Citrus Sinensis ID: 036910


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA
cccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccEEEccEEEcccccHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccEEEEEEEccccccccEEEEEcccccccccccEEEEEcccccccccccccccccc
cccHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEHHHHcccccccEccccccHHHHHHHHHHHHHHHHHHcccccEcHHHHHHHHHHHcccHHHcccHHHHHHHHHHHccEEEccccccccccccccccHHHEEEcEEEEEEcccccHHHHHHHHHHcccEEEEEcccHHHHcccccEEcccccccccccccEEEEEEEEEEEccEEEEEEEccEcccccEccEEEEEccccHHHcccccEEEEcc
MARPVQLVSSVILLLCCAAAAsasassfddsnpirlvssdglrDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFsknldlirstnckglsyrlglnispvkdqghcgscwtfsttgslEAAYHQAFGKGISLSEQQLVDCAQAFnnqgcngglpsqAFEYIKynggldteeaypytgkdgvckfssenvgvqvlDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRfyksgvysstkcgntpmdvNHAVVAVGYGVEDGVPYWLiknswgenwgdhgyfkmemgknmcgiatcasypvva
MARPVQLVSSVILLLCCAAAASasassfddsnpIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATfsknldlirSTNCKGLSYRLGLNISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYsstkcgntpMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA
MARPVQLVSSVILLLCCaaaasasassFDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA
*****QLVSSVILLLCCAAAAS***********IRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV**
******L*SSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIY****E****FATFSKNLDLIRSTNCKGLSYRLGLNISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA
MARPVQLVSSVILLLCCAAA*********DSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA
***PVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEM****ATFSKNLDLIRSTNCKGLSYRLGLNISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query314 2.2.26 [Sep-21-2011]
Q8RWQ9358 Thiol protease aleurain-l yes no 0.990 0.868 0.670 1e-138
Q8H166358 Thiol protease aleurain O no no 0.910 0.798 0.712 1e-137
Q10717360 Cysteine proteinase 2 OS= N/A no 0.968 0.844 0.634 1e-126
Q40143356 Cysteine proteinase 3 OS= N/A no 0.961 0.848 0.633 1e-124
P25778362 Oryzain gamma chain OS=Or yes no 0.914 0.792 0.638 1e-123
P05167362 Thiol protease aleurain O N/A no 0.901 0.781 0.637 1e-119
P00786333 Pro-cathepsin H OS=Rattus yes no 0.815 0.768 0.468 6e-74
P49935333 Pro-cathepsin H OS=Mus mu yes no 0.815 0.768 0.465 2e-73
O46427335 Pro-cathepsin H OS=Sus sc yes no 0.802 0.752 0.471 3e-73
P09668335 Pro-cathepsin H OS=Homo s yes no 0.802 0.752 0.468 4e-72
>sp|Q8RWQ9|ALEUL_ARATH Thiol protease aleurain-like OS=Arabidopsis thaliana GN=At3g45310 PE=2 SV=1 Back     alignment and function desciption
 Score =  492 bits (1266), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 242/361 (67%), Positives = 277/361 (76%), Gaps = 50/361 (13%)

Query: 1   MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHAL 60
           M+  + L SS++L+L   AAA++    FD+SNPI++VS D L + E +V+Q++GQ+RH L
Sbjct: 1   MSVKLNLSSSILLILF--AAAASKEIGFDESNPIKMVS-DNLHELEDTVVQILGQSRHVL 57

Query: 61  SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLN------------ 108
           SF+RF  RYGK Y+SVEEMKLRF+ F +NLDLIRSTN KGLSY+L LN            
Sbjct: 58  SFSRFTHRYGKKYQSVEEMKLRFSVFKENLDLIRSTNKKGLSYKLSLNQFADLTWQEFQR 117

Query: 109 -----------------------------------ISPVKDQGHCGSCWTFSTTGSLEAA 133
                                              +SPVK+QGHCGSCWTFSTTG+LEAA
Sbjct: 118 YKLGAAQNCSATLKGSHKITEATVPDTKDWREDGIVSPVKEQGHCGSCWTFSTTGALEAA 177

Query: 134 YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV 193
           YHQAFGKGISLSEQQLVDCA  FNN GC+GGLPSQAFEYIKYNGGLDTEEAYPYTGKDG 
Sbjct: 178 YHQAFGKGISLSEQQLVDCAGTFNNFGCHGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGG 237

Query: 194 CKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCG 253
           CKFS++N+GVQV DSVNITLGAEDEL+HAVGLVRPVSVAFEVV  FRFYK GV++S  CG
Sbjct: 238 CKFSAKNIGVQVRDSVNITLGAEDELKHAVGLVRPVSVAFEVVHEFRFYKKGVFTSNTCG 297

Query: 254 NTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVV 313
           NTPMDVNHAV+AVGYGVED VPYWLIKNSWG  WGD+GYFKMEMGKNMCG+ATC+SYPVV
Sbjct: 298 NTPMDVNHAVLAVGYGVEDDVPYWLIKNSWGGEWGDNGYFKMEMGKNMCGVATCSSYPVV 357

Query: 314 A 314
           A
Sbjct: 358 A 358





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 1EC: 6
>sp|Q8H166|ALEU_ARATH Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2 Back     alignment and function description
>sp|Q10717|CYSP2_MAIZE Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=1 Back     alignment and function description
>sp|Q40143|CYSP3_SOLLC Cysteine proteinase 3 OS=Solanum lycopersicum GN=CYP-3 PE=2 SV=1 Back     alignment and function description
>sp|P25778|ORYC_ORYSJ Oryzain gamma chain OS=Oryza sativa subsp. japonica GN=Os09g0442300 PE=2 SV=2 Back     alignment and function description
>sp|P05167|ALEU_HORVU Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1 Back     alignment and function description
>sp|P00786|CATH_RAT Pro-cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1 Back     alignment and function description
>sp|P49935|CATH_MOUSE Pro-cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=2 Back     alignment and function description
>sp|O46427|CATH_PIG Pro-cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1 Back     alignment and function description
>sp|P09668|CATH_HUMAN Pro-cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
151547430361 cysteine protease Cp [Citrus sinensis] 1.0 0.869 0.861 1e-171
146215994358 cysteine protease Cp1 [Actinidia delicio 0.990 0.868 0.695 1e-140
312282841358 unnamed protein product [Thellungiella h 0.974 0.854 0.690 1e-139
23397070358 putative cysteine proteinase AALP [Arabi 0.974 0.854 0.692 1e-138
18141289359 senescence-associated cysteine protease 0.990 0.866 0.681 1e-138
224069140358 predicted protein [Populus trichocarpa] 0.984 0.863 0.690 1e-138
255550445358 cysteine protease, putative [Ricinus com 0.929 0.815 0.714 1e-137
18407961358 thiol protease aleurain-like protein [Ar 0.990 0.868 0.670 1e-136
18424347358 thiol protease aleurain [Arabidopsis tha 0.910 0.798 0.712 1e-135
225444726362 PREDICTED: thiol protease aleurain-like 0.993 0.861 0.673 1e-135
>gi|151547430|gb|ABS12459.1| cysteine protease Cp [Citrus sinensis] Back     alignment and taxonomy information
 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 311/361 (86%), Positives = 314/361 (86%), Gaps = 47/361 (13%)

Query: 1   MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHAL 60
           MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHAL
Sbjct: 1   MARPVQLVSSVILLLCCAAAASASASSFDDSNPIRLVSSDGLRDFETSVLQVIGQARHAL 60

Query: 61  SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLN------------ 108
           SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLN            
Sbjct: 61  SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQR 120

Query: 109 -----------------------------------ISPVKDQGHCGSCWTFSTTGSLEAA 133
                                              +SPVKDQGHCGSCWTFSTTGSLEAA
Sbjct: 121 HRLGAAQNCSATTKGNHKLTADVLPETKDWRESGIVSPVKDQGHCGSCWTFSTTGSLEAA 180

Query: 134 YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV 193
           YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV
Sbjct: 181 YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV 240

Query: 194 CKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCG 253
           CKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCG
Sbjct: 241 CKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCG 300

Query: 254 NTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVV 313
           NTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFK++MGKNMCGIATCASYPVV
Sbjct: 301 NTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKIKMGKNMCGIATCASYPVV 360

Query: 314 A 314
           A
Sbjct: 361 A 361




Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|146215994|gb|ABQ10199.1| cysteine protease Cp1 [Actinidia deliciosa] Back     alignment and taxonomy information
>gi|312282841|dbj|BAJ34286.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18141289|gb|AAL60582.1|AF454960_1 senescence-associated cysteine protease [Brassica oleracea] Back     alignment and taxonomy information
>gi|224069140|ref|XP_002326284.1| predicted protein [Populus trichocarpa] gi|118482340|gb|ABK93094.1| unknown [Populus trichocarpa] gi|222833477|gb|EEE71954.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255550445|ref|XP_002516273.1| cysteine protease, putative [Ricinus communis] gi|223544759|gb|EEF46275.1| cysteine protease, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|18407961|ref|NP_566880.1| thiol protease aleurain-like protein [Arabidopsis thaliana] gi|73622182|sp|Q8RWQ9.1|ALEUL_ARATH RecName: Full=Thiol protease aleurain-like; Flags: Precursor gi|20147207|gb|AAM10319.1| AT3g45310/F18N11_70 [Arabidopsis thaliana] gi|332644500|gb|AEE78021.1| thiol protease aleurain-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18424347|ref|NP_568921.1| thiol protease aleurain [Arabidopsis thaliana] gi|71152227|sp|Q8H166.2|ALEU_ARATH RecName: Full=Thiol protease aleurain; Short=AtALEU; AltName: Full=Senescence-associated gene product 2; Flags: Precursor gi|7230640|gb|AAF43041.1|AF233883_1 AALP protein [Arabidopsis thaliana] gi|13430722|gb|AAK25983.1|AF360273_1 putative cysteine proteinase AALP [Arabidopsis thaliana] gi|9757740|dbj|BAB08221.1| AALP protein [Arabidopsis thaliana] gi|21617934|gb|AAM66984.1| cysteine proteinase AALP [Arabidopsis thaliana] gi|23397068|gb|AAN31819.1| putative cysteine proteinase AALP [Arabidopsis thaliana] gi|23397074|gb|AAN31822.1| putative cysteine proteinase AALP [Arabidopsis thaliana] gi|24417304|gb|AAN60262.1| unknown [Arabidopsis thaliana] gi|222423506|dbj|BAH19723.1| AT5G60360 [Arabidopsis thaliana] gi|222424411|dbj|BAH20161.1| AT5G60360 [Arabidopsis thaliana] gi|332009930|gb|AED97313.1| thiol protease aleurain [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225444726|ref|XP_002278624.1| PREDICTED: thiol protease aleurain-like isoform 1 [Vitis vinifera] gi|147826441|emb|CAN62278.1| hypothetical protein VITISV_031382 [Vitis vinifera] gi|297738562|emb|CBI27807.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
TAIR|locus:2078312358 AT3G45310 [Arabidopsis thalian 0.656 0.575 0.868 1.4e-129
TAIR|locus:2175088361 ALP "aleurain-like protease" [ 0.621 0.540 0.866 8.1e-125
UNIPROTKB|F7BJD8305 CTSH "Uncharacterized protein" 0.649 0.668 0.627 5.9e-74
RGD|2447333 Ctsh "cathepsin H" [Rattus nor 0.649 0.612 0.632 7.6e-74
UNIPROTKB|G1M0X4337 CTSH "Uncharacterized protein" 0.659 0.614 0.623 1.6e-73
UNIPROTKB|O46427335 CTSH "Pro-cathepsin H" [Sus sc 0.649 0.608 0.617 2.5e-73
UNIPROTKB|F6R7P5335 CTSH "Uncharacterized protein" 0.646 0.605 0.634 3.2e-73
UNIPROTKB|F7B939336 CTSH "Uncharacterized protein" 0.646 0.604 0.639 3.2e-73
UNIPROTKB|F7BRD4336 CTSH "Uncharacterized protein" 0.646 0.604 0.639 3.2e-73
UNIPROTKB|P09668335 CTSH "Pro-cathepsin H" [Homo s 0.646 0.605 0.624 8.6e-73
TAIR|locus:2078312 AT3G45310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 996 (355.7 bits), Expect = 1.4e-129, Sum P(2) = 1.4e-129
 Identities = 179/206 (86%), Positives = 193/206 (93%)

Query:   109 ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQ 168
             +SPVK+QGHCGSCWTFSTTG+LEAAYHQAFGKGISLSEQQLVDCA  FNN GC+GGLPSQ
Sbjct:   153 VSPVKEQGHCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGTFNNFGCHGGLPSQ 212

Query:   169 AFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRP 228
             AFEYIKYNGGLDTEEAYPYTGKDG CKFS++N+GVQV DSVNITLGAEDEL+HAVGLVRP
Sbjct:   213 AFEYIKYNGGLDTEEAYPYTGKDGGCKFSAKNIGVQVRDSVNITLGAEDELKHAVGLVRP 272

Query:   229 VSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWG 288
             VSVAFEVV  FRFYK GV++S  CGNTPMDVNHAV+AVGYGVED VPYWLIKNSWG  WG
Sbjct:   273 VSVAFEVVHEFRFYKKGVFTSNTCGNTPMDVNHAVLAVGYGVEDDVPYWLIKNSWGGEWG 332

Query:   289 DHGYFKMEMGKNMCGIATCASYPVVA 314
             D+GYFKMEMGKNMCG+ATC+SYPVVA
Sbjct:   333 DNGYFKMEMGKNMCGVATCSSYPVVA 358


GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008234 "cysteine-type peptidase activity" evidence=IEA;ISS
TAIR|locus:2175088 ALP "aleurain-like protease" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F7BJD8 CTSH "Uncharacterized protein" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
RGD|2447 Ctsh "cathepsin H" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G1M0X4 CTSH "Uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] Back     alignment and assigned GO terms
UNIPROTKB|O46427 CTSH "Pro-cathepsin H" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6R7P5 CTSH "Uncharacterized protein" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
UNIPROTKB|F7B939 CTSH "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|F7BRD4 CTSH "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|P09668 CTSH "Pro-cathepsin H" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RWQ9ALEUL_ARATH3, ., 4, ., 2, 2, ., 1, 60.67030.99040.8687yesno
Q40143CYSP3_SOLLC3, ., 4, ., 2, 2, ., -0.63380.96170.8483N/Ano
P25778ORYC_ORYSJ3, ., 4, ., 2, 2, ., -0.63880.91400.7928yesno
Q10717CYSP2_MAIZE3, ., 4, ., 2, 2, ., -0.63450.96810.8444N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.22.160.991
3rd Layer3.4.220.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 1e-109
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 1e-104
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 1e-75
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 5e-53
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 5e-51
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 3e-46
PTZ00203348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 2e-45
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 1e-43
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 6e-42
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 3e-28
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 2e-18
COG4870372 COG4870, COG4870, Cysteine protease [Posttranslati 8e-18
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 2e-14
PTZ00462 1004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 2e-12
pfam0824658 pfam08246, Inhibitor_I29, Cathepsin propeptide inh 1e-11
smart0084857 smart00848, Inhibitor_I29, Cathepsin propeptide in 2e-09
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 1e-04
cd00585437 cd00585, Peptidase_C1B, Peptidase C1B subfamily (M 3e-04
pfam03051438 pfam03051, Peptidase_C1_2, Peptidase C1-like famil 0.001
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
 Score =  316 bits (813), Expect = e-109
 Identities = 110/207 (53%), Positives = 137/207 (66%), Gaps = 7/207 (3%)

Query: 108 NISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPS 167
            ++PVKDQG CGSCW FS  G+LE  Y    GK +SLSEQQLVDC     N GCNGGLP 
Sbjct: 12  AVTPVKDQGQCGSCWAFSAVGALEGRYCIKTGKLVSLSEQQLVDCDT--GNNGCNGGLPD 69

Query: 168 QAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVG-VQVLDSVNITLGAEDELQHAVGLV 226
            AFEYIK NGG+ TE  YPYT  DG CKF   N    ++    ++    E+ LQ A+   
Sbjct: 70  NAFEYIKKNGGIVTESDYPYTAHDGTCKFKKSNSKYAKIKGYGDVPYNDEEALQAALAKN 129

Query: 227 RPVSVAFEVV-DGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGE 285
            PVSVA +   D F+ YKSGVY  T+C      ++HAV+ VGYG E+GVPYW++KNSWG 
Sbjct: 130 GPVSVAIDAYEDDFQLYKSGVYKHTECSGE---LDHAVLIVGYGTENGVPYWIVKNSWGT 186

Query: 286 NWGDHGYFKMEMGKNMCGIATCASYPV 312
           +WG++GYF++  G N CGIA+ ASYP+
Sbjct: 187 DWGENGYFRIARGVNECGIASEASYPI 213


Length = 213

>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|238328 cd00585, Peptidase_C1B, Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>gnl|CDD|202517 pfam03051, Peptidase_C1_2, Peptidase C1-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 314
KOG1542372 consensus Cysteine proteinase Cathepsin F [Posttra 100.0
PTZ00203348 cathepsin L protease; Provisional 100.0
PTZ00021489 falcipain-2; Provisional 100.0
PTZ00200448 cysteine proteinase; Provisional 100.0
KOG1543325 consensus Cysteine proteinase Cathepsin L [Posttra 100.0
cd02621243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 100.0
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 100.0
cd02620236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 100.0
cd02698239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 100.0
PF00112219 Peptidase_C1: Papain family cysteine protease This 100.0
PTZ00049693 cathepsin C-like protein; Provisional 100.0
PTZ00364548 dipeptidyl-peptidase I precursor; Provisional 100.0
PTZ00462 1004 Serine-repeat antigen protein; Provisional 100.0
smart00645174 Pept_C1 Papain family cysteine protease. 100.0
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 100.0
KOG1544470 consensus Predicted cysteine proteinase TIN-ag [Ge 100.0
COG4870372 Cysteine protease [Posttranslational modification, 99.95
cd00585437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 99.94
PF03051438 Peptidase_C1_2: Peptidase C1-like family This fami 99.84
COG3579 444 PepC Aminopeptidase C [Amino acid transport and me 99.26
PF0824658 Inhibitor_I29: Cathepsin propeptide inhibitor doma 98.9
smart0084857 Inhibitor_I29 Cathepsin propeptide inhibitor domai 98.6
KOG4128 457 consensus Bleomycin hydrolases and aminopeptidases 98.26
PF13529144 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 97.42
PF05543175 Peptidase_C47: Staphopain peptidase C47; InterPro: 96.35
PF09778212 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP 93.17
PF14399 317 Transpep_BrtH: NlpC/p60-like transpeptidase 91.01
COG4990195 Uncharacterized protein conserved in bacteria [Fun 87.27
PF12385166 Peptidase_C70: Papain-like cysteine protease AvrRp 82.56
PF05984100 Cytomega_UL20A: Cytomegalovirus UL20A protein; Int 81.12
>KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=2.8e-76  Score=526.64  Aligned_cols=249  Identities=43%  Similarity=0.810  Sum_probs=230.9

Q ss_pred             HHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHhhCCCCc-ccccccc-----------------------------
Q 036910           59 ALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGL-SYRLGLN-----------------------------  108 (314)
Q Consensus        59 ~~~f~~f~~~~~k~y~~~~e~~~R~~~f~~n~~~i~~~n~~~~-~y~l~~n-----------------------------  108 (314)
                      +.+|..|+.+|+|+|.+.+|...|+.||+.|+..+++++.... +..+|+|                             
T Consensus        68 ~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~~~~~~~  147 (372)
T KOG1542|consen   68 EDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSKLPGDAA  147 (372)
T ss_pred             HHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHHHHHhhccccccccCccccc
Confidence            5899999999999999999999999999999999988776544 5555555                             


Q ss_pred             ---------------------cCccccCCCCchhHHHhhHHHHHHHHHHHcCCCcccCHHHHHhhhcCCCCCCCCCCChh
Q 036910          109 ---------------------ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPS  167 (314)
Q Consensus       109 ---------------------vtpVkdQg~cGsCwAfa~~~~lE~~~~~~~g~~~~lS~q~l~dc~~~~~~~gC~GG~~~  167 (314)
                                           ||||||||+||||||||+|+++|+++++++|++++||||+|+||+.  .+.||+||.+.
T Consensus       148 ~~~~~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~--~d~gC~GGl~~  225 (372)
T KOG1542|consen  148 EAPIEPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDS--CDNGCNGGLMD  225 (372)
T ss_pred             cCcCCCCCCCCcccchhccCCccccccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhhhcccC--cCCcCCCCChh
Confidence                                 9999999999999999999999999999999999999999999995  68999999999


Q ss_pred             hHHHHHHHcCCcCCCCCCCCCCCCC-cccCCCCCcceEeceeEEecCCCHHHHHHHHHccCCeEEEEEecccccccCCce
Q 036910          168 QAFEYIKYNGGLDTEEAYPYTGKDG-VCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGV  246 (314)
Q Consensus       168 ~a~~~~~~~~Gi~~e~~yPY~~~~~-~c~~~~~~~~~~~~~~~~~~~~~~~~ik~~l~~~gPV~v~~~~~~~f~~y~~Gi  246 (314)
                      .||+|+++.+|+..|++|||+++.+ .|.++.....+.|.++..++. +|++|.++|.++|||+|+|++ ..+|+|++||
T Consensus       226 nA~~~~~~~gGL~~E~dYPY~g~~~~~C~~~~~~~~v~I~~f~~l~~-nE~~ia~wLv~~GPi~vgiNa-~~mQ~YrgGV  303 (372)
T KOG1542|consen  226 NAFKYIKKAGGLEKEKDYPYTGKKGNQCHFDKSKIVVSIKDFSMLSN-NEDQIAAWLVTFGPLSVGINA-KPMQFYRGGV  303 (372)
T ss_pred             HHHHHHHHhCCccccccCCccccCCCccccchhhceEEEeccEecCC-CHHHHHHHHHhcCCeEEEEch-HHHHHhcccc
Confidence            9999988889999999999999988 999999999999999999884 899999999999999999997 4699999999


Q ss_pred             Eec--CCCCCCCCCCCeEEEEEEeeecC-CcceEEEEcCCCCCcCCCcEEEEEeCCCccccCCceeeeee
Q 036910          247 YSS--TKCGNTPMDVNHAVVAVGYGVED-GVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVV  313 (314)
Q Consensus       247 ~~~--~~~~~~~~~~~Hav~iVGyg~~~-g~~ywivkNSWG~~WG~~Gy~~i~~~~~~cgi~~~~~~p~~  313 (314)
                      ..+  ..|+..  .++|+|||||||..+ .++|||||||||++|||+||+|+.||.|.|||+++++.+++
T Consensus       304 ~~P~~~~Cs~~--~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~WGE~GY~~l~RG~N~CGi~~mvss~~v  371 (372)
T KOG1542|consen  304 SCPSKYICSPK--LLNHAVLLVGYGSSGYEKPYWIVKNSWGTSWGEKGYYKLCRGSNACGIADMVSSAAV  371 (372)
T ss_pred             cCCCcccCCcc--ccCceEEEEeecCCCCCCceEEEECCccccccccceEEEeccccccccccchhhhhc
Confidence            988  568653  489999999999988 89999999999999999999999999999999999987764



>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>KOG1544 consensus Predicted cysteine proteinase TIN-ag [General function prediction only] Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information
>PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>KOG4128 consensus Bleomycin hydrolases and aminopeptidases of cysteine protease family [Amino acid transport and metabolism] Back     alignment and domain information
>PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A Back     alignment and domain information
>PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate Back     alignment and domain information
>PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase Back     alignment and domain information
>COG4990 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12385 Peptidase_C70: Papain-like cysteine protease AvrRpt2; InterPro: IPR022118 This is a family of cysteine proteases, found in actinobacteria, protobacteria and firmicutes Back     alignment and domain information
>PF05984 Cytomega_UL20A: Cytomegalovirus UL20A protein; InterPro: IPR009245 This family consists of several Cytomegalovirus UL20A proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
8pch_A220 Crystal Structure Of Porcine Cathepsin H Determined 1e-73
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 3e-53
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 4e-52
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 1e-51
3hwn_A258 Cathepsin L With Az13010160 Length = 258 2e-48
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 2e-48
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 3e-48
3of8_A221 Structural Basis For Reversible And Irreversible In 3e-48
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 3e-48
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 4e-48
3h89_A220 A Combined Crystallographic And Molecular Dynamics 4e-48
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 4e-48
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 4e-48
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 4e-48
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 4e-48
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 2e-47
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 2e-47
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 3e-47
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 3e-47
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 3e-47
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 4e-47
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 6e-47
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 1e-44
2vhs_A217 Cathsilicatein, A Chimera Length = 217 5e-44
1cqd_A221 The 2.1 Angstrom Structure Of A Cysteine Protease W 2e-43
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 3e-43
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 4e-43
3qj3_A331 Structure Of Digestive Procathepsin L2 Proteinase F 1e-42
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 1e-42
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 1e-42
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 1e-42
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 1e-42
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 2e-42
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 2e-42
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 2e-42
2fo5_A262 Crystal Structure Of Recombinant Barley Cysteine En 2e-42
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 2e-42
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 3e-42
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 4e-42
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 5e-42
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 1e-41
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 1e-41
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 2e-41
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 2e-41
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 2e-41
3f75_A224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 2e-41
2act_A220 Crystallographic Refinement Of The Structure Of Act 1e-40
1iwd_A215 Proposed Amino Acid Sequence And The 1.63 Angstrom 1e-39
1m6d_A214 Crystal Structure Of Human Cathepsin F Length = 214 1e-37
3bcn_A209 Crystal Structure Of A Papain-Like Cysteine Proteas 2e-35
1yvb_A241 The Plasmodium Falciparum Cysteine Protease Falcipa 3e-35
2pns_A208 1.9 Angstrom Resolution Crystal Structure Of A Plan 3e-35
3pnr_A240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 2e-34
1icf_A175 Crystal Structure Of Mhc Class Ii Associated P41 Ii 3e-34
1o0e_A208 1.9 Angstrom Crystal Structure Of A Plant Cysteine 4e-34
1mhw_A175 Design Of Non-covalent Inhibitors Of Human Cathepsi 4e-33
2bdz_A214 Mexicain From Jacaratia Mexicana Length = 214 4e-32
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 4e-32
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 5e-32
3bpm_A243 Crystal Structure Of Falcipain-3 With Its Inhibitor 9e-32
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 2e-31
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 2e-31
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 2e-31
3tnx_A363 Structure Of The Precursor Of A Thermostable Varian 5e-30
1pci_A322 Procaricain Length = 322 9e-30
3u8e_A222 Crystal Structure Of Cysteine Protease From Bulbs O 9e-30
3pdf_A441 Discovery Of Novel Cyanamide-Based Inhibitors Of Ca 1e-29
1yal_A218 Carica Papaya Chymopapain At 1.7 Angstroms Resoluti 2e-29
1jqp_A438 Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric 6e-28
1ppo_A216 Determination Of The Structure Of Papaya Protease O 2e-27
1meg_A216 Crystal Structure Of A Caricain D158e Mutant In Com 2e-27
1khp_A212 Monoclinic Form Of Papain/zlfg-dam Covalent Complex 2e-26
1ppp_A212 Crystal Structure Of Papain-E64-C Complex. Binding 8e-26
1pip_A212 Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al 9e-26
2cio_A212 The High Resolution X-Ray Structure Of Papain Compl 2e-25
3ima_A212 Complex Strcuture Of Tarocystatin And Papain Length 2e-25
1stf_E212 The Refined 2.4 Angstroms X-Ray Crystal Structure O 1e-24
1gec_E216 Glycyl Endopeptidase-complex With Benzyloxycarbonyl 3e-24
1xkg_A312 Crystal Structure Of The Major House Dust Mite Alle 3e-24
3d6s_A223 Crystal Structure Of Mite Allergen Der F 1 Length = 4e-24
3rvw_A222 Crystal Structure Of Der P 1 Complexed With Fab 4c1 4e-24
3ioq_A213 Crystal Structure Of The Carica Candamarcensis Cyst 5e-24
2as8_A222 Crystal Structure Of Mature And Fully Active Der P 2e-23
3f5v_A222 C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 2e-22
1pbh_A317 Crystal Structure Of Human Recombinant Procathepsin 2e-21
1cpj_A260 Crystal Structures Of Recombinant Rat Cathepsin B A 2e-21
3ai8_B256 Cathepsin B In Complex With The Nitroxoline Length 3e-21
3k9m_A254 Cathepsin B In Complex With Stefin A Length = 254 3e-21
1gmy_A261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 3e-21
1cte_A254 Crystal Structures Of Recombinant Rat Cathepsin B A 5e-21
3cbj_A266 Chagasin-cathepsin B Complex Length = 266 6e-21
4hwy_A340 Trypanosoma Brucei Procathepsin B Solved From 40 Fs 3e-20
1mir_A322 Rat Procathepsin B Length = 322 3e-20
3hhi_A325 Crystal Structure Of Cathepsin B From T. Brucei In 4e-20
3mor_A317 Crystal Structure Of Cathepsin B From Trypanosoma B 4e-20
3qsd_A254 Structure Of Cathepsin B1 From Schistosoma Mansoni 6e-19
1huc_B205 The Refined 2.15 Angstroms X-Ray Crystal Structure 1e-15
1ito_A256 Crystal Structure Analysis Of Bovine Spleen Catheps 3e-15
1qdq_A253 X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 6e-15
1k3b_B164 Crystal Structure Of Human Dipeptidyl Peptidase I ( 7e-15
1sp4_B205 Crystal Structure Of Ns-134 In Complex With Bovine 2e-14
1deu_A277 Crystal Structure Of Human Procathepsin X: A Cystei 3e-13
1ef7_A242 Crystal Structure Of Human Cathepsin X Length = 242 4e-13
1k3b_C69 Crystal Structure Of Human Dipeptidyl Peptidase I ( 1e-10
2wbf_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 6e-10
3ch2_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 7e-10
1icf_B42 Crystal Structure Of Mhc Class Ii Associated P41 Ii 1e-07
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure

Iteration: 1

Score = 272 bits (696), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 126/204 (61%), Positives = 152/204 (74%) Query: 109 ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQ 168 +SPVK+QG CGSCWTFSTTG+LE+A A GK +SL+EQQLVDCAQ FNN GC GGLPSQ Sbjct: 14 VSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHGCQGGLPSQ 73 Query: 169 AFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRP 228 AFEYI+YN G+ E+ YPY G+D CKF + V D NIT+ E+ + AV L P Sbjct: 74 AFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNP 133 Query: 229 VSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWG 288 VS AFEV + F Y+ G+YSST C TP VNHAV+AVGYG E+G+PYW++KNSWG WG Sbjct: 134 VSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWG 193 Query: 289 DHGYFKMEMGKNMCGIATCASYPV 312 +GYF +E GKNMCG+A CASYP+ Sbjct: 194 MNGYFLIERGKNMCGLAACASYPI 217
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 Back     alignment and structure
>pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 Back     alignment and structure
>pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 Back     alignment and structure
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure
>pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 Back     alignment and structure
>pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 Back     alignment and structure
>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 Back     alignment and structure
>pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 Back     alignment and structure
>pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 Back     alignment and structure
>pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 Back     alignment and structure
>pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 Back     alignment and structure
>pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 Back     alignment and structure
>pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 Back     alignment and structure
>pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 Back     alignment and structure
>pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 Back     alignment and structure
>pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 Back     alignment and structure
>pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 Back     alignment and structure
>pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 Back     alignment and structure
>pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 Back     alignment and structure
>pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 Back     alignment and structure
>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 Back     alignment and structure
>pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 Back     alignment and structure
>pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 Back     alignment and structure
>pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 Back     alignment and structure
>pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 Back     alignment and structure
>pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 Back     alignment and structure
>pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 Back     alignment and structure
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure
>pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 Back     alignment and structure
>pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 Back     alignment and structure
>pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 Back     alignment and structure
>pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 Back     alignment and structure
>pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 Back     alignment and structure
>pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 Back     alignment and structure
>pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 Back     alignment and structure
>pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 Back     alignment and structure
>pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 Back     alignment and structure
>pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 Back     alignment and structure
>pdb|1ICF|B Chain B, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 42 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 1e-135
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 1e-135
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 1e-133
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 1e-131
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 1e-130
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 1e-127
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 1e-125
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 1e-123
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 4e-09
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 1e-123
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 1e-121
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 1e-120
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 1e-120
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 1e-118
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 1e-117
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 1e-114
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 1e-113
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 1e-113
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 1e-113
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 1e-112
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 1e-111
1cqd_A221 Protein (protease II); cysteine protease, glycopro 1e-111
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 1e-110
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 1e-110
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 1e-109
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 1e-107
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 1e-107
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 1e-106
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 1e-105
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 1e-105
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 1e-105
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 1e-102
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 1e-97
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 1e-95
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 6e-90
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 2e-89
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 3e-88
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 4e-87
3u8e_A222 Papain-like cysteine protease; papain-like cystein 7e-83
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 4e-76
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 2e-14
3pw3_A 383 Aminopeptidase C; bleomycin, cysteine proteinase f 3e-12
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 2e-07
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 1e-08
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 1e-04
2e01_A 457 Cysteine proteinase 1; bleomycin hydrolase, thiol 5e-04
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
 Score =  386 bits (993), Expect = e-135
 Identities = 104/327 (31%), Positives = 150/327 (45%), Gaps = 59/327 (18%)

Query: 43  RDFETSVLQVIGQARHAL--SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCK- 99
              E S L++    +      +++F   + K Y S  E   R   F  N+  I   N K 
Sbjct: 6   HHLEGSDLEICSLPKSLFQEQWSQFKLTHKKSYSSPIEEIRRQLIFKDNVAKIAEHNAKF 65

Query: 100 ---GLSYRLGLN------------------------------------------------ 108
               ++Y   +N                                                
Sbjct: 66  EKGEVTYSKAMNQFGDMSKEEFLAYVNRGKAQKPKHPENLRMPYVSSKKPLAASVDWRSN 125

Query: 109 -ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPS 167
            +S VKDQG CGS W+FSTTG++E       G+  SLSEQ L+DC+ ++ N GC+GG   
Sbjct: 126 AVSEVKDQGQCGSSWSFSTTGAVEGQLALQRGRLTSLSEQNLIDCSSSYGNAGCDGGWMD 185

Query: 168 QAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVR 227
            AF YI  + G+ +E AYPY  +   C+F S      +    ++  G E+ L  AVG   
Sbjct: 186 SAFSYIH-DYGIMSESAYPYEAQGDYCRFDSSQSVTTLSGYYDLPSGDENSLADAVGQAG 244

Query: 228 PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENW 287
           PV+VA +  D  +FY  G++    C  +  D+NH V+ VGYG ++G  YW++KNSWG  W
Sbjct: 245 PVAVAIDATDELQFYSGGLFYDQTCNQS--DLNHGVLVVGYGSDNGQDYWILKNSWGSGW 302

Query: 288 GDHGYFKMEMGK-NMCGIATCASYPVV 313
           G+ GY++      N CGIAT ASYP +
Sbjct: 303 GESGYWRQVRNYGNNCGIATAASYPAL 329


>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Length = 80 Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Length = 457 Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Length = 457 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 100.0
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 100.0
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 100.0
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 100.0
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 100.0
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 100.0
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 100.0
3tnx_A363 Papain; hydrolase, cytoplasm for recombinant expre 100.0
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 100.0
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 100.0
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 100.0
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 100.0
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 100.0
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 100.0
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 100.0
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 100.0
3u8e_A222 Papain-like cysteine protease; papain-like cystein 100.0
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 100.0
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 100.0
1cqd_A221 Protein (protease II); cysteine protease, glycopro 100.0
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 100.0
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 100.0
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 100.0
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 100.0
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 100.0
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 100.0
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 100.0
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 100.0
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 100.0
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 100.0
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 100.0
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 100.0
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 100.0
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 100.0
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 100.0
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 100.0
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 100.0
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 100.0
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 100.0
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 100.0
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 100.0
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 100.0
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 100.0
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 98.94
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 98.82
1pxv_A183 Cysteine protease; hydrolase; 1.80A {Staphylococcu 97.42
1x9y_A367 Cysteine proteinase; half-barrel, barrel-sandwich- 97.29
1cv8_A174 Staphopain; cysteine protease, thiol protease, pap 97.18
3erv_A236 Putative C39-like peptidase; structural genomics, 90.22
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
Probab=100.00  E-value=1.3e-75  Score=541.71  Aligned_cols=252  Identities=40%  Similarity=0.782  Sum_probs=232.3

Q ss_pred             HHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHhhCCC----Ccccccccc--------------------------
Q 036910           59 ALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCK----GLSYRLGLN--------------------------  108 (314)
Q Consensus        59 ~~~f~~f~~~~~k~y~~~~e~~~R~~~f~~n~~~i~~~n~~----~~~y~l~~n--------------------------  108 (314)
                      ..+|++|+.+|+|.|.+.+|+.+|+.||++|+++|++||++    ..+|++++|                          
T Consensus        24 ~~~f~~~~~~~~K~Y~~~~E~~~R~~iF~~N~~~I~~hN~~~~~g~~sy~lg~N~FaDlt~eEf~~~~g~~~~~~~~~~~  103 (329)
T 3qt4_A           24 QEQWSQFKLTHKKSYSSPIEEIRRQLIFKDNVAKIAEHNAKFEKGEVTYSKAMNQFGDMSKEEFLAYVNRGKAQKPKHPE  103 (329)
T ss_dssp             HHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSSEEECCCGGGGCCHHHHHHHHHHTCCC------
T ss_pred             HHHHHHHHHHhCCcCCCHHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCeEEeccccccCCHHHHHHhcCCcccccccccc
Confidence            46899999999999999889999999999999999999862    234544433                          


Q ss_pred             -----------------------cCccccCCCCchhHHHhhHHHHHHHHHHHcCCCcccCHHHHHhhhcCCCCCCCCCCC
Q 036910          109 -----------------------ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGL  165 (314)
Q Consensus       109 -----------------------vtpVkdQg~cGsCwAfa~~~~lE~~~~~~~g~~~~lS~q~l~dc~~~~~~~gC~GG~  165 (314)
                                             ||||||||.||||||||++++||+++++++|++++||||+|+||+..+++.||+||+
T Consensus       104 ~~~~~~~~~~~~lP~~~DwR~~~vtpVkdQg~CGSCWAFaa~~alE~~~~i~~g~~~~LSeQ~LvdC~~~~g~~GC~GG~  183 (329)
T 3qt4_A          104 NLRMPYVSSKKPLAASVDWRSNAVSEVKDQGQCGSSWSFSTTGAVEGQLALQRGRLTSLSEQNLIDCSSSYGNAGCDGGW  183 (329)
T ss_dssp             CCEEECCCCCSCCCSCEECTTTSCCCCCBCCSSBCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGGGTCCTTBCCC
T ss_pred             cccccccCCccCCCCCEEccccccCCCccCCCCcChHHHHHHHHHHHHHHHHcCCcccCCHHHHHHhccccCCCCCCCCC
Confidence                                   789999999999999999999999999999999999999999999766688999999


Q ss_pred             hhhHHHHHHHcCCcCCCCCCCCCCCCCcccCCCCCcceEeceeEEecCCCHHHHHHHHHccCCeEEEEEecccccccCCc
Q 036910          166 PSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSG  245 (314)
Q Consensus       166 ~~~a~~~~~~~~Gi~~e~~yPY~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~ik~~l~~~gPV~v~~~~~~~f~~y~~G  245 (314)
                      +..|++|+.++ |+++|++|||.+.++.|+.......+++.++..++..++++||++|+.+|||+|+|++.++|++|++|
T Consensus       184 ~~~a~~yi~~~-Gi~~e~~yPY~~~~~~C~~~~~~~~~~i~~~~~v~~~~e~~lk~al~~~GPV~v~i~a~~~f~~Y~~G  262 (329)
T 3qt4_A          184 MDSAFSYIHDY-GIMSESAYPYEAQGDYCRFDSSQSVTTLSGYYDLPSGDENSLADAVGQAGPVAVAIDATDELQFYSGG  262 (329)
T ss_dssp             HHHHHHHHHHS-CBCBTTTSCCCSSCCCCCCCGGGCCBCCSEEEECCTTCHHHHHHHHHHTCCEEEEECCCGGGTTEEEE
T ss_pred             hhHHHHHHHHc-CCCcHHHeeeecCCCCCCCCcccceEEeceEEEecCCCHHHHHHHHHhCCCEEEEEecChhhhhccCc
Confidence            99999999998 99999999999999999988777778889999888778999999999999999999997799999999


Q ss_pred             eEecCCCCCCCCCCCeEEEEEEeeecCCcceEEEEcCCCCCcCCCcEEEEEeCC-CccccCCceeeeee
Q 036910          246 VYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGK-NMCGIATCASYPVV  313 (314)
Q Consensus       246 i~~~~~~~~~~~~~~Hav~iVGyg~~~g~~ywivkNSWG~~WG~~Gy~~i~~~~-~~cgi~~~~~~p~~  313 (314)
                      ||..+.|...  .++|||+|||||+++|++|||||||||++||++|||||+||. |.|||+++++||++
T Consensus       263 Vy~~~~c~~~--~~~HaV~iVGyg~~~g~~yWivkNSWG~~WGe~GY~~i~r~~~n~CgI~~~~~yp~v  329 (329)
T 3qt4_A          263 LFYDQTCNQS--DLNHGVLVVGYGSDNGQDYWILKNSWGSGWGESGYWRQVRNYGNNCGIATAASYPAL  329 (329)
T ss_dssp             EECCSSCCSS--CCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEESSSSSGGGTTTTCEEEEC
T ss_pred             eeecCCCCCC--cCCEEEEEEEEEeeCCccEEEEEeCCCCcccCCcEEEEEeCCCCccCCCCceeEeeC
Confidence            9998888642  589999999999999999999999999999999999999998 99999999999986



>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A Back     alignment and structure
>1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 Back     alignment and structure
>1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 Back     alignment and structure
>3erv_A Putative C39-like peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Bacillus anthracis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 314
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 3e-68
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 3e-62
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 7e-62
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 3e-61
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 4e-60
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 2e-59
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 8e-57
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 1e-56
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 8e-56
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 6e-55
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 3e-54
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 3e-54
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 1e-53
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 3e-52
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 3e-51
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 1e-50
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 4e-49
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 8e-49
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 1e-46
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 1e-42
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 8e-09
d3gcba_ 458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 3e-04
d2cb5a_453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 7e-08
d2cb5a_ 453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 0.002
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 100.0
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 100.0
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1m6da_214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 100.0
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 100.0
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 100.0
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 100.0
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d1ppoa_216 Caricain (protease omega) {Papaya (Carica papaya) 100.0
g1k3b.1233 Cathepsin C (dipeptidyl peptidase I), catalytic do 100.0
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 100.0
d1aeca_218 Actinidin {Chinese gooseberry or kiwifruit (Actini 100.0
d1me4a_215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 100.0
d1gmya_254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 100.0
d1khqa_212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d1s4va_224 Vignain (bean endopeptidase) {Castor bean (Ricinus 100.0
d1deua_275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 100.0
d1o0ea_208 Ervatamin C {East indian rosebay (Ervatamia corona 100.0
d1iwda_215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 100.0
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 99.84
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 99.8
d1pxva_183 Staphopain SspB {Staphylococcus aureus [TaxId: 128 95.91
d1cv8a_173 Staphopain StpA {Staphylococcus aureus [TaxId: 128 95.42
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin L
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.8e-69  Score=495.34  Aligned_cols=250  Identities=44%  Similarity=0.855  Sum_probs=222.9

Q ss_pred             HHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHhhCCC----Ccccccccc---------------------------
Q 036910           60 LSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCK----GLSYRLGLN---------------------------  108 (314)
Q Consensus        60 ~~f~~f~~~~~k~y~~~~e~~~R~~~f~~n~~~i~~~n~~----~~~y~l~~n---------------------------  108 (314)
                      .+|++|+++|+|.|.+ +|+.+|+.||.+|++.|++||++    ..+|++++|                           
T Consensus        10 ~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~~~~~~~   88 (316)
T d1cs8a_          10 AQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKV   88 (316)
T ss_dssp             HHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCCCSCCEE
T ss_pred             HHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhccccccccccCcc
Confidence            6799999999999987 46789999999999999999963    457889888                           


Q ss_pred             --------------------cCccccCCCCchhHHHhhHHHHHHHHHHHcCCCcccCHHHHHhhhcCCCCCCCCCCChhh
Q 036910          109 --------------------ISPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQ  168 (314)
Q Consensus       109 --------------------vtpVkdQg~cGsCwAfa~~~~lE~~~~~~~g~~~~lS~q~l~dc~~~~~~~gC~GG~~~~  168 (314)
                                          |+||||||.||||||||+++++|+++++++++.+.||+|+|+||+...++.+|.||++..
T Consensus        89 ~~~~~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~~~~~~~~c~gg~~~~  168 (316)
T d1cs8a_          89 FQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDY  168 (316)
T ss_dssp             CCCCTTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGGGTCCGGGCBCHHH
T ss_pred             ccCcccccCCCceECCcCCcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhccccccCCCCCCCchHH
Confidence                                999999999999999999999999999999999999999999998766788999999999


Q ss_pred             HHHHHHHcCCcCCCCCCCCCCCCCcccCCCCCcceEeceeEEecCCCHHHHHHHHHccCCeEEEEEe-cccccccCCceE
Q 036910          169 AFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEV-VDGFRFYKSGVY  247 (314)
Q Consensus       169 a~~~~~~~~Gi~~e~~yPY~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~ik~~l~~~gPV~v~~~~-~~~f~~y~~Gi~  247 (314)
                      |++|+..++++.+|+.|||.+....|.........++..+... ..+++.|+++|..+|||+|++++ ..+|++|++|||
T Consensus       169 a~~y~~~~g~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~l~~~l~~~gpv~v~i~~~~~~f~~y~~Gi~  247 (316)
T d1cs8a_         169 AFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDAGFVDI-PKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIY  247 (316)
T ss_dssp             HHHHHHHHTCEEBTTTSCCCSSCCCCCCCGGGEEECCCCEEEC-CSCHHHHHHHHHHHCCEEEEECCCSHHHHTEEEEEE
T ss_pred             HHHHHHhcCcccccccccccccccccccccccccccccccccc-cCcHHHHHHHHHHhCCeEEEEEeccchhccccCCcc
Confidence            9999999988899999999998888876655544444444443 45789999999999999999998 468999999999


Q ss_pred             ecCCCCCCCCCCCeEEEEEEeeec----CCcceEEEEcCCCCCcCCCcEEEEEeCC-CccccCCceeeeee
Q 036910          248 SSTKCGNTPMDVNHAVVAVGYGVE----DGVPYWLIKNSWGENWGDHGYFKMEMGK-NMCGIATCASYPVV  313 (314)
Q Consensus       248 ~~~~~~~~~~~~~Hav~iVGyg~~----~g~~ywivkNSWG~~WG~~Gy~~i~~~~-~~cgi~~~~~~p~~  313 (314)
                      ..+.|+..  .++|||+|||||.+    ++.+|||||||||++|||+|||||+|+. |+|||++.++||+|
T Consensus       248 ~~~~c~~~--~~nHaV~iVGyG~d~~~~~g~~YWIikNSWG~~WGe~GY~ri~r~~~n~CGI~~~~~yP~v  316 (316)
T d1cs8a_         248 FEPDCSSE--DMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV  316 (316)
T ss_dssp             CCTTCCSS--CCCEEEEEEEEEEECCSSCCEEEEEEECSBCTTSTBTTEEEEECSSSSGGGTTTSCEEECC
T ss_pred             cCCCCCCC--cCCEEEEEEEEcccccCCCCCeEEEEEeCCCCCcccCCEEEEeeCCCCcCccCCeeeeeeC
Confidence            98888653  57999999999964    6789999999999999999999999985 89999999999986



>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure