Citrus Sinensis ID: 037071

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MCEKRVDDVKELDKNATEATEGFLRPTDIDEVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEFLLGAKLSNKRRRVSLFDSSLSSSSDYLWHPRITISRLRPSLVRTITAVAQRRLPTMGGSSVWEKWEKERLLEEKGVF
cHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccccEEEEEEEEcccccccHHHHHHHHHHccccEEEEEEEcccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccccccEEEcccccccccccccccccEEEcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccc
cHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccEEEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHccccccccccEEEEEEEccccccccccccccEEHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccc
MCEKRVDDVKELDKNAteategflrptdidevkveqqedgldgapysikaslccnykpglLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEFLLGAKLSNKRRRVSLfdsslssssdylwhpritisrlrpSLVRTITAVAQrrlptmggssvweKWEKERLLEEKGVF
mcekrvddvkeldknateategflrptdideVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEFLlgaklsnkrrrVSLFdsslssssdylwhpritisrlrpslVRTITAvaqrrlptmggssvwekwekerlleekgvf
MCEKRVDDVKELDKNATEATEGFLRPTDIDEVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEFLLGAKLSNKRRRVslfdsslssssdYLWHPRITISRLRPSLVRTITAVAQRRLPTMGGSSVwekwekerlleekGVF
*****************************************DGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEFLLGAKLSNK**RVSLF*******SDYLWHPRITISRLRPSLVRTITAVAQRRLPTMGGSSVWEKW************
MCEKRVDDVKEL****************IDEVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFE*TEVCQSLVSSVHQAIRS***********************************DYLWHPRITISRLRPSLVRTITAVAQRRLPTMGGSSVWEKWEKERLLEEKGV*
*********KELDKNATEATEGFLRPTDIDEVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEFLLGAKLSNKRRRVSLFDSSLSSSSDYLWHPRITISRLRPSLVRTITAVAQRRLPTMGGSSVWEKWEKERLLEEKGVF
MCEKRVDDVKELDKNATEATEGFLRPTDIDEVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDKFSATEE*LLGAKLSNKRRRVSLFDSSLSSSSDYLWHPRITISRLRPSLVRTITAVAQRRLPTMGGSSVWEKWEKERLLEE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCEKRVDDVKELDKNATEATEGFLRPTDIDEVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDKFSATEEFLLGAKLSNKRRRVSLFDSSLSSSSDYLWHPRITISRLRPSLVRTITAVAQRRLPTMGGSSVWEKWEKERLLEEKGVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
Q9S7Y1368 Transcription factor bHLH yes no 0.634 0.358 0.347 1e-10
Q9LS08344 Transcription factor AIG1 no no 0.567 0.343 0.279 2e-08
O80674253 Transcription factor bHLH no no 0.548 0.450 0.312 7e-08
Q9LET0230 Putative transcription fa no no 0.567 0.513 0.314 3e-07
Q9XEF0254 Transcription factor bHLH no no 0.562 0.460 0.300 3e-06
>sp|Q9S7Y1|BH030_ARATH Transcription factor bHLH30 OS=Arabidopsis thaliana GN=BHLH30 PE=1 SV=1 Back     alignment and function desciption
 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 81/144 (56%), Gaps = 12/144 (8%)

Query: 6   VDDVKELDKNATEATEGFLRPTDIDEVKV---EQQEDGLDGAPYSIKASLCCNYKPGLLS 62
           +  VKEL +  +  +E  L PT+ DE+ V   E++E G DG  + IKASLCC  +  LL 
Sbjct: 216 IQHVKELKRETSVISETNLVPTESDELTVAFTEEEETG-DGR-FVIKASLCCEDRSDLLP 273

Query: 63  DLRRVLEALHLSIVKAEIATLEGSMKNI-FVMASCKELNFENTEVCQSLVSSVHQAIRSV 121
           D+ + L+A+ L  +KAEI T+ G +KN+ FV            E C   + ++ +A+++V
Sbjct: 274 DMIKTLKAMRLKTLKAEITTVGGRVKNVLFVTGEESSGEEVEEEYC---IGTIEEALKAV 330

Query: 122 LDKFSATEEFLLGAKLSNKRRRVS 145
           ++K +  E    G   + KR+R+S
Sbjct: 331 MEKSNVEESSSSG---NAKRQRMS 351

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LS08|BH032_ARATH Transcription factor AIG1 OS=Arabidopsis thaliana GN=BHLH32 PE=1 SV=1 Back     alignment and function description
>sp|O80674|BH106_ARATH Transcription factor bHLH106 OS=Arabidopsis thaliana GN=BHLH106 PE=2 SV=1 Back     alignment and function description
>sp|Q9LET0|BH107_ARATH Putative transcription factor bHLH107 OS=Arabidopsis thaliana GN=BHLH107 PE=2 SV=1 Back     alignment and function description
>sp|Q9XEF0|BH051_ARATH Transcription factor bHLH51 OS=Arabidopsis thaliana GN=BHLH51 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
224145243267 predicted protein [Populus trichocarpa] 0.740 0.576 0.655 7e-48
302143406208 unnamed protein product [Vitis vinifera] 0.778 0.778 0.588 2e-45
225446577259 PREDICTED: transcription factor bHLH30 [ 0.740 0.594 0.603 3e-45
255568283265 conserved hypothetical protein [Ricinus 0.725 0.569 0.602 2e-44
388510320243 unknown [Lotus japonicus] 0.706 0.604 0.562 7e-42
356543028258 PREDICTED: transcription factor bHLH30-l 0.677 0.546 0.572 2e-40
356546966247 PREDICTED: transcription factor bHLH30-l 0.596 0.502 0.612 1e-38
224135857268 predicted protein [Populus trichocarpa] 0.682 0.529 0.591 1e-38
356542185247 PREDICTED: transcription factor bHLH30-l 0.596 0.502 0.588 2e-38
356517428259 PREDICTED: transcription factor bHLH30-l 0.596 0.478 0.612 2e-38
>gi|224145243|ref|XP_002325576.1| predicted protein [Populus trichocarpa] gi|222862451|gb|EEE99957.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  195 bits (496), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 101/154 (65%), Positives = 123/154 (79%)

Query: 6   VDDVKELDKNATEATEGFLRPTDIDEVKVEQQEDGLDGAPYSIKASLCCNYKPGLLSDLR 65
           +  +KEL + ATEA+EG L P DIDEV+VEQQEDGL  APY I+AS+CC+ KPG+LSDLR
Sbjct: 114 IAHLKELKRQATEASEGLLMPLDIDEVRVEQQEDGLLSAPYVIRASICCDCKPGILSDLR 173

Query: 66  RVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDKF 125
           + L+ALHL I+KAEIATLEG MKN+FVM+SCKE +  + +V Q L  S+HQA RS+LDKF
Sbjct: 174 QALDALHLIIMKAEIATLEGRMKNVFVMSSCKEGDSGDAKVHQFLAGSIHQAFRSILDKF 233

Query: 126 SATEEFLLGAKLSNKRRRVSLFDSSLSSSSDYLW 159
           SA++EFLL + LSNKRRRV  F  SLSSSS  LW
Sbjct: 234 SASQEFLLKSTLSNKRRRVDSFKPSLSSSSGDLW 267

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302143406|emb|CBI21967.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225446577|ref|XP_002280074.1| PREDICTED: transcription factor bHLH30 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568283|ref|XP_002525116.1| conserved hypothetical protein [Ricinus communis] gi|223535575|gb|EEF37243.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|388510320|gb|AFK43226.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356543028|ref|XP_003539965.1| PREDICTED: transcription factor bHLH30-like [Glycine max] Back     alignment and taxonomy information
>gi|356546966|ref|XP_003541890.1| PREDICTED: transcription factor bHLH30-like [Glycine max] Back     alignment and taxonomy information
>gi|224135857|ref|XP_002327321.1| predicted protein [Populus trichocarpa] gi|222835691|gb|EEE74126.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356542185|ref|XP_003539550.1| PREDICTED: transcription factor bHLH30-like [Glycine max] Back     alignment and taxonomy information
>gi|356517428|ref|XP_003527389.1| PREDICTED: transcription factor bHLH30-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
TAIR|locus:2012393368 AT1G68810 "AT1G68810" [Arabido 0.634 0.358 0.338 1.1e-13
TAIR|locus:2085964344 BHLH32 "AT3G25710" [Arabidopsi 0.423 0.255 0.325 1.7e-11
TAIR|locus:2063203253 AT2G41130 "AT2G41130" [Arabido 0.649 0.533 0.286 4.7e-11
TAIR|locus:2103560230 AT3G56770 "AT3G56770" [Arabido 0.557 0.504 0.336 5.6e-10
UNIPROTKB|Q9FTQ1267 P0665D10.21 "DNA binding prote 0.644 0.501 0.321 6.7e-10
TAIR|locus:2065086254 AT2G40200 "AT2G40200" [Arabido 0.649 0.531 0.281 1.6e-09
UNIPROTKB|Q7F7Z2258 Os01g0159800 "ESTs C26093(C116 0.634 0.511 0.288 1.7e-09
UNIPROTKB|Q6ZA99345 P0431A03.9 "Os08g0432800 prote 0.504 0.304 0.327 8.3e-09
UNIPROTKB|Q7XZF8268 OSJNBb0033J23.9 "Helix-loop-he 0.437 0.339 0.368 1.2e-08
UNIPROTKB|Q6ESL3363 OJ1294_G06.8 "DNA binding prot 0.408 0.234 0.337 2.4e-07
TAIR|locus:2012393 AT1G68810 "AT1G68810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 183 (69.5 bits), Expect = 1.1e-13, P = 1.1e-13
 Identities = 48/142 (33%), Positives = 83/142 (58%)

Query:     6 VDDVKELDKNATEATEGFLRPTDIDEVKV---EQQEDGLDGAPYSIKASLCCNYKPGLLS 62
             +  VKEL +  +  +E  L PT+ DE+ V   E++E G DG  + IKASLCC  +  LL 
Sbjct:   216 IQHVKELKRETSVISETNLVPTESDELTVAFTEEEETG-DGR-FVIKASLCCEDRSDLLP 273

Query:    63 DLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVL 122
             D+ + L+A+ L  +KAEI T+ G +KN+  +   +E + E  E  +  + ++ +A+++V+
Sbjct:   274 DMIKTLKAMRLKTLKAEITTVGGRVKNVLFVTG-EESSGEEVEE-EYCIGTIEEALKAVM 331

Query:   123 DKFSATEEFLLGAKLSNKRRRV 144
             +K +  E    G   + KR+R+
Sbjct:   332 EKSNVEESSSSG---NAKRQRM 350
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2085964 BHLH32 "AT3G25710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063203 AT2G41130 "AT2G41130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103560 AT3G56770 "AT3G56770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9FTQ1 P0665D10.21 "DNA binding protein-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2065086 AT2G40200 "AT2G40200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7F7Z2 Os01g0159800 "ESTs C26093(C11622)" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZA99 P0431A03.9 "Os08g0432800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XZF8 OSJNBb0033J23.9 "Helix-loop-helix DNA-binding domain containing protein, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ESL3 OJ1294_G06.8 "DNA binding protein-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00190809
hypothetical protein (268 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 6e-05
cd0489970 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain 6e-05
cd0492672 cd04926, ACT_ACR_4, C-terminal ACT domain, of a no 1e-04
COG2844867 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran 8e-04
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information 
 Score = 39.5 bits (93), Expect = 6e-05
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 51 SLCCNYKPGLLSDLRRVLEALHLSIVKAEIATL 83
           +    +PGLL+D+ RVL  L L+I  A I+T 
Sbjct: 4  EVYAPDRPGLLADITRVLADLGLNIHDARISTT 36

This ACT domain family, ACT_UUR_ACR-like, includes the two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the four ACT domains of a novel protein composed almost entirely of ACT domain repeats (the ACR protein) and like proteins. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. This CD also includes the first of the two ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein and related domains, as well as, the N-terminal ACT domain of a yet characterized Arabidopsis/Oryza predicted tyrosine kinase. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 70
>gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.81
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 99.79
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.76
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 99.61
PRK05007884 PII uridylyl-transferase; Provisional 99.6
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 99.57
PRK01759854 glnD PII uridylyl-transferase; Provisional 99.56
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 99.54
PRK00275895 glnD PII uridylyl-transferase; Provisional 99.44
PRK04374869 PII uridylyl-transferase; Provisional 99.42
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 99.4
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.33
PRK05092931 PII uridylyl-transferase; Provisional 99.3
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 99.28
PRK03381774 PII uridylyl-transferase; Provisional 99.23
PRK03059856 PII uridylyl-transferase; Provisional 99.21
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 99.2
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.13
PRK01759854 glnD PII uridylyl-transferase; Provisional 99.07
PRK05007884 PII uridylyl-transferase; Provisional 99.05
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 98.97
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 98.92
PRK05092931 PII uridylyl-transferase; Provisional 98.87
PRK00275895 glnD PII uridylyl-transferase; Provisional 98.72
PRK03381774 PII uridylyl-transferase; Provisional 98.61
PRK03059856 PII uridylyl-transferase; Provisional 98.61
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.37
PRK04374869 PII uridylyl-transferase; Provisional 98.34
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 98.14
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 97.97
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.83
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 97.81
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 97.71
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.7
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 97.69
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 97.63
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 97.62
PRK0019490 hypothetical protein; Validated 97.47
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 97.14
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 97.08
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 96.98
PRK00227693 glnD PII uridylyl-transferase; Provisional 96.97
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 96.96
PRK00227693 glnD PII uridylyl-transferase; Provisional 96.95
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 96.94
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 96.86
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 96.72
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.64
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 96.64
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 96.6
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 96.57
PRK11589190 gcvR glycine cleavage system transcriptional repre 96.52
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 96.51
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 96.26
PRK08577136 hypothetical protein; Provisional 96.14
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 96.12
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 96.11
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 96.07
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 96.01
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 95.85
cd0211660 ACT ACT domains are commonly involved in specifica 95.63
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 95.4
cd0489877 ACT_ACR-like_4 ACT domain-containing protein which 95.33
PRK07334403 threonine dehydratase; Provisional 95.13
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 94.48
PRK11589190 gcvR glycine cleavage system transcriptional repre 94.46
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 94.35
PRK04435147 hypothetical protein; Provisional 94.12
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 93.53
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 93.11
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 93.0
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 92.62
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 92.59
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 92.43
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 92.21
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 91.73
CHL00100174 ilvH acetohydroxyacid synthase small subunit 91.56
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 91.41
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 90.58
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 90.4
COG383090 ACT domain-containing protein [Signal transduction 89.89
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 89.55
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 86.94
COG2716176 GcvR Glycine cleavage system regulatory protein [A 85.87
COG2716176 GcvR Glycine cleavage system regulatory protein [A 85.47
PRK06349426 homoserine dehydrogenase; Provisional 84.42
TIGR02258179 2_5_ligase 2'-5' RNA ligase. This protein family c 82.65
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 82.54
PRK06382406 threonine dehydratase; Provisional 82.46
PRK11899279 prephenate dehydratase; Provisional 81.95
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 81.77
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 80.66
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information 
Probab=99.81  E-value=2.2e-19  Score=132.93  Aligned_cols=71  Identities=14%  Similarity=0.247  Sum_probs=65.7

Q ss_pred             EEEecCCCCCchHHHHHHHHhcCCeeEeeEEeecCCeeEEEEEEeeccCcCccChHHHHHHHHHHHHHHHHHHhh
Q 037071           50 ASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDK  124 (208)
Q Consensus        50 asVcCdDRPGLLSDLtRALreL~L~ivRAEIaTlGGRaknVFyVtd~~gg~~~D~~~~~~~~~sVrqAL~~vLe~  124 (208)
                      ++|.|.||||||+||+++|.++++.|..|.|+|.|+||.|+|||+|..|.+..|++    ..+.|+++|.++|++
T Consensus         4 veV~~~DRpGLL~~i~~~l~~~~l~I~~A~I~T~gera~D~FyV~d~~g~kl~~~~----~~~~l~~~L~~al~~   74 (75)
T cd04897           4 VTVQCRDRPKLLFDVVCTLTDMDYVVFHATIDTDGDDAHQEYYIRHKDGRTLSTEG----ERQRVIKCLEAAIER   74 (75)
T ss_pred             EEEEeCCcCcHHHHHHHHHHhCCeEEEEEEEeecCceEEEEEEEEcCCCCccCCHH----HHHHHHHHHHHHHhc
Confidence            34999999999999999999999999999999999999999999999998888885    478899999998876

This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02258 2_5_ligase 2'-5' RNA ligase Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 42.1 bits (98), Expect = 7e-05
 Identities = 22/153 (14%), Positives = 49/153 (32%), Gaps = 31/153 (20%)

Query: 65  RRVLEALHLSIVK-AEIATLEGSMKNIFVMASCKELNFENTEVCQSLV----------SS 113
           + +L     + V   +   ++   K+I        +      V  +L             
Sbjct: 19  KDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEM 78

Query: 114 VHQAIRSVLDKFSATEEFLLGAKLSNKRRRVSLFDSSLSSSSDYLWH-----PRITISRL 168
           V + +  VL       +FL+ + +  ++R+ S+         D L++      +  +SRL
Sbjct: 79  VQKFVEEVLRI---NYKFLM-SPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRL 134

Query: 169 RPSLVRTITAVAQRRLPT-------MGGS--SV 192
           +P     +        P        + GS  + 
Sbjct: 135 QP--YLKLRQALLELRPAKNVLIDGVLGSGKTW 165
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
2nyi_A195 Unknown protein; protein structure initiative, PSI 98.38
1u8s_A192 Glycine cleavage system transcriptional repressor, 98.29
1u8s_A192 Glycine cleavage system transcriptional repressor, 98.04
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.91
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.79
2nyi_A195 Unknown protein; protein structure initiative, PSI 97.78
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 97.25
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 97.09
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 96.97
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 96.85
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 96.83
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 96.83
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 96.76
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 95.79
2pc6_A165 Probable acetolactate synthase isozyme III (small; 95.38
1y7p_A223 Hypothetical protein AF1403; structural genomics, 93.9
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 92.29
2f06_A144 Conserved hypothetical protein; structural genomic 89.07
2f06_A144 Conserved hypothetical protein; structural genomic 80.82
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
Probab=98.38  E-value=7.7e-07  Score=73.18  Aligned_cols=72  Identities=21%  Similarity=0.171  Sum_probs=59.1

Q ss_pred             EEEEEEecCCCCCchHHHHHHHHhcCCeeEeeEEeecC--CeeEEEEEEeeccCcCccChHHHHHHHHHHHHHHHHHHhh
Q 037071           47 SIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLE--GSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSVLDK  124 (208)
Q Consensus        47 ~irasVcCdDRPGLLSDLtRALreL~L~ivRAEIaTlG--GRaknVFyVtd~~gg~~~D~~~~~~~~~sVrqAL~~vLe~  124 (208)
                      ...++|.|.|||||++.|+++|.++|+.|..+.+.|.+  ++..++||++...+..  +.    .. +.|+++|..+.++
T Consensus        93 ~~iltv~g~DrpGiva~Vt~~La~~g~nI~~~~~~t~~~~~~~~~~F~m~~~~~~~--~~----~~-~~l~~~l~~~a~~  165 (195)
T 2nyi_A           93 EYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGFTLFRMGSRVAFP--FP----LY-QEVVTALSRVEEE  165 (195)
T ss_dssp             EEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEEECSSTTCEEEEEEEEEEEE--GG----GH-HHHHHHHHHHHHH
T ss_pred             EEEEEEEeCCCcCHHHHHHHHHHHcCCCEEEceeeecccccCCCCeEEEEEEEEcC--CC----cc-HHHHHHHHHHHHH
Confidence            34567999999999999999999999999999999999  8889999998866422  12    13 6788888877655


Q ss_pred             c
Q 037071          125 F  125 (208)
Q Consensus       125 ~  125 (208)
                      .
T Consensus       166 l  166 (195)
T 2nyi_A          166 F  166 (195)
T ss_dssp             H
T ss_pred             c
Confidence            3
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 98.2
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 97.96
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.95
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 96.95
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 96.36
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 96.03
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 95.55
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 94.33
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 90.56
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 90.02
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: Glycine cleavage system transcriptional repressor
domain: putative transcriptional repressor VC2159
species: Vibrio cholerae [TaxId: 666]

Probab=98.20  E-value=3.7e-06  Score=59.57  Aligned_cols=63  Identities=11%  Similarity=0.290  Sum_probs=51.3

Q ss_pred             EEEEEecCCCCCchHHHHHHHHhcCCeeEeeEEeecCCeeEEEEEEeeccCcCccChHHHHHHHHHHHHHHHHH
Q 037071           48 IKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFENTEVCQSLVSSVHQAIRSV  121 (208)
Q Consensus        48 irasVcCdDRPGLLSDLtRALreL~L~ivRAEIaTlGGRaknVFyVtd~~gg~~~D~~~~~~~~~sVrqAL~~v  121 (208)
                      +-+++.|.||||++++|+++|.+.|..|..+.++++|++..-.+.|....     +      .++.++.+|..+
T Consensus         6 ~vitv~G~DrpGiva~vt~~l~~~g~NI~d~~~~~~~~~~~~~~~v~~~~-----~------~~~~l~~~L~~l   68 (86)
T d1u8sa1           6 LVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGSP-----S------NITRVETTLPLL   68 (86)
T ss_dssp             EEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEECH-----H------HHHHHHHHHHHH
T ss_pred             EEEEEEeCCCChHHHHHHHHHHHCCCeEEEeEeEEECCeeEEEEEEEcCc-----c------cHHHHHHHHHHH
Confidence            45679999999999999999999999999999999999988777775421     1      245666666665
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure