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.84
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.84
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.83
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.83
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.82
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.82
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.82
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.81
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.81
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.8
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.79
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.76
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.75
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.74
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.74
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.74
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.74
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.73
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.73
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.72
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.72
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.71
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.7
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.69
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.68
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.66
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.63
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.6
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.6
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.59
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.58
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.58
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.57
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.55
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.55
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.54
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.53
3k9i_A117 BH0479 protein; putative protein binding protein, 98.5
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.46
3k9i_A117 BH0479 protein; putative protein binding protein, 98.46
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.46
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.45
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.42
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.41
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.4
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.4
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.4
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.39
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.31
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.3
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.3
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.28
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.26
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.26
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.17
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.1
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.09
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.05
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.03
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.87
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.85
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.84
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.81
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.81
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.71
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.63
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.62
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.61
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.6
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.6
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.42
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.35
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.2
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.15
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.13
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.11
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.08
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.06
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.03
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.0
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.82
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.78
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.51
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.24
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.12
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.98
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.98
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.9
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 95.81
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.68
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.65
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 95.45
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 95.44
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.14
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.07
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 94.69
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.5
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 94.45
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.34
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.74
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.61
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 93.53
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 93.3
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 92.57
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 92.14
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.53
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 90.66
2uwj_G115 Type III export protein PSCG; virulence, chaperone 90.31
2p58_C116 Putative type III secretion protein YSCG; type III 90.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 89.85
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.61
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 88.28
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 88.09
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 87.68
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 87.28
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 86.95
3eiq_C358 Programmed cell death protein 4; PDCD4, anti-oncog 85.74
3hra_A201 Ankyrin repeat family protein; structural protein; 84.78
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 84.61
2zu6_B307 Programmed cell death protein 4; protein-protein c 82.77
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 81.02
2uwj_G115 Type III export protein PSCG; virulence, chaperone 80.42
2fe3_A145 Peroxide operon regulator; oxidative stress regula 80.39
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=1.3e-38  Score=254.36  Aligned_cols=212  Identities=16%  Similarity=0.182  Sum_probs=182.5

Q ss_pred             HHHHHHHHHHhhCCCCCch-HhHHHHHHHHhhcCChhHHHHHHHHHHHcCCCCchhhHHHHHHHHHHcCC---------H
Q 036731           33 DKAKELFLQMKDENINPNV-VTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSDVVTFNVIMDELCKNRK---------M  102 (259)
Q Consensus        33 ~~a~~~~~~~~~~~~~~~~-~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~---------~  102 (259)
                      ..+..+.+++.+.+..+.+ ..++.+|.+|++.|++++|+++|++|.+.|+.||..+|++||.+|++.+.         +
T Consensus         7 s~~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l   86 (501)
T 4g26_A            7 SPSENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGL   86 (501)
T ss_dssp             -----------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHH
T ss_pred             chHHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchH
Confidence            3456666777777665543 46888899999999999999999999999999999999999999987654         6


Q ss_pred             HHHHHHHHHHHhCCCCCCCccchhHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCChhhHHHHHHHHHhcCChhHHH
Q 036731          103 DEATRLLDLMIQGGVRPDAFCEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGLMPNVVTYNITIHALCNDEQMDKAH  182 (259)
Q Consensus       103 ~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~  182 (259)
                      +.|.++|++|...|+.|+      ..+|+++|.+|++.|++++|.++|++|.+.|+.||..||+.+|.+|++.|++++|.
T Consensus        87 ~~A~~lf~~M~~~G~~Pd------~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~  160 (501)
T 4g26_A           87 SRGFDIFKQMIVDKVVPN------EATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAY  160 (501)
T ss_dssp             HHHHHHHHHHHHTTCCCC------HHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHH
T ss_pred             HHHHHHHHHHHHhCCCCC------HHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHH
Confidence            889999999999999885      59999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCccchHHHHHHHHHHHHhcccCC
Q 036731          183 DLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSIIVDLLVKNEISLN  250 (259)
Q Consensus       183 ~~~~~~~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  250 (259)
                      ++|++|.+.|+.||..||+.||.+|++.|++++|.+++++|.+.+..|+..||+.++..|...+....
T Consensus       161 ~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~~a~~~  228 (501)
T 4g26_A          161 EVDAHMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSEVATKT  228 (501)
T ss_dssp             HHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSHHHHTC
T ss_pred             HHHHHHHhcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcCcchhh
Confidence            99999999999999999999999999999999999999999999999999999999999987655443



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3eiq_C Programmed cell death protein 4; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2zu6_B Programmed cell death protein 4; protein-protein complex, ATP-binding, helicase, hydrolase, initiation factor, nucleotide-binding; 2.80A {Homo sapiens} PDB: 3eij_A Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.8
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.77
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.77
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.66
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.53
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.49
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.41
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.36
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.33
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.31
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.23
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.16
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.1
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.09
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.05
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.0
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.96
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.86
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.85
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.83
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.82
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.81
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.81
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.81
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.64
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.63
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.56
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.55
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.48
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.48
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.39
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.36
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.32
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.31
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.28
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.28
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.25
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.23
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.03
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.99
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.91
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.89
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.88
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.84
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.81
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.77
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.74
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.6
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.45
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.18
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.97
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.9
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.58
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.43
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 95.12
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 94.09
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.26
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.11
d1qsaa1 450 70 KDa soluble lytic transglycosylase (SLT70), sup 85.83
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 81.05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=6.3e-17  Score=123.64  Aligned_cols=237  Identities=11%  Similarity=0.014  Sum_probs=154.5

Q ss_pred             CHHHHHHHHHHHHhcCChHHHHHHHHHHhhCCCCCchHhHHHHHHHHhhcCChhHHHHHHHHHHHcCCCCc---------
Q 036731           15 NTVTYNTIIDGLCKEGFVDKAKELFLQMKDENINPNVVTYNSLIHGFCYANDGNEAEYLFIEMMDRGLQSD---------   85 (259)
Q Consensus        15 ~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~---------   85 (259)
                      ++.++..+...+.+.|++++|...|++..+.. +-+..+|..+..++...|++++|+..+....+......         
T Consensus        32 ~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~  110 (388)
T d1w3ba_          32 NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAA  110 (388)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhcccccccccccccccccccccccccccccc
Confidence            57788888888999999999999999887763 33567888888899999999999999988887654210         


Q ss_pred             ----------------------------------------------------------hhhHHHHHHHHHHcCCHHHHHH
Q 036731           86 ----------------------------------------------------------VVTFNVIMDELCKNRKMDEATR  107 (259)
Q Consensus        86 ----------------------------------------------------------~~~~~~l~~~~~~~~~~~~a~~  107 (259)
                                                                                ...+..+...+...|++++|..
T Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~  190 (388)
T d1w3ba_         111 LVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIH  190 (388)
T ss_dssp             HHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHH
Confidence                                                                      1223333444555566666666


Q ss_pred             HHHHHHhCCCCCCCc-----------------------------cchhHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCC
Q 036731          108 LLDLMIQGGVRPDAF-----------------------------CEINIVAYGCLIDGLCKIGKLKNARELSQSLTRAGL  158 (259)
Q Consensus       108 ~~~~~~~~~~~~~~~-----------------------------~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~  158 (259)
                      .+++..+.  .|+..                             ...+...+..+...+.+.|++++|...|++..+...
T Consensus       191 ~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p  268 (388)
T d1w3ba_         191 HFEKAVTL--DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP  268 (388)
T ss_dssp             HHHHHHHH--CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCS
T ss_pred             HHHHHHHh--CcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCC
Confidence            66655543  22210                             111234445555555566666666666666555432


Q ss_pred             CCChhhHHHHHHHHHhcCChhHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCccchHHHHHH
Q 036731          159 MPNVVTYNITIHALCNDEQMDKAHDLFLDMEVKGVAPNCVIFTTLMPSFIRKNETSKVIELLRSMDKRNVMPYASILSII  238 (259)
Q Consensus       159 ~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l  238 (259)
                       -+..++..+...+...|++++|...++...... +.+...+..+...+...|++++|.+.+++..+.. +-+..++..+
T Consensus       269 -~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l  345 (388)
T d1w3ba_         269 -HFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNL  345 (388)
T ss_dssp             -SCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHH
T ss_pred             -CCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHH
Confidence             134455666666666666666666666655542 4455666677777777788888888887777653 2245667777


Q ss_pred             HHHHHHhcccCCcchhhhc
Q 036731          239 VDLLVKNEISLNSIPQFNR  257 (259)
Q Consensus       239 ~~~~~~~g~~~~a~~~~~~  257 (259)
                      ..+|.+.|++++|++.|++
T Consensus       346 a~~~~~~g~~~~A~~~~~~  364 (388)
T d1w3ba_         346 ASVLQQQGKLQEALMHYKE  364 (388)
T ss_dssp             HHHHHTTTCCHHHHHHHHH
T ss_pred             HHHHHHcCCHHHHHHHHHH
Confidence            7888888888888777764



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure