Citrus Sinensis ID: 036910
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 314 | 2.2.26 [Sep-21-2011] | |||||||
| Q8RWQ9 | 358 | Thiol protease aleurain-l | yes | no | 0.990 | 0.868 | 0.670 | 1e-138 | |
| Q8H166 | 358 | Thiol protease aleurain O | no | no | 0.910 | 0.798 | 0.712 | 1e-137 | |
| Q10717 | 360 | Cysteine proteinase 2 OS= | N/A | no | 0.968 | 0.844 | 0.634 | 1e-126 | |
| Q40143 | 356 | Cysteine proteinase 3 OS= | N/A | no | 0.961 | 0.848 | 0.633 | 1e-124 | |
| P25778 | 362 | Oryzain gamma chain OS=Or | yes | no | 0.914 | 0.792 | 0.638 | 1e-123 | |
| P05167 | 362 | Thiol protease aleurain O | N/A | no | 0.901 | 0.781 | 0.637 | 1e-119 | |
| P00786 | 333 | Pro-cathepsin H OS=Rattus | yes | no | 0.815 | 0.768 | 0.468 | 6e-74 | |
| P49935 | 333 | Pro-cathepsin H OS=Mus mu | yes | no | 0.815 | 0.768 | 0.465 | 2e-73 | |
| O46427 | 335 | Pro-cathepsin H OS=Sus sc | yes | no | 0.802 | 0.752 | 0.471 | 3e-73 | |
| P09668 | 335 | Pro-cathepsin H OS=Homo s | yes | no | 0.802 | 0.752 | 0.468 | 4e-72 |
| >sp|Q8RWQ9|ALEUL_ARATH Thiol protease aleurain-like OS=Arabidopsis thaliana GN=At3g45310 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 492 bits (1266), Expect = e-138, Method: Compositional matrix adjust.
Identities = 242/361 (67%), Positives = 277/361 (76%), Gaps = 50/361 (13%)
Query: 1 MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHAL 60
M+ + L SS++L+L AAA++ FD+SNPI++VS D L + E +V+Q++GQ+RH L
Sbjct: 1 MSVKLNLSSSILLILF--AAAASKEIGFDESNPIKMVS-DNLHELEDTVVQILGQSRHVL 57
Query: 61 SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLN------------ 108
SF+RF RYGK Y+SVEEMKLRF+ F +NLDLIRSTN KGLSY+L LN
Sbjct: 58 SFSRFTHRYGKKYQSVEEMKLRFSVFKENLDLIRSTNKKGLSYKLSLNQFADLTWQEFQR 117
Query: 109 -----------------------------------ISPVKDQGHCGSCWTFSTTGSLEAA 133
+SPVK+QGHCGSCWTFSTTG+LEAA
Sbjct: 118 YKLGAAQNCSATLKGSHKITEATVPDTKDWREDGIVSPVKEQGHCGSCWTFSTTGALEAA 177
Query: 134 YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV 193
YHQAFGKGISLSEQQLVDCA FNN GC+GGLPSQAFEYIKYNGGLDTEEAYPYTGKDG
Sbjct: 178 YHQAFGKGISLSEQQLVDCAGTFNNFGCHGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGG 237
Query: 194 CKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCG 253
CKFS++N+GVQV DSVNITLGAEDEL+HAVGLVRPVSVAFEVV FRFYK GV++S CG
Sbjct: 238 CKFSAKNIGVQVRDSVNITLGAEDELKHAVGLVRPVSVAFEVVHEFRFYKKGVFTSNTCG 297
Query: 254 NTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVV 313
NTPMDVNHAV+AVGYGVED VPYWLIKNSWG WGD+GYFKMEMGKNMCG+ATC+SYPVV
Sbjct: 298 NTPMDVNHAVLAVGYGVEDDVPYWLIKNSWGGEWGDNGYFKMEMGKNMCGVATCSSYPVV 357
Query: 314 A 314
A
Sbjct: 358 A 358
|
Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 1EC: 6 |
| >sp|Q8H166|ALEU_ARATH Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q10717|CYSP2_MAIZE Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q40143|CYSP3_SOLLC Cysteine proteinase 3 OS=Solanum lycopersicum GN=CYP-3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P25778|ORYC_ORYSJ Oryzain gamma chain OS=Oryza sativa subsp. japonica GN=Os09g0442300 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P05167|ALEU_HORVU Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P00786|CATH_RAT Pro-cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P49935|CATH_MOUSE Pro-cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O46427|CATH_PIG Pro-cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P09668|CATH_HUMAN Pro-cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 314 | ||||||
| 151547430 | 361 | cysteine protease Cp [Citrus sinensis] | 1.0 | 0.869 | 0.861 | 1e-171 | |
| 146215994 | 358 | cysteine protease Cp1 [Actinidia delicio | 0.990 | 0.868 | 0.695 | 1e-140 | |
| 312282841 | 358 | unnamed protein product [Thellungiella h | 0.974 | 0.854 | 0.690 | 1e-139 | |
| 23397070 | 358 | putative cysteine proteinase AALP [Arabi | 0.974 | 0.854 | 0.692 | 1e-138 | |
| 18141289 | 359 | senescence-associated cysteine protease | 0.990 | 0.866 | 0.681 | 1e-138 | |
| 224069140 | 358 | predicted protein [Populus trichocarpa] | 0.984 | 0.863 | 0.690 | 1e-138 | |
| 255550445 | 358 | cysteine protease, putative [Ricinus com | 0.929 | 0.815 | 0.714 | 1e-137 | |
| 18407961 | 358 | thiol protease aleurain-like protein [Ar | 0.990 | 0.868 | 0.670 | 1e-136 | |
| 18424347 | 358 | thiol protease aleurain [Arabidopsis tha | 0.910 | 0.798 | 0.712 | 1e-135 | |
| 225444726 | 362 | PREDICTED: thiol protease aleurain-like | 0.993 | 0.861 | 0.673 | 1e-135 |
| >gi|151547430|gb|ABS12459.1| cysteine protease Cp [Citrus sinensis] | Back alignment and taxonomy information |
|---|
Score = 608 bits (1567), Expect = e-171, Method: Compositional matrix adjust.
Identities = 311/361 (86%), Positives = 314/361 (86%), Gaps = 47/361 (13%)
Query: 1 MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHAL 60
MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHAL
Sbjct: 1 MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHAL 60
Query: 61 SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLN------------ 108
SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLN
Sbjct: 61 SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQR 120
Query: 109 -----------------------------------ISPVKDQGHCGSCWTFSTTGSLEAA 133
+SPVKDQGHCGSCWTFSTTGSLEAA
Sbjct: 121 HRLGAAQNCSATTKGNHKLTADVLPETKDWRESGIVSPVKDQGHCGSCWTFSTTGSLEAA 180
Query: 134 YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV 193
YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV
Sbjct: 181 YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV 240
Query: 194 CKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCG 253
CKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCG
Sbjct: 241 CKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCG 300
Query: 254 NTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVV 313
NTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFK++MGKNMCGIATCASYPVV
Sbjct: 301 NTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKIKMGKNMCGIATCASYPVV 360
Query: 314 A 314
A
Sbjct: 361 A 361
|
Source: Citrus sinensis Species: Citrus sinensis Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|146215994|gb|ABQ10199.1| cysteine protease Cp1 [Actinidia deliciosa] | Back alignment and taxonomy information |
|---|
| >gi|312282841|dbj|BAJ34286.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18141289|gb|AAL60582.1|AF454960_1 senescence-associated cysteine protease [Brassica oleracea] | Back alignment and taxonomy information |
|---|
| >gi|224069140|ref|XP_002326284.1| predicted protein [Populus trichocarpa] gi|118482340|gb|ABK93094.1| unknown [Populus trichocarpa] gi|222833477|gb|EEE71954.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255550445|ref|XP_002516273.1| cysteine protease, putative [Ricinus communis] gi|223544759|gb|EEF46275.1| cysteine protease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|18407961|ref|NP_566880.1| thiol protease aleurain-like protein [Arabidopsis thaliana] gi|73622182|sp|Q8RWQ9.1|ALEUL_ARATH RecName: Full=Thiol protease aleurain-like; Flags: Precursor gi|20147207|gb|AAM10319.1| AT3g45310/F18N11_70 [Arabidopsis thaliana] gi|332644500|gb|AEE78021.1| thiol protease aleurain-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18424347|ref|NP_568921.1| thiol protease aleurain [Arabidopsis thaliana] gi|71152227|sp|Q8H166.2|ALEU_ARATH RecName: Full=Thiol protease aleurain; Short=AtALEU; AltName: Full=Senescence-associated gene product 2; Flags: Precursor gi|7230640|gb|AAF43041.1|AF233883_1 AALP protein [Arabidopsis thaliana] gi|13430722|gb|AAK25983.1|AF360273_1 putative cysteine proteinase AALP [Arabidopsis thaliana] gi|9757740|dbj|BAB08221.1| AALP protein [Arabidopsis thaliana] gi|21617934|gb|AAM66984.1| cysteine proteinase AALP [Arabidopsis thaliana] gi|23397068|gb|AAN31819.1| putative cysteine proteinase AALP [Arabidopsis thaliana] gi|23397074|gb|AAN31822.1| putative cysteine proteinase AALP [Arabidopsis thaliana] gi|24417304|gb|AAN60262.1| unknown [Arabidopsis thaliana] gi|222423506|dbj|BAH19723.1| AT5G60360 [Arabidopsis thaliana] gi|222424411|dbj|BAH20161.1| AT5G60360 [Arabidopsis thaliana] gi|332009930|gb|AED97313.1| thiol protease aleurain [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225444726|ref|XP_002278624.1| PREDICTED: thiol protease aleurain-like isoform 1 [Vitis vinifera] gi|147826441|emb|CAN62278.1| hypothetical protein VITISV_031382 [Vitis vinifera] gi|297738562|emb|CBI27807.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 314 | ||||||
| TAIR|locus:2078312 | 358 | AT3G45310 [Arabidopsis thalian | 0.656 | 0.575 | 0.868 | 1.4e-129 | |
| TAIR|locus:2175088 | 361 | ALP "aleurain-like protease" [ | 0.621 | 0.540 | 0.866 | 8.1e-125 | |
| UNIPROTKB|F7BJD8 | 305 | CTSH "Uncharacterized protein" | 0.649 | 0.668 | 0.627 | 5.9e-74 | |
| RGD|2447 | 333 | Ctsh "cathepsin H" [Rattus nor | 0.649 | 0.612 | 0.632 | 7.6e-74 | |
| UNIPROTKB|G1M0X4 | 337 | CTSH "Uncharacterized protein" | 0.659 | 0.614 | 0.623 | 1.6e-73 | |
| UNIPROTKB|O46427 | 335 | CTSH "Pro-cathepsin H" [Sus sc | 0.649 | 0.608 | 0.617 | 2.5e-73 | |
| UNIPROTKB|F6R7P5 | 335 | CTSH "Uncharacterized protein" | 0.646 | 0.605 | 0.634 | 3.2e-73 | |
| UNIPROTKB|F7B939 | 336 | CTSH "Uncharacterized protein" | 0.646 | 0.604 | 0.639 | 3.2e-73 | |
| UNIPROTKB|F7BRD4 | 336 | CTSH "Uncharacterized protein" | 0.646 | 0.604 | 0.639 | 3.2e-73 | |
| UNIPROTKB|P09668 | 335 | CTSH "Pro-cathepsin H" [Homo s | 0.646 | 0.605 | 0.624 | 8.6e-73 |
| TAIR|locus:2078312 AT3G45310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 996 (355.7 bits), Expect = 1.4e-129, Sum P(2) = 1.4e-129
Identities = 179/206 (86%), Positives = 193/206 (93%)
Query: 109 ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQ 168
+SPVK+QGHCGSCWTFSTTG+LEAAYHQAFGKGISLSEQQLVDCA FNN GC+GGLPSQ
Sbjct: 153 VSPVKEQGHCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGTFNNFGCHGGLPSQ 212
Query: 169 AFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRP 228
AFEYIKYNGGLDTEEAYPYTGKDG CKFS++N+GVQV DSVNITLGAEDEL+HAVGLVRP
Sbjct: 213 AFEYIKYNGGLDTEEAYPYTGKDGGCKFSAKNIGVQVRDSVNITLGAEDELKHAVGLVRP 272
Query: 229 VSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWG 288
VSVAFEVV FRFYK GV++S CGNTPMDVNHAV+AVGYGVED VPYWLIKNSWG WG
Sbjct: 273 VSVAFEVVHEFRFYKKGVFTSNTCGNTPMDVNHAVLAVGYGVEDDVPYWLIKNSWGGEWG 332
Query: 289 DHGYFKMEMGKNMCGIATCASYPVVA 314
D+GYFKMEMGKNMCG+ATC+SYPVVA
Sbjct: 333 DNGYFKMEMGKNMCGVATCSSYPVVA 358
|
|
| TAIR|locus:2175088 ALP "aleurain-like protease" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F7BJD8 CTSH "Uncharacterized protein" [Equus caballus (taxid:9796)] | Back alignment and assigned GO terms |
|---|
| RGD|2447 Ctsh "cathepsin H" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G1M0X4 CTSH "Uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O46427 CTSH "Pro-cathepsin H" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6R7P5 CTSH "Uncharacterized protein" [Macaca mulatta (taxid:9544)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F7B939 CTSH "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F7BRD4 CTSH "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P09668 CTSH "Pro-cathepsin H" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8RWQ9 | ALEUL_ARATH | 3, ., 4, ., 2, 2, ., 1, 6 | 0.6703 | 0.9904 | 0.8687 | yes | no |
| Q40143 | CYSP3_SOLLC | 3, ., 4, ., 2, 2, ., - | 0.6338 | 0.9617 | 0.8483 | N/A | no |
| P25778 | ORYC_ORYSJ | 3, ., 4, ., 2, 2, ., - | 0.6388 | 0.9140 | 0.7928 | yes | no |
| Q10717 | CYSP2_MAIZE | 3, ., 4, ., 2, 2, ., - | 0.6345 | 0.9681 | 0.8444 | N/A | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.22.16 | 0.991 |
| 3rd Layer | 3.4.22 | 0.976 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 314 | |||
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 1e-109 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 1e-104 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 1e-75 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 5e-53 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 5e-51 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 3e-46 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 2e-45 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 1e-43 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 6e-42 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 3e-28 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 2e-18 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 8e-18 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 2e-14 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 2e-12 | |
| pfam08246 | 58 | pfam08246, Inhibitor_I29, Cathepsin propeptide inh | 1e-11 | |
| smart00848 | 57 | smart00848, Inhibitor_I29, Cathepsin propeptide in | 2e-09 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 1e-04 | |
| cd00585 | 437 | cd00585, Peptidase_C1B, Peptidase C1B subfamily (M | 3e-04 | |
| pfam03051 | 438 | pfam03051, Peptidase_C1_2, Peptidase C1-like famil | 0.001 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
Score = 316 bits (813), Expect = e-109
Identities = 110/207 (53%), Positives = 137/207 (66%), Gaps = 7/207 (3%)
Query: 108 NISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPS 167
++PVKDQG CGSCW FS G+LE Y GK +SLSEQQLVDC N GCNGGLP
Sbjct: 12 AVTPVKDQGQCGSCWAFSAVGALEGRYCIKTGKLVSLSEQQLVDCDT--GNNGCNGGLPD 69
Query: 168 QAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVG-VQVLDSVNITLGAEDELQHAVGLV 226
AFEYIK NGG+ TE YPYT DG CKF N ++ ++ E+ LQ A+
Sbjct: 70 NAFEYIKKNGGIVTESDYPYTAHDGTCKFKKSNSKYAKIKGYGDVPYNDEEALQAALAKN 129
Query: 227 RPVSVAFEVV-DGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGE 285
PVSVA + D F+ YKSGVY T+C ++HAV+ VGYG E+GVPYW++KNSWG
Sbjct: 130 GPVSVAIDAYEDDFQLYKSGVYKHTECSGE---LDHAVLIVGYGTENGVPYWIVKNSWGT 186
Query: 286 NWGDHGYFKMEMGKNMCGIATCASYPV 312
+WG++GYF++ G N CGIA+ ASYP+
Sbjct: 187 DWGENGYFRIARGVNECGIASEASYPI 213
|
Length = 213 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238328 cd00585, Peptidase_C1B, Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >gnl|CDD|202517 pfam03051, Peptidase_C1_2, Peptidase C1-like family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 314 | |||
| KOG1542 | 372 | consensus Cysteine proteinase Cathepsin F [Posttra | 100.0 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| KOG1543 | 325 | consensus Cysteine proteinase Cathepsin L [Posttra | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 100.0 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 100.0 | |
| KOG1544 | 470 | consensus Predicted cysteine proteinase TIN-ag [Ge | 100.0 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.95 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.94 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 99.84 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 99.26 | |
| PF08246 | 58 | Inhibitor_I29: Cathepsin propeptide inhibitor doma | 98.9 | |
| smart00848 | 57 | Inhibitor_I29 Cathepsin propeptide inhibitor domai | 98.6 | |
| KOG4128 | 457 | consensus Bleomycin hydrolases and aminopeptidases | 98.26 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 97.42 | |
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 96.35 | |
| PF09778 | 212 | Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP | 93.17 | |
| PF14399 | 317 | Transpep_BrtH: NlpC/p60-like transpeptidase | 91.01 | |
| COG4990 | 195 | Uncharacterized protein conserved in bacteria [Fun | 87.27 | |
| PF12385 | 166 | Peptidase_C70: Papain-like cysteine protease AvrRp | 82.56 | |
| PF05984 | 100 | Cytomega_UL20A: Cytomegalovirus UL20A protein; Int | 81.12 |
| >KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.8e-76 Score=526.64 Aligned_cols=249 Identities=43% Similarity=0.810 Sum_probs=230.9
Q ss_pred HHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHhhCCCCc-ccccccc-----------------------------
Q 036910 59 ALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGL-SYRLGLN----------------------------- 108 (314)
Q Consensus 59 ~~~f~~f~~~~~k~y~~~~e~~~R~~~f~~n~~~i~~~n~~~~-~y~l~~n----------------------------- 108 (314)
+.+|..|+.+|+|+|.+.+|...|+.||+.|+..+++++.... +..+|+|
T Consensus 68 ~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~~~~~~~ 147 (372)
T KOG1542|consen 68 EDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSKLPGDAA 147 (372)
T ss_pred HHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHHHHHhhccccccccCccccc
Confidence 5899999999999999999999999999999999988776544 5555555
Q ss_pred ---------------------cCccccCCCCchhHHHhhHHHHHHHHHHHcCCCcccCHHHHHhhhcCCCCCCCCCCChh
Q 036910 109 ---------------------ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPS 167 (314)
Q Consensus 109 ---------------------vtpVkdQg~cGsCwAfa~~~~lE~~~~~~~g~~~~lS~q~l~dc~~~~~~~gC~GG~~~ 167 (314)
||||||||+||||||||+|+++|+++++++|++++||||+|+||+. .+.||+||.+.
T Consensus 148 ~~~~~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~--~d~gC~GGl~~ 225 (372)
T KOG1542|consen 148 EAPIEPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDS--CDNGCNGGLMD 225 (372)
T ss_pred cCcCCCCCCCCcccchhccCCccccccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhhhcccC--cCCcCCCCChh
Confidence 9999999999999999999999999999999999999999999995 68999999999
Q ss_pred hHHHHHHHcCCcCCCCCCCCCCCCC-cccCCCCCcceEeceeEEecCCCHHHHHHHHHccCCeEEEEEecccccccCCce
Q 036910 168 QAFEYIKYNGGLDTEEAYPYTGKDG-VCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGV 246 (314)
Q Consensus 168 ~a~~~~~~~~Gi~~e~~yPY~~~~~-~c~~~~~~~~~~~~~~~~~~~~~~~~ik~~l~~~gPV~v~~~~~~~f~~y~~Gi 246 (314)
.||+|+++.+|+..|++|||+++.+ .|.++.....+.|.++..++. +|++|.++|.++|||+|+|++ ..+|+|++||
T Consensus 226 nA~~~~~~~gGL~~E~dYPY~g~~~~~C~~~~~~~~v~I~~f~~l~~-nE~~ia~wLv~~GPi~vgiNa-~~mQ~YrgGV 303 (372)
T KOG1542|consen 226 NAFKYIKKAGGLEKEKDYPYTGKKGNQCHFDKSKIVVSIKDFSMLSN-NEDQIAAWLVTFGPLSVGINA-KPMQFYRGGV 303 (372)
T ss_pred HHHHHHHHhCCccccccCCccccCCCccccchhhceEEEeccEecCC-CHHHHHHHHHhcCCeEEEEch-HHHHHhcccc
Confidence 9999988889999999999999988 999999999999999999884 899999999999999999997 4699999999
Q ss_pred Eec--CCCCCCCCCCCeEEEEEEeeecC-CcceEEEEcCCCCCcCCCcEEEEEeCCCccccCCceeeeee
Q 036910 247 YSS--TKCGNTPMDVNHAVVAVGYGVED-GVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVV 313 (314)
Q Consensus 247 ~~~--~~~~~~~~~~~Hav~iVGyg~~~-g~~ywivkNSWG~~WG~~Gy~~i~~~~~~cgi~~~~~~p~~ 313 (314)
..+ ..|+.. .++|+|||||||..+ .++|||||||||++|||+||+|+.||.|.|||+++++.+++
T Consensus 304 ~~P~~~~Cs~~--~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~WGE~GY~~l~RG~N~CGi~~mvss~~v 371 (372)
T KOG1542|consen 304 SCPSKYICSPK--LLNHAVLLVGYGSSGYEKPYWIVKNSWGTSWGEKGYYKLCRGSNACGIADMVSSAAV 371 (372)
T ss_pred cCCCcccCCcc--ccCceEEEEeecCCCCCCceEEEECCccccccccceEEEeccccccccccchhhhhc
Confidence 988 568653 489999999999988 89999999999999999999999999999999999987764
|
|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >KOG1544 consensus Predicted cysteine proteinase TIN-ag [General function prediction only] | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >KOG4128 consensus Bleomycin hydrolases and aminopeptidases of cysteine protease family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate | Back alignment and domain information |
|---|
| >PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase | Back alignment and domain information |
|---|
| >COG4990 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF12385 Peptidase_C70: Papain-like cysteine protease AvrRpt2; InterPro: IPR022118 This is a family of cysteine proteases, found in actinobacteria, protobacteria and firmicutes | Back alignment and domain information |
|---|
| >PF05984 Cytomega_UL20A: Cytomegalovirus UL20A protein; InterPro: IPR009245 This family consists of several Cytomegalovirus UL20A proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 314 | ||||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 1e-73 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 3e-53 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 4e-52 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 1e-51 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 2e-48 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 2e-48 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 3e-48 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 3e-48 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 3e-48 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 4e-48 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 4e-48 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 4e-48 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 4e-48 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 4e-48 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 4e-48 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 2e-47 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 2e-47 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 3e-47 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 3e-47 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 3e-47 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 4e-47 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 6e-47 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 1e-44 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 5e-44 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 2e-43 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 3e-43 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 4e-43 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 1e-42 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 1e-42 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 1e-42 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 1e-42 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 1e-42 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 2e-42 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 2e-42 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 2e-42 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 2e-42 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 2e-42 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 3e-42 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 4e-42 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 5e-42 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 1e-41 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 1e-41 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 2e-41 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 2e-41 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 2e-41 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 2e-41 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 1e-40 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 1e-39 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 1e-37 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 2e-35 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 3e-35 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 3e-35 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 2e-34 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 3e-34 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 4e-34 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 4e-33 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 4e-32 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 4e-32 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 5e-32 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 9e-32 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 2e-31 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 2e-31 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 2e-31 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 5e-30 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 9e-30 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 9e-30 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 1e-29 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 2e-29 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 6e-28 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 2e-27 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 2e-27 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 2e-26 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 8e-26 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 9e-26 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 2e-25 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 2e-25 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 1e-24 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 3e-24 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 3e-24 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 4e-24 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 4e-24 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 5e-24 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 2e-23 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 2e-22 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 2e-21 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 2e-21 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 3e-21 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 3e-21 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 3e-21 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 5e-21 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 6e-21 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 3e-20 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 3e-20 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 4e-20 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 4e-20 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 6e-19 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 1e-15 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 3e-15 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 6e-15 | ||
| 1k3b_B | 164 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 7e-15 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 2e-14 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 3e-13 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 4e-13 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 1e-10 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 6e-10 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 7e-10 | ||
| 1icf_B | 42 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 1e-07 |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
|
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|1ICF|B Chain B, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 42 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
Score = 386 bits (993), Expect = e-135
Identities = 104/327 (31%), Positives = 150/327 (45%), Gaps = 59/327 (18%)
Query: 43 RDFETSVLQVIGQARHAL--SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCK- 99
E S L++ + +++F + K Y S E R F N+ I N K
Sbjct: 6 HHLEGSDLEICSLPKSLFQEQWSQFKLTHKKSYSSPIEEIRRQLIFKDNVAKIAEHNAKF 65
Query: 100 ---GLSYRLGLN------------------------------------------------ 108
++Y +N
Sbjct: 66 EKGEVTYSKAMNQFGDMSKEEFLAYVNRGKAQKPKHPENLRMPYVSSKKPLAASVDWRSN 125
Query: 109 -ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPS 167
+S VKDQG CGS W+FSTTG++E G+ SLSEQ L+DC+ ++ N GC+GG
Sbjct: 126 AVSEVKDQGQCGSSWSFSTTGAVEGQLALQRGRLTSLSEQNLIDCSSSYGNAGCDGGWMD 185
Query: 168 QAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVR 227
AF YI + G+ +E AYPY + C+F S + ++ G E+ L AVG
Sbjct: 186 SAFSYIH-DYGIMSESAYPYEAQGDYCRFDSSQSVTTLSGYYDLPSGDENSLADAVGQAG 244
Query: 228 PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENW 287
PV+VA + D +FY G++ C + D+NH V+ VGYG ++G YW++KNSWG W
Sbjct: 245 PVAVAIDATDELQFYSGGLFYDQTCNQS--DLNHGVLVVGYGSDNGQDYWILKNSWGSGW 302
Query: 288 GDHGYFKMEMGK-NMCGIATCASYPVV 313
G+ GY++ N CGIAT ASYP +
Sbjct: 303 GESGYWRQVRNYGNNCGIATAASYPAL 329
|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Length = 80 | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Length = 457 | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Length = 457 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 314 | |||
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 100.0 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 100.0 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 100.0 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 98.94 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 98.82 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 97.42 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 97.29 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 97.18 | |
| 3erv_A | 236 | Putative C39-like peptidase; structural genomics, | 90.22 |
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-75 Score=541.71 Aligned_cols=252 Identities=40% Similarity=0.782 Sum_probs=232.3
Q ss_pred HHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHhhCCC----Ccccccccc--------------------------
Q 036910 59 ALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCK----GLSYRLGLN-------------------------- 108 (314)
Q Consensus 59 ~~~f~~f~~~~~k~y~~~~e~~~R~~~f~~n~~~i~~~n~~----~~~y~l~~n-------------------------- 108 (314)
..+|++|+.+|+|.|.+.+|+.+|+.||++|+++|++||++ ..+|++++|
T Consensus 24 ~~~f~~~~~~~~K~Y~~~~E~~~R~~iF~~N~~~I~~hN~~~~~g~~sy~lg~N~FaDlt~eEf~~~~g~~~~~~~~~~~ 103 (329)
T 3qt4_A 24 QEQWSQFKLTHKKSYSSPIEEIRRQLIFKDNVAKIAEHNAKFEKGEVTYSKAMNQFGDMSKEEFLAYVNRGKAQKPKHPE 103 (329)
T ss_dssp HHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSSEEECCCGGGGCCHHHHHHHHHHTCCC------
T ss_pred HHHHHHHHHHhCCcCCCHHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCeEEeccccccCCHHHHHHhcCCcccccccccc
Confidence 46899999999999999889999999999999999999862 234544433
Q ss_pred -----------------------cCccccCCCCchhHHHhhHHHHHHHHHHHcCCCcccCHHHHHhhhcCCCCCCCCCCC
Q 036910 109 -----------------------ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGL 165 (314)
Q Consensus 109 -----------------------vtpVkdQg~cGsCwAfa~~~~lE~~~~~~~g~~~~lS~q~l~dc~~~~~~~gC~GG~ 165 (314)
||||||||.||||||||++++||+++++++|++++||||+|+||+..+++.||+||+
T Consensus 104 ~~~~~~~~~~~~lP~~~DwR~~~vtpVkdQg~CGSCWAFaa~~alE~~~~i~~g~~~~LSeQ~LvdC~~~~g~~GC~GG~ 183 (329)
T 3qt4_A 104 NLRMPYVSSKKPLAASVDWRSNAVSEVKDQGQCGSSWSFSTTGAVEGQLALQRGRLTSLSEQNLIDCSSSYGNAGCDGGW 183 (329)
T ss_dssp CCEEECCCCCSCCCSCEECTTTSCCCCCBCCSSBCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGGGTCCTTBCCC
T ss_pred cccccccCCccCCCCCEEccccccCCCccCCCCcChHHHHHHHHHHHHHHHHcCCcccCCHHHHHHhccccCCCCCCCCC
Confidence 789999999999999999999999999999999999999999999766688999999
Q ss_pred hhhHHHHHHHcCCcCCCCCCCCCCCCCcccCCCCCcceEeceeEEecCCCHHHHHHHHHccCCeEEEEEecccccccCCc
Q 036910 166 PSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSG 245 (314)
Q Consensus 166 ~~~a~~~~~~~~Gi~~e~~yPY~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~ik~~l~~~gPV~v~~~~~~~f~~y~~G 245 (314)
+..|++|+.++ |+++|++|||.+.++.|+.......+++.++..++..++++||++|+.+|||+|+|++.++|++|++|
T Consensus 184 ~~~a~~yi~~~-Gi~~e~~yPY~~~~~~C~~~~~~~~~~i~~~~~v~~~~e~~lk~al~~~GPV~v~i~a~~~f~~Y~~G 262 (329)
T 3qt4_A 184 MDSAFSYIHDY-GIMSESAYPYEAQGDYCRFDSSQSVTTLSGYYDLPSGDENSLADAVGQAGPVAVAIDATDELQFYSGG 262 (329)
T ss_dssp HHHHHHHHHHS-CBCBTTTSCCCSSCCCCCCCGGGCCBCCSEEEECCTTCHHHHHHHHHHTCCEEEEECCCGGGTTEEEE
T ss_pred hhHHHHHHHHc-CCCcHHHeeeecCCCCCCCCcccceEEeceEEEecCCCHHHHHHHHHhCCCEEEEEecChhhhhccCc
Confidence 99999999998 99999999999999999988777778889999888778999999999999999999997799999999
Q ss_pred eEecCCCCCCCCCCCeEEEEEEeeecCCcceEEEEcCCCCCcCCCcEEEEEeCC-CccccCCceeeeee
Q 036910 246 VYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGK-NMCGIATCASYPVV 313 (314)
Q Consensus 246 i~~~~~~~~~~~~~~Hav~iVGyg~~~g~~ywivkNSWG~~WG~~Gy~~i~~~~-~~cgi~~~~~~p~~ 313 (314)
||..+.|... .++|||+|||||+++|++|||||||||++||++|||||+||. |.|||+++++||++
T Consensus 263 Vy~~~~c~~~--~~~HaV~iVGyg~~~g~~yWivkNSWG~~WGe~GY~~i~r~~~n~CgI~~~~~yp~v 329 (329)
T 3qt4_A 263 LFYDQTCNQS--DLNHGVLVVGYGSDNGQDYWILKNSWGSGWGESGYWRQVRNYGNNCGIATAASYPAL 329 (329)
T ss_dssp EECCSSCCSS--CCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEESSSSSGGGTTTTCEEEEC
T ss_pred eeecCCCCCC--cCCEEEEEEEEEeeCCccEEEEEeCCCCcccCCcEEEEEeCCCCccCCCCceeEeeC
Confidence 9998888642 589999999999999999999999999999999999999998 99999999999986
|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3erv_A Putative C39-like peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Bacillus anthracis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 314 | ||||
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 3e-68 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 3e-62 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 7e-62 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 3e-61 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 4e-60 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 2e-59 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 8e-57 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 1e-56 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 8e-56 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 6e-55 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 3e-54 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 3e-54 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 1e-53 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 3e-52 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 3e-51 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 1e-50 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 4e-49 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 8e-49 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 1e-46 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 1e-42 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 8e-09 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 3e-04 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 7e-08 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 0.002 |
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 314 | |||
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 99.84 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 99.8 | |
| d1pxva_ | 183 | Staphopain SspB {Staphylococcus aureus [TaxId: 128 | 95.91 | |
| d1cv8a_ | 173 | Staphopain StpA {Staphylococcus aureus [TaxId: 128 | 95.42 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=5.8e-69 Score=495.34 Aligned_cols=250 Identities=44% Similarity=0.855 Sum_probs=222.9
Q ss_pred HHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHhhCCC----Ccccccccc---------------------------
Q 036910 60 LSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCK----GLSYRLGLN--------------------------- 108 (314)
Q Consensus 60 ~~f~~f~~~~~k~y~~~~e~~~R~~~f~~n~~~i~~~n~~----~~~y~l~~n--------------------------- 108 (314)
.+|++|+++|+|.|.+ +|+.+|+.||.+|++.|++||++ ..+|++++|
T Consensus 10 ~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~~~~~~~ 88 (316)
T d1cs8a_ 10 AQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKV 88 (316)
T ss_dssp HHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCCCSCCEE
T ss_pred HHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhccccccccccCcc
Confidence 6799999999999987 46789999999999999999963 457889888
Q ss_pred --------------------cCccccCCCCchhHHHhhHHHHHHHHHHHcCCCcccCHHHHHhhhcCCCCCCCCCCChhh
Q 036910 109 --------------------ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQ 168 (314)
Q Consensus 109 --------------------vtpVkdQg~cGsCwAfa~~~~lE~~~~~~~g~~~~lS~q~l~dc~~~~~~~gC~GG~~~~ 168 (314)
|+||||||.||||||||+++++|+++++++++.+.||+|+|+||+...++.+|.||++..
T Consensus 89 ~~~~~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~~~~~~~~c~gg~~~~ 168 (316)
T d1cs8a_ 89 FQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDY 168 (316)
T ss_dssp CCCCTTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGGGTCCGGGCBCHHH
T ss_pred ccCcccccCCCceECCcCCcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhccccccCCCCCCCchHH
Confidence 999999999999999999999999999999999999999999998766788999999999
Q ss_pred HHHHHHHcCCcCCCCCCCCCCCCCcccCCCCCcceEeceeEEecCCCHHHHHHHHHccCCeEEEEEe-cccccccCCceE
Q 036910 169 AFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEV-VDGFRFYKSGVY 247 (314)
Q Consensus 169 a~~~~~~~~Gi~~e~~yPY~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~ik~~l~~~gPV~v~~~~-~~~f~~y~~Gi~ 247 (314)
|++|+..++++.+|+.|||.+....|.........++..+... ..+++.|+++|..+|||+|++++ ..+|++|++|||
T Consensus 169 a~~y~~~~g~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~l~~~l~~~gpv~v~i~~~~~~f~~y~~Gi~ 247 (316)
T d1cs8a_ 169 AFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDAGFVDI-PKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIY 247 (316)
T ss_dssp HHHHHHHHTCEEBTTTSCCCSSCCCCCCCGGGEEECCCCEEEC-CSCHHHHHHHHHHHCCEEEEECCCSHHHHTEEEEEE
T ss_pred HHHHHHhcCcccccccccccccccccccccccccccccccccc-cCcHHHHHHHHHHhCCeEEEEEeccchhccccCCcc
Confidence 9999999988899999999998888876655544444444443 45789999999999999999998 468999999999
Q ss_pred ecCCCCCCCCCCCeEEEEEEeeec----CCcceEEEEcCCCCCcCCCcEEEEEeCC-CccccCCceeeeee
Q 036910 248 SSTKCGNTPMDVNHAVVAVGYGVE----DGVPYWLIKNSWGENWGDHGYFKMEMGK-NMCGIATCASYPVV 313 (314)
Q Consensus 248 ~~~~~~~~~~~~~Hav~iVGyg~~----~g~~ywivkNSWG~~WG~~Gy~~i~~~~-~~cgi~~~~~~p~~ 313 (314)
..+.|+.. .++|||+|||||.+ ++.+|||||||||++|||+|||||+|+. |+|||++.++||+|
T Consensus 248 ~~~~c~~~--~~nHaV~iVGyG~d~~~~~g~~YWIikNSWG~~WGe~GY~ri~r~~~n~CGI~~~~~yP~v 316 (316)
T d1cs8a_ 248 FEPDCSSE--DMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV 316 (316)
T ss_dssp CCTTCCSS--CCCEEEEEEEEEEECCSSCCEEEEEEECSBCTTSTBTTEEEEECSSSSGGGTTTSCEEECC
T ss_pred cCCCCCCC--cCCEEEEEEEEcccccCCCCCeEEEEEeCCCCCcccCCEEEEeeCCCCcCccCCeeeeeeC
Confidence 98888653 57999999999964 6789999999999999999999999985 89999999999986
|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|