Citrus Sinensis ID: 037256


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680
MRRLGPSTEGFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHNDKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGALLLACRIHGEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLKKPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW
cccccccccccHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHccccccHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHccccHHHHHHHHHccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccc
cccccccccccHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEccccccHHHHHHHHHHHHHcccHHHccccccccHEHccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEccccccccccccEcccccc
mrrlgpstegFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYttygepntarSLFNsihndksySFLWNTMIRAYANNGHCVETLELYSTMRrsgissnsytfPFVLKACasnslilegkvvhgdiirtgflsDSYVQAALVDMYakcgqtddgckvfdemsVRDLVSWTVMITAYEQAEKPEEALILFQKTqqegllsdsVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFdemqnsdckpnpVTALILVSACTYlgsrqlgrkfhgYIINSNMKIDATLRNAVMDMYAKcgdldtaenmfndihpsernvsSWNVLIAGygmhghgrKALEFFSQMLeegvkpdhitFTSILSACSHAGLIDEGRKCFADmtklsvkpevkHYACMVDMLGRAGCLYEAFDmikqmplppndsVWGALLLACRIHGEIAANylfqlepehtgyFVLMSNIYAASNKWREVGKLREDmknkglkkpaafSVIEygkdiqgfhtadrvnpYWKEVYKKVESMAVEIKMAgympdlscalhdvededrEHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIivrdanrfhhfeggtcscndyw
mrrlgpsteGFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHNDKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGALLLACRIHGEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLKKPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDAnrfhhfeggtcscndyw
MRRLGPSTEGFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHNDKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGALLLACRIHGEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLKKPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW
*********GFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHNDKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGALLLACRIHGEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDM*NKGLKKPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCND**
****GPSTEGFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHNDKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGALLLACRIHGEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLKKPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW
MRRLGPSTEGFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHNDKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGALLLACRIHGEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLKKPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW
*****PSTEGFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHNDKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGALLLACRIHGEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLKKPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRLGPSTEGFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHNDKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGALLLACRIHGEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLKKPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query680 2.2.26 [Sep-21-2011]
O81767823 Pentatricopeptide repeat- yes no 0.970 0.801 0.416 1e-158
Q9LTV8694 Pentatricopeptide repeat- no no 0.982 0.962 0.380 1e-147
Q9LN01741 Pentatricopeptide repeat- no no 0.972 0.892 0.391 1e-143
Q7Y211890 Pentatricopeptide repeat- no no 0.954 0.729 0.380 1e-142
Q3E6Q1809 Pentatricopeptide repeat- no no 0.972 0.817 0.391 1e-142
O82380738 Pentatricopeptide repeat- no no 0.972 0.895 0.377 1e-141
Q9LW32659 Pentatricopeptide repeat- no no 0.938 0.968 0.382 1e-139
P0C899686 Putative pentatricopeptid no no 0.925 0.916 0.387 1e-138
Q9SUH6792 Pentatricopeptide repeat- no no 0.951 0.816 0.377 1e-137
Q9SN39871 Pentatricopeptide repeat- no no 0.963 0.752 0.380 1e-135
>sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana GN=EMB2758 PE=3 SV=2 Back     alignment and function desciption
 Score =  557 bits (1436), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 282/677 (41%), Positives = 423/677 (62%), Gaps = 17/677 (2%)

Query: 12  YDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHND 71
           +  +LK+C  +    +IH      G +   +++ A +I  Y+ Y     AR LF+ +   
Sbjct: 156 FPSVLKACRTVIDGNKIHCLALKFGFM-WDVYVAASLIHLYSRYKAVGNARILFDEMPVR 214

Query: 72  KSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKV 131
              S  WN MI  Y  +G+  E L L + +R    + +S T   +L AC        G  
Sbjct: 215 DMGS--WNAMISGYCQSGNAKEALTLSNGLR----AMDSVTVVSLLSACTEAGDFNRGVT 268

Query: 132 VHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEK 191
           +H   I+ G  S+ +V   L+D+YA+ G+  D  KVFD M VRDL+SW  +I AYE  E+
Sbjct: 269 IHSYSIKHGLESELFVSNKLIDLYAEFGRLRDCQKVFDRMYVRDLISWNSIIKAYELNEQ 328

Query: 192 PEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNA-FLEDLCIQN 250
           P  A+ LFQ+ +   +  D +T++S+AS + QLGD+   ++V G+ +    FLED+ I N
Sbjct: 329 PLRAISLFQEMRLSRIQPDCLTLISLASILSQLGDIRACRSVQGFTLRKGWFLEDITIGN 388

Query: 251 SIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQN-SDCK 309
           ++V MYA+ G V+ AR VF+ +   D+ISWN++++GY QNG ASEA+ +++ M+   +  
Sbjct: 389 AVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIMEEEGEIA 448

Query: 310 PNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENM 369
            N  T + ++ AC+  G+ + G K HG ++ + + +D  +  ++ DMY KCG L+ A ++
Sbjct: 449 ANQGTWVSVLPACSQAGALRQGMKLHGRLLKNGLYLDVFVVTSLADMYGKCGRLEDALSL 508

Query: 370 FNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAG 429
           F  I     N   WN LIA +G HGHG KA+  F +ML+EGVKPDHITF ++LSACSH+G
Sbjct: 509 FYQI--PRVNSVPWNTLIACHGFHGHGEKAVMLFKEMLDEGVKPDHITFVTLLSACSHSG 566

Query: 430 LIDEGRKCFADM-TKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGAL 488
           L+DEG+ CF  M T   + P +KHY CMVDM GRAG L  A   IK M L P+ S+WGAL
Sbjct: 567 LVDEGQWCFEMMQTDYGITPSLKHYGCMVDMYGRAGQLETALKFIKSMSLQPDASIWGAL 626

Query: 489 LLACRIHG-----EIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLK 543
           L ACR+HG     +IA+ +LF++EPEH GY VL+SN+YA++ KW  V ++R     KGL+
Sbjct: 627 LSACRVHGNVDLGKIASEHLFEVEPEHVGYHVLLSNMYASAGKWEGVDEIRSIAHGKGLR 686

Query: 544 KPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDE 603
           K   +S +E    ++ F+T ++ +P ++E+Y+++ ++  ++KM GY+PD    L DVED+
Sbjct: 687 KTPGWSSMEVDNKVEVFYTGNQTHPMYEEMYRELTALQAKLKMIGYVPDHRFVLQDVEDD 746

Query: 604 DREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDA 663
           ++EH+L  HSE+LA+AF ++    +  +++ KNLRVC DCHS  +FIS I  R+IIVRD+
Sbjct: 747 EKEHILMSHSERLAIAFALIATPAKTTIRIFKNLRVCGDCHSVTKFISKITEREIIVRDS 806

Query: 664 NRFHHFEGGTCSCNDYW 680
           NRFHHF+ G CSC DYW
Sbjct: 807 NRFHHFKNGVCSCGDYW 823





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein At3g57430, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H81 PE=2 SV=2 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protein At3g26782, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H34 PE=2 SV=1 Back     alignment and function description
>sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containing protein At3g49142 OS=Arabidopsis thaliana GN=PCMP-H77 PE=3 SV=1 Back     alignment and function description
>sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protein At4g30700 OS=Arabidopsis thaliana GN=DYW9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query680
225448223707 PREDICTED: pentatricopeptide repeat-cont 0.992 0.954 0.654 0.0
297739586676 unnamed protein product [Vitis vinifera] 0.947 0.952 0.625 0.0
224119910533 predicted protein [Populus trichocarpa] 0.775 0.988 0.741 0.0
255539985543 pentatricopeptide repeat-containing prot 0.630 0.790 0.682 1e-173
148909481 795 unknown [Picea sitchensis] 0.992 0.849 0.420 1e-163
359475368 891 PREDICTED: pentatricopeptide repeat-cont 0.973 0.742 0.423 1e-160
147795292 891 hypothetical protein VITISV_001772 [Viti 0.973 0.742 0.420 1e-159
359488559735 PREDICTED: pentatricopeptide repeat-cont 0.951 0.880 0.425 1e-159
359475558 848 PREDICTED: pentatricopeptide repeat-cont 0.976 0.783 0.420 1e-158
225423499738 PREDICTED: pentatricopeptide repeat-cont 0.973 0.897 0.395 1e-158
>gi|225448223|ref|XP_002266190.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/686 (65%), Positives = 551/686 (80%), Gaps = 11/686 (1%)

Query: 6   PSTEGFYDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLF 65
           PS   FYD LL+ C  L +L+ IHSSL+T G +    H  A++II Y+  G+ ++AR+LF
Sbjct: 22  PSLHHFYDHLLQCCTSLTTLKLIHSSLSTRGFLLHTPHFLARLIILYSKLGDLHSARTLF 81

Query: 66  NSIH------NDKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKA 119
           +  H           SFL NTM+RAYAN G   E ++LY  M+R G+  N++T+PFVLK 
Sbjct: 82  DHRHHHHHGHTQAPNSFLCNTMLRAYANAGRSYEAIDLYIYMQRMGVGVNNFTYPFVLKV 141

Query: 120 CASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSW 179
           CAS    + G+VVHG ++RTGF SD +V+AALVDMYAKCG+  D  +VFD M +RD+V W
Sbjct: 142 CASELGAVFGEVVHGQVVRTGFGSDLFVEAALVDMYAKCGEIGDAHEVFDRMLIRDVVCW 201

Query: 180 TVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAIC 239
           T MIT YEQAE+P +AL+LF+K Q+EG L D +T +SVASAVGQLGD   A +VHGYA+ 
Sbjct: 202 TAMITLYEQAERPLKALMLFRKMQEEGFLGDEITAISVASAVGQLGDGRMAISVHGYAVL 261

Query: 240 NAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLL 299
           N F+ D+ + NSIV MYA+CGNVE+ARLVFD ME+R+ ISWNSML+GY QNG+ ++AL L
Sbjct: 262 NGFIGDVSVGNSIVGMYAKCGNVERARLVFDRMEERNGISWNSMLSGYTQNGRPTDALSL 321

Query: 300 FDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAK 359
           F++MQ S+C PNPVTALI+VSAC+YLGS+ LGRK H ++I+S M ID TLRNA+MDMY K
Sbjct: 322 FNQMQASECDPNPVTALIMVSACSYLGSKHLGRKLHNFVISSKMDIDTTLRNAIMDMYMK 381

Query: 360 CGDLDTAENMFNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFT 419
           CGDLDTA  MFN+    ER+VSSWNVLI+GYG+HGHG++ALE FS+M  EGV+P+ ITFT
Sbjct: 382 CGDLDTAVEMFNNCELGERDVSSWNVLISGYGVHGHGKEALELFSRMQVEGVEPNDITFT 441

Query: 420 SILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLP 479
           SILSACSHAGLIDEGRKCFADMTKLSV+PE+KHYACMVDMLGRAG L EAF +IK++P  
Sbjct: 442 SILSACSHAGLIDEGRKCFADMTKLSVRPEMKHYACMVDMLGRAGFLNEAFRLIKKIPSR 501

Query: 480 PNDSVWGALLLACRIH-----GEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLR 534
           P+D VWGALLLACRIH     GEIAAN LFQLEPEHTGY+VLMSNIYAASNKW+EV  +R
Sbjct: 502 PSDEVWGALLLACRIHGNTELGEIAANNLFQLEPEHTGYYVLMSNIYAASNKWKEVEMVR 561

Query: 535 EDMKNKGLKKPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLS 594
           ++MK++GLKKPAAFSVIE+G ++ GFHTAD+ +PY++EVY+KVES+A+E+KM GY+PDLS
Sbjct: 562 QNMKSRGLKKPAAFSVIEFGTEVHGFHTADQSSPYYREVYRKVESLAIEMKMVGYVPDLS 621

Query: 595 CALHDVEDEDREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIY 654
           C LHDVE ED+EH+LNYHSEKLAVAFGIM +     +QVTKNLRVC+DCH AF+FIS IY
Sbjct: 622 CVLHDVEPEDKEHLLNYHSEKLAVAFGIMKMDQGMPIQVTKNLRVCSDCHWAFKFISSIY 681

Query: 655 RRKIIVRDANRFHHFEGGTCSCNDYW 680
            RKIIVRD NRFHHF+GG CSC DYW
Sbjct: 682 GRKIIVRDGNRFHHFQGGRCSCGDYW 707




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297739586|emb|CBI29768.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224119910|ref|XP_002318193.1| predicted protein [Populus trichocarpa] gi|222858866|gb|EEE96413.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255539985|ref|XP_002511057.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550172|gb|EEF51659.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|148909481|gb|ABR17838.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|359475368|ref|XP_003631669.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147795292|emb|CAN64990.1| hypothetical protein VITISV_001772 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488559|ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475558|ref|XP_003631701.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225423499|ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query680
TAIR|locus:2118964823 EMB2758 "embryo defective 2758 0.970 0.801 0.418 2.8e-146
TAIR|locus:2202074809 CRR22 "CHLORORESPIRATORY REDUC 0.972 0.817 0.391 5.6e-132
TAIR|locus:4010713776659 AT3G26782 [Arabidopsis thalian 0.938 0.968 0.382 5.9e-128
TAIR|locus:2131939792 MEF29 "AT4G30700" [Arabidopsis 0.951 0.816 0.380 8.7e-127
TAIR|locus:2124137871 DOT4 "DEFECTIVELY ORGANIZED TR 0.969 0.756 0.379 1.5e-124
TAIR|locus:21194401064 AT4G13650 [Arabidopsis thalian 0.955 0.610 0.367 7.2e-123
TAIR|locus:2178188995 MEF7 "AT5G09950" [Arabidopsis 0.955 0.653 0.378 7.4e-121
TAIR|locus:2032840937 AT1G16480 "AT1G16480" [Arabido 0.951 0.690 0.360 3.2e-120
TAIR|locus:2125899990 AT4G33170 [Arabidopsis thalian 0.958 0.658 0.368 8.8e-118
TAIR|locus:2205200741 OTP82 "AT1G08070" [Arabidopsis 0.873 0.801 0.382 3e-117
TAIR|locus:2118964 EMB2758 "embryo defective 2758" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1429 (508.1 bits), Expect = 2.8e-146, P = 2.8e-146
 Identities = 283/677 (41%), Positives = 425/677 (62%)

Query:    12 YDQLLKSCNFLASLRQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHND 71
             +  +LK+C  +    +IH      G +   +++ A +I  Y+ Y     AR LF+ +   
Sbjct:   156 FPSVLKACRTVIDGNKIHCLALKFGFMWD-VYVAASLIHLYSRYKAVGNARILFDEMPVR 214

Query:    72 KSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKV 131
                S  WN MI  Y  +G+  E L L + +R    + +S T   +L AC        G  
Sbjct:   215 DMGS--WNAMISGYCQSGNAKEALTLSNGLR----AMDSVTVVSLLSACTEAGDFNRGVT 268

Query:   132 VHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEK 191
             +H   I+ G  S+ +V   L+D+YA+ G+  D  KVFD M VRDL+SW  +I AYE  E+
Sbjct:   269 IHSYSIKHGLESELFVSNKLIDLYAEFGRLRDCQKVFDRMYVRDLISWNSIIKAYELNEQ 328

Query:   192 PEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNA-FLEDLCIQN 250
             P  A+ LFQ+ +   +  D +T++S+AS + QLGD+   ++V G+ +    FLED+ I N
Sbjct:   329 PLRAISLFQEMRLSRIQPDCLTLISLASILSQLGDIRACRSVQGFTLRKGWFLEDITIGN 388

Query:   251 SIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNS-DCK 309
             ++V MYA+ G V+ AR VF+ +   D+ISWN++++GY QNG ASEA+ +++ M+   +  
Sbjct:   389 AVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIMEEEGEIA 448

Query:   310 PNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENM 369
              N  T + ++ AC+  G+ + G K HG ++ + + +D  +  ++ DMY KCG L+ A ++
Sbjct:   449 ANQGTWVSVLPACSQAGALRQGMKLHGRLLKNGLYLDVFVVTSLADMYGKCGRLEDALSL 508

Query:   370 FNDIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAG 429
             F  I P   +V  WN LIA +G HGHG KA+  F +ML+EGVKPDHITF ++LSACSH+G
Sbjct:   509 FYQI-PRVNSVP-WNTLIACHGFHGHGEKAVMLFKEMLDEGVKPDHITFVTLLSACSHSG 566

Query:   430 LIDEGRKCFADM-TKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGAL 488
             L+DEG+ CF  M T   + P +KHY CMVDM GRAG L  A   IK M L P+ S+WGAL
Sbjct:   567 LVDEGQWCFEMMQTDYGITPSLKHYGCMVDMYGRAGQLETALKFIKSMSLQPDASIWGAL 626

Query:   489 LLACRIHG-----EIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLK 543
             L ACR+HG     +IA+ +LF++EPEH GY VL+SN+YA++ KW  V ++R     KGL+
Sbjct:   627 LSACRVHGNVDLGKIASEHLFEVEPEHVGYHVLLSNMYASAGKWEGVDEIRSIAHGKGLR 686

Query:   544 KPAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDE 603
             K   +S +E    ++ F+T ++ +P ++E+Y+++ ++  ++KM GY+PD    L DVED+
Sbjct:   687 KTPGWSSMEVDNKVEVFYTGNQTHPMYEEMYRELTALQAKLKMIGYVPDHRFVLQDVEDD 746

Query:   604 DREHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDA 663
             ++EH+L  HSE+LA+AF ++    +  +++ KNLRVC DCHS  +FIS I  R+IIVRD+
Sbjct:   747 EKEHILMSHSERLAIAFALIATPAKTTIRIFKNLRVCGDCHSVTKFISKITEREIIVRDS 806

Query:   664 NRFHHFEGGTCSCNDYW 680
             NRFHHF+ G CSC DYW
Sbjct:   807 NRFHHFKNGVCSCGDYW 823


GO:0005739 "mitochondrion" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713776 AT3G26782 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131939 MEF29 "AT4G30700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124137 DOT4 "DEFECTIVELY ORGANIZED TRIBUTARIES 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178188 MEF7 "AT5G09950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032840 AT1G16480 "AT1G16480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125899 AT4G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81767PP348_ARATHNo assigned EC number0.41650.97050.8019yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query680
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-175
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-159
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-76
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-65
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-49
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 6e-20
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-11
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  520 bits (1342), Expect = e-175
 Identities = 252/673 (37%), Positives = 394/673 (58%), Gaps = 17/673 (2%)

Query: 15  LLKSCNFLASL---RQIHSSLTTSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHND 71
           +L++C  +  L   R++H+ +   G       + A +I  Y   G+  +AR +F+ +   
Sbjct: 193 VLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNA-LITMYVKCGDVVSARLVFDRMPRR 251

Query: 72  KSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKV 131
              S  WN MI  Y  NG C+E LEL+ TMR   +  +  T   V+ AC        G+ 
Sbjct: 252 DCIS--WNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGRE 309

Query: 132 VHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEK 191
           +HG +++TGF  D  V  +L+ MY   G   +  KVF  M  +D VSWT MI+ YE+   
Sbjct: 310 MHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGL 369

Query: 192 PEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAICNAFLEDLCIQNS 251
           P++AL  +   +Q+ +  D +TI SV SA   LGD+     +H  A     +  + + N+
Sbjct: 370 PDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANA 429

Query: 252 IVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPN 311
           ++ MY++C  ++KA  VF  + ++D+ISW S++ G   N +  EAL+ F +M     KPN
Sbjct: 430 LIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQML-LTLKPN 488

Query: 312 PVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFN 371
            VT +  +SAC  +G+   G++ H +++ + +  D  L NA++D+Y +CG ++ A N FN
Sbjct: 489 SVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFN 548

Query: 372 DIHPSERNVSSWNVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLI 431
                E++V SWN+L+ GY  HG G  A+E F++M+E GV PD +TF S+L ACS +G++
Sbjct: 549 S---HEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMV 605

Query: 432 DEGRKCFADMT-KLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQMPLPPNDSVWGALLL 490
            +G + F  M  K S+ P +KHYAC+VD+LGRAG L EA++ I +MP+ P+ +VWGALL 
Sbjct: 606 TQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLN 665

Query: 491 ACRIH-----GEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLKKP 545
           ACRIH     GE+AA ++F+L+P   GY++L+ N+YA + KW EV ++R+ M+  GL   
Sbjct: 666 ACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVD 725

Query: 546 AAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDR 605
              S +E    +  F T D  +P  KE+   +E    ++K +G     S ++ ++E   +
Sbjct: 726 PGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGLAGSESSSMDEIE-VSK 784

Query: 606 EHMLNYHSEKLAVAFGIMNLTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDANR 665
           + +   HSE+LA+AFG++N  P   + VTKNL +C +CH+  +FIS I RR+I VRD  +
Sbjct: 785 DDIFCGHSERLAIAFGLINTVPGMPIWVTKNLYMCENCHNTVKFISKIVRREISVRDTEQ 844

Query: 666 FHHFEGGTCSCND 678
           FHHF+ G CSC D
Sbjct: 845 FHHFKDGECSCGD 857


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 680
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.92
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.86
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.85
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.83
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.82
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.81
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.79
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.79
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.75
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.73
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.73
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.69
PRK14574 822 hmsH outer membrane protein; Provisional 99.65
KOG2076895 consensus RNA polymerase III transcription factor 99.64
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.57
KOG2003840 consensus TPR repeat-containing protein [General f 99.53
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.52
KOG2076895 consensus RNA polymerase III transcription factor 99.48
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.48
KOG2003840 consensus TPR repeat-containing protein [General f 99.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.46
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.46
KOG0547606 consensus Translocase of outer mitochondrial membr 99.46
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.45
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.43
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.42
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.42
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.38
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.37
KOG1915677 consensus Cell cycle control protein (crooked neck 99.37
KOG1126638 consensus DNA-binding cell division cycle control 99.37
KOG1915677 consensus Cell cycle control protein (crooked neck 99.33
KOG1126638 consensus DNA-binding cell division cycle control 99.33
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.32
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.32
KOG0547606 consensus Translocase of outer mitochondrial membr 99.32
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.31
PF1304150 PPR_2: PPR repeat family 99.28
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.26
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.25
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.24
PF1304150 PPR_2: PPR repeat family 99.23
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.21
PRK12370553 invasion protein regulator; Provisional 99.2
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.15
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.14
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.12
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.12
KOG2376652 consensus Signal recognition particle, subunit Srp 99.12
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.11
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.1
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.09
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.08
PRK12370553 invasion protein regulator; Provisional 99.08
PRK11189296 lipoprotein NlpI; Provisional 99.07
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.07
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.02
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.99
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.97
KOG1129478 consensus TPR repeat-containing protein [General f 98.97
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.92
KOG2376652 consensus Signal recognition particle, subunit Srp 98.89
KOG1129478 consensus TPR repeat-containing protein [General f 98.88
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.83
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.82
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.82
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.81
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.79
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.77
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.76
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.76
PRK11189296 lipoprotein NlpI; Provisional 98.74
PRK04841903 transcriptional regulator MalT; Provisional 98.68
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.67
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.67
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.67
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.63
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.63
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.62
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.61
KOG1125579 consensus TPR repeat-containing protein [General f 98.61
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.6
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.6
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.59
PRK04841903 transcriptional regulator MalT; Provisional 98.49
PF1285434 PPR_1: PPR repeat 98.48
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.47
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.47
PF1285434 PPR_1: PPR repeat 98.46
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.46
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.46
KOG1125579 consensus TPR repeat-containing protein [General f 98.45
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.41
KOG1128777 consensus Uncharacterized conserved protein, conta 98.41
KOG1128777 consensus Uncharacterized conserved protein, conta 98.39
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.34
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.34
PLN02789320 farnesyltranstransferase 98.27
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.26
PRK10370198 formate-dependent nitrite reductase complex subuni 98.22
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.19
PRK15359144 type III secretion system chaperone protein SscB; 98.18
PLN02789320 farnesyltranstransferase 98.16
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.14
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.14
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.13
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.11
PRK10370198 formate-dependent nitrite reductase complex subuni 98.1
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.08
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.05
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.04
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.01
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.01
PRK15359144 type III secretion system chaperone protein SscB; 98.01
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.98
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.97
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.95
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.92
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.91
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.89
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.86
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.84
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.78
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.76
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.73
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.71
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.7
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.68
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.66
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.62
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.61
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.53
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.44
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.35
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.34
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.32
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.27
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.26
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.26
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.24
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.22
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.2
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.19
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.14
PF1343134 TPR_17: Tetratricopeptide repeat 97.13
KOG0553304 consensus TPR repeat-containing protein [General f 97.1
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.09
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.08
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.07
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.04
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.02
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.01
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.01
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.01
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.99
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.99
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.95
KOG20411189 consensus WD40 repeat protein [General function pr 96.93
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.93
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.92
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.9
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.83
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.81
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.81
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.79
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.78
COG3898531 Uncharacterized membrane-bound protein [Function u 96.76
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.73
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.72
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.72
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.72
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.72
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.69
PF12688120 TPR_5: Tetratrico peptide repeat 96.64
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.61
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.61
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.59
KOG0553304 consensus TPR repeat-containing protein [General f 96.54
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.39
PF12688120 TPR_5: Tetratrico peptide repeat 96.38
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.31
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.27
COG4700251 Uncharacterized protein conserved in bacteria cont 96.05
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.95
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.9
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.87
PRK10803263 tol-pal system protein YbgF; Provisional 95.8
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 95.78
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.63
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.63
KOG20411189 consensus WD40 repeat protein [General function pr 95.53
KOG3941406 consensus Intermediate in Toll signal transduction 95.5
PRK10803263 tol-pal system protein YbgF; Provisional 95.45
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.41
PRK15331165 chaperone protein SicA; Provisional 95.35
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.35
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.21
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.11
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 95.09
PF1337173 TPR_9: Tetratricopeptide repeat 95.07
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.06
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.01
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.96
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.92
KOG15381081 consensus Uncharacterized conserved protein WDR10, 94.9
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.81
COG4700251 Uncharacterized protein conserved in bacteria cont 94.76
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.76
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.69
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.52
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.48
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.48
PF1337173 TPR_9: Tetratricopeptide repeat 94.47
COG3898531 Uncharacterized membrane-bound protein [Function u 94.33
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.28
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.23
smart00299140 CLH Clathrin heavy chain repeat homology. 94.09
PRK15331165 chaperone protein SicA; Provisional 94.02
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 93.74
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.67
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.59
smart00299140 CLH Clathrin heavy chain repeat homology. 93.57
PF13281374 DUF4071: Domain of unknown function (DUF4071) 93.46
KOG3941406 consensus Intermediate in Toll signal transduction 93.19
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.13
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.06
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.66
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.54
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.33
PRK11906458 transcriptional regulator; Provisional 92.33
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.29
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.15
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.11
KOG1258577 consensus mRNA processing protein [RNA processing 92.1
KOG1585308 consensus Protein required for fusion of vesicles 92.08
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.06
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 91.96
COG0457291 NrfG FOG: TPR repeat [General function prediction 91.87
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.71
KOG4555175 consensus TPR repeat-containing protein [Function 91.5
KOG4648 536 consensus Uncharacterized conserved protein, conta 91.36
COG3629280 DnrI DNA-binding transcriptional activator of the 90.89
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.88
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 90.63
KOG2610491 consensus Uncharacterized conserved protein [Funct 90.56
KOG1585308 consensus Protein required for fusion of vesicles 90.48
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.12
COG3629280 DnrI DNA-binding transcriptional activator of the 89.97
KOG2610491 consensus Uncharacterized conserved protein [Funct 89.8
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 89.78
PF13512142 TPR_18: Tetratricopeptide repeat 89.73
KOG1258577 consensus mRNA processing protein [RNA processing 89.66
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.49
KOG1941518 consensus Acetylcholine receptor-associated protei 89.13
PRK11906458 transcriptional regulator; Provisional 89.03
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.74
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 88.64
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 88.59
KOG4555175 consensus TPR repeat-containing protein [Function 88.55
COG1747711 Uncharacterized N-terminal domain of the transcrip 88.26
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.19
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 88.15
PRK09687280 putative lyase; Provisional 88.09
KOG1941 518 consensus Acetylcholine receptor-associated protei 88.03
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 87.98
PF1342844 TPR_14: Tetratricopeptide repeat 87.89
KOG4570418 consensus Uncharacterized conserved protein [Funct 87.6
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 87.57
PF1342844 TPR_14: Tetratricopeptide repeat 87.35
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 87.19
PF13512142 TPR_18: Tetratricopeptide repeat 87.16
PF13170297 DUF4003: Protein of unknown function (DUF4003) 87.15
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 87.14
COG0457291 NrfG FOG: TPR repeat [General function prediction 86.91
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.31
COG4105254 ComL DNA uptake lipoprotein [General function pred 86.09
PRK09687280 putative lyase; Provisional 85.87
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 85.81
KOG1586288 consensus Protein required for fusion of vesicles 85.37
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 83.77
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 83.56
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 83.47
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 83.46
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 83.14
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 82.8
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.51
KOG4234271 consensus TPR repeat-containing protein [General f 82.12
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 81.98
PF1343134 TPR_17: Tetratricopeptide repeat 81.62
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 80.68
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 80.54
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.01
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.7e-131  Score=1134.90  Aligned_cols=664  Identities=38%  Similarity=0.710  Sum_probs=650.7

Q ss_pred             CCcCC-CCCcchHHHHHHhccccccH---HHHHHHhh------hhhhHHHHHHhhhhhhhcccCCCChHHHHHHhhhccC
Q 037256            1 MRRLG-PSTEGFYDQLLKSCNFLASL---RQIHSSLT------TSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHN   70 (680)
Q Consensus         1 ~~~~~-~~~~~~~~~~l~~~~~~~~~---~~~h~~~~------~~~~~~~li~~y~~~~~~~~~~g~~~~A~~~f~~~~~   70 (680)
                      |.+.| .||.+||+++|++|+..+++   +++|..+.      |++++|+||++|.+ +      |++++|.++|++|+.
T Consensus       178 M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k-~------g~~~~A~~lf~~m~~  250 (857)
T PLN03077        178 MLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVK-C------GDVVSARLVFDRMPR  250 (857)
T ss_pred             HHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhc-C------CCHHHHHHHHhcCCC
Confidence            45678 79999999999999998887   89999987      99999999999999 9      999999999999998


Q ss_pred             CCCCcchHHHHHHHHHhCCCchHHHHHHHHHHhCCCCCCcccHHHHHHHHhccCChHHHHHHHHHHHHhCCCCchhHHHH
Q 037256           71 DKSYSFLWNTMIRAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAA  150 (680)
Q Consensus        71 ~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~  150 (680)
                      +  |+++||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|+++.|+++|..+.+.|+.||..+||+
T Consensus       251 ~--d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~  328 (857)
T PLN03077        251 R--DCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNS  328 (857)
T ss_pred             C--CcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHH
Confidence            7  99999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCChHHHHHHHhcCCCCChhHHHHHHHHHHhCCCccHHHHHHHHHHHcCCCCCHhHHHHHHHHHhccCChHHH
Q 037256          151 LVDMYAKCGQTDDGCKVFDEMSVRDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKA  230 (680)
Q Consensus       151 Li~~~~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a  230 (680)
                      |+.+|+++|++++|.++|++|..||+++||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|+++.|
T Consensus       329 Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a  408 (857)
T PLN03077        329 LIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVG  408 (857)
T ss_pred             HHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHccCCCChhHHHHHHHHHHhcCCHHHHHHHHHhcCCCChhHHHHHHHHHHHcCChhHHHHHHHHHHhCCCCC
Q 037256          231 QAVHGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEKRDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKP  310 (680)
Q Consensus       231 ~~~~~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~f~~m~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p  310 (680)
                      .++|+.+.+.|+.|+..++|+|+++|+++|++++|.++|++|.++|+++||+||.+|+++|+.++|+.+|++|.. +++|
T Consensus       409 ~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~p  487 (857)
T PLN03077        409 VKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKP  487 (857)
T ss_pred             HHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999986 5999


Q ss_pred             CHhhHHHHHHHHhhhcchHHHHHHHHHHHHcCCCCchHHHHHHHHHHHHcCCHHHHHHHHhhcCCCCCCHhHHHHHHHHH
Q 037256          311 NPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSERNVSSWNVLIAGY  390 (680)
Q Consensus       311 ~~~t~~~ll~a~~~~g~~~~a~~i~~~~~~~~~~~~~~~~~~li~~y~k~g~~~~A~~~f~~~~~~~~~~~~~~~li~~~  390 (680)
                      |..||++++.+|++.|+++.+.++|..+.+.|+.++..++|+|+++|+|+|++++|.++|+.+   .+|+++||+||.+|
T Consensus       488 d~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~---~~d~~s~n~lI~~~  564 (857)
T PLN03077        488 NSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH---EKDVVSWNILLTGY  564 (857)
T ss_pred             CHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc---CCChhhHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999998   78999999999999


Q ss_pred             HhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHhhh-cCCCcChHHHHHHHHHHHhcCCHHHH
Q 037256          391 GMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTK-LSVKPEVKHYACMVDMLGRAGCLYEA  469 (680)
Q Consensus       391 ~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~m~~-~~~~p~~~~~~~li~~~~~~g~~~~A  469 (680)
                      +++|+.++|+++|++|.+.|+.||.+||+++|.+|++.|++++|.++|+.|.+ .|+.|+..+|++|+++|+|+|++++|
T Consensus       565 ~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA  644 (857)
T PLN03077        565 VAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEA  644 (857)
T ss_pred             HHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999995 49999999999999999999999999


Q ss_pred             HHHHHhCCCCCCHhHHHHHHHHHHHH-----HHHHHHHHHccCCCCCchHHHHHHHHHhcCChhHHHHHHHHHHhCCCCC
Q 037256          470 FDMIKQMPLPPNDSVWGALLLACRIH-----GEIAANYLFQLEPEHTGYFVLMSNIYAASNKWREVGKLREDMKNKGLKK  544 (680)
Q Consensus       470 ~~~~~~m~~~p~~~~~~~ll~a~~~~-----~~~~~~~~~~l~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~g~~~  544 (680)
                      .+++++|+++||..+|++|+++|+.|     |+.+++++++++|+++++|+.|+++|+..|+|++|.++++.|+++|++|
T Consensus       645 ~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k  724 (857)
T PLN03077        645 YNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTV  724 (857)
T ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCC
Confidence            99999999999999999999999988     7889999999999999999999999999999999999999999999999


Q ss_pred             CCceeEEEECCEEEEEEeCCCCCcccHHHHHHHHHHHHHHHHcCcccCCccccccCchhhhhhhhhhchHHHHHHhcccC
Q 037256          545 PAAFSVIEYGKDIQGFHTADRVNPYWKEVYKKVESMAVEIKMAGYMPDLSCALHDVEDEDREHMLNYHSEKLAVAFGIMN  624 (680)
Q Consensus       545 ~~~~s~~~~~~~~~~f~~~~~~~~~~~~i~~~~~~l~~~m~~~g~~p~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~~  624 (680)
                      +||+|||++++.+|.|.+||.+||+.++||..++++..+|++.||+||+..++ ++++++|+..+++||||||+|||||+
T Consensus       725 ~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~g~~~~~~~~~-~~~~~~k~~~~~~hse~la~a~~l~~  803 (857)
T PLN03077        725 DPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGLAGSESSSM-DEIEVSKDDIFCGHSERLAIAFGLIN  803 (857)
T ss_pred             CCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhCCcCCCcchhc-cccHHHHHHHHHhccHHHHHHHhhhc
Confidence            99999999999999999999999999999999999999999999999999888 55788999999999999999999999


Q ss_pred             CCCCCeEEEEecccccchhhhHHHHHhhhhCceEEEecCCccccccCccccCCC
Q 037256          625 LTPEAVVQVTKNLRVCNDCHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCND  678 (680)
Q Consensus       625 ~~~~~~~~~~~~l~~~~~~~~~~~~~s~~~~~~~~~~~~~~~h~~~~g~csc~~  678 (680)
                      +|+|+||||+||||+|+|||+++||||++++|+|||||.+|||||++|+|||+|
T Consensus       804 ~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d  857 (857)
T PLN03077        804 TVPGMPIWVTKNLYMCENCHNTVKFISKIVRREISVRDTEQFHHFKDGECSCGD  857 (857)
T ss_pred             CCCCCeEEEeCCCEeCccHHHHHHHHHHHhCeEEEEecCCcceeCCCCcccCCC
Confidence            999999999999999999999999999999999999999999999999999998



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query680
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 9e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 80.6 bits (197), Expect = 9e-16
 Identities = 28/191 (14%), Positives = 61/191 (31%), Gaps = 6/191 (3%)

Query: 296 ALLLFDEMQNSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMD 355
           A  L D  + +   P       L+       S  + +   G    + +        A   
Sbjct: 76  AGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFK 135

Query: 356 MYAKCGDLDTAENMFNDIHPSER-----NVSSWNVLIAGYGMHGHGRKALEFFSQMLEEG 410
                  L  A ++    H   +      +  +N ++ G+   G  ++ +     + + G
Sbjct: 136 CCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAG 195

Query: 411 VKPDHITFTSILSACSHAGLIDEG-RKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEA 469
           + PD +++ + L              +C   M++  +K +    A ++    RA  L   
Sbjct: 196 LTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAV 255

Query: 470 FDMIKQMPLPP 480
             +     LPP
Sbjct: 256 HKVKPTFSLPP 266


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query680
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.81
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.76
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.75
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.75
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.73
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.73
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.72
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.69
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.69
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.68
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.67
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.66
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.65
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.65
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.64
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.63
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.55
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
3u4t_A272 TPR repeat-containing protein; structural genomics 99.5
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.5
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.49
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.48
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.47
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.45
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.44
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.41
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.39
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.39
3u4t_A272 TPR repeat-containing protein; structural genomics 99.39
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.38
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.38
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.36
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.35
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.34
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.34
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.33
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.33
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.33
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.32
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.31
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.3
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.28
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.28
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.28
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.27
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.27
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.24
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.22
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.21
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.19
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.17
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.07
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.06
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.05
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.04
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.97
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.94
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.88
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.87
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.86
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.86
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.83
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.81
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.79
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.79
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.78
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.75
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.73
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.69
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.68
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.67
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.66
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.66
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.65
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.64
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.6
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.58
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.58
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.56
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.5
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.5
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.49
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.49
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.48
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.46
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.45
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.45
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.45
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.45
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.43
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.43
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.43
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.42
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.42
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.38
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.37
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.33
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.33
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.32
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.3
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.3
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.28
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.27
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.25
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.24
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.21
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.18
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.17
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.17
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.17
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.16
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.16
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.16
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.15
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.12
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.07
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.02
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.99
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.98
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.96
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.96
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.95
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.95
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.94
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.93
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.92
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.92
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.92
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.9
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.9
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.88
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.88
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.85
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.85
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.85
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.84
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.81
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.8
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.8
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.76
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.76
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.75
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.75
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.74
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.72
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.67
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.65
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.64
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.63
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.62
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.62
3k9i_A117 BH0479 protein; putative protein binding protein, 97.61
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.57
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.56
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.54
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.4
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.38
3k9i_A117 BH0479 protein; putative protein binding protein, 97.38
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.36
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.27
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.19
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.01
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.0
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.98
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.98
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.98
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.92
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.89
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.82
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.82
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.81
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.7
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.7
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.62
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.53
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.48
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.44
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.43
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.83
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.78
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.45
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.34
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.23
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.17
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.13
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.61
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.61
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.95
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.9
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.27
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.26
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.17
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.03
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.02
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 91.69
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 91.65
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 91.3
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.5
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 88.98
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 88.87
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.66
2p58_C116 Putative type III secretion protein YSCG; type III 87.88
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 87.8
2uwj_G115 Type III export protein PSCG; virulence, chaperone 86.78
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 86.1
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 85.53
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 85.28
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 85.19
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 85.06
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 84.95
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 84.9
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 84.84
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 84.57
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 84.41
2p58_C116 Putative type III secretion protein YSCG; type III 82.09
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 81.43
2uwj_G115 Type III export protein PSCG; virulence, chaperone 81.14
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 80.67
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 80.11
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3e-42  Score=383.76  Aligned_cols=508  Identities=8%  Similarity=-0.044  Sum_probs=402.3

Q ss_pred             HHHHhccccccHHHHHHHhh----hhhhHHHHHHhhhhhhhcccCCCChHHHHHHhhhccCCCCCcchHHHHHHHHHhCC
Q 037256           14 QLLKSCNFLASLRQIHSSLT----TSGLINQALHLGAKIIIKYTTYGEPNTARSLFNSIHNDKSYSFLWNTMIRAYANNG   89 (680)
Q Consensus        14 ~~l~~~~~~~~~~~~h~~~~----~~~~~~~li~~y~~~~~~~~~~g~~~~A~~~f~~~~~~~p~~~~~~~li~~~~~~g   89 (680)
                      .+...+.....++++|....    .......+...+.+ +      |.+..+...|+.++..  ++..|+.++..+.+.|
T Consensus        28 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~------~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~g   98 (597)
T 2xpi_A           28 AAYMTPPSMGALNANNSNSQLSTLTISPMTYLANNTST-D------GSFLKERNAQNTDSLS--REDYLRLWRHDALMQQ   98 (597)
T ss_dssp             -----------------CTTSCGGGGCGGGGGC----------------------------C--HHHHHHHHHHHHHHTT
T ss_pred             HHhcCCccHHHHhhccccccccceeechhhhhcccccc-c------CccCCCCCccccchHH--HHHHHHHHHHHHHHcc
Confidence            33333444444466676554    11112223334555 6      8889999999988876  8999999999999999


Q ss_pred             CchHHHHHHHHHHhCCCCCCcccHHHHHHHHhccCChHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCChHHHHHHHh
Q 037256           90 HCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTDDGCKVFD  169 (680)
Q Consensus        90 ~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~Li~~~~~~g~~~~A~~~f~  169 (680)
                      ++++|+.+|++|..  ..|+..++..++.+|.+.|++++|..+++.+...  ++++.+++.++.+|.++|++++|.++|+
T Consensus        99 ~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~  174 (597)
T 2xpi_A           99 QYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLG  174 (597)
T ss_dssp             CHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHC
T ss_pred             CchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHh
Confidence            99999999999985  4678899999999999999999999999988653  6789999999999999999999999999


Q ss_pred             cCCCC-------------------ChhHHHHHHHHHHhCCCccHHHHHHHHHHHcCCCCC-HhHHHHHHHHHhccCChHH
Q 037256          170 EMSVR-------------------DLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSD-SVTIVSVASAVGQLGDVLK  229 (680)
Q Consensus       170 ~~~~~-------------------~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~-~~t~~~ll~~~~~~~~~~~  229 (680)
                      ++...                   ++.+|+.++.+|.+.|++++|+++|++|.+.+  |+ ...+..+...+...+..+.
T Consensus       175 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--p~~~~~~~~l~~~~~~~~~~~~  252 (597)
T 2xpi_A          175 ETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVD--AKCYEAFDQLVSNHLLTADEEW  252 (597)
T ss_dssp             SSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHTTCSCHHHHH
T ss_pred             ccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC--chhhHHHHHHHHhhcccchhHH
Confidence            65433                   47899999999999999999999999999864  43 4444444443333322222


Q ss_pred             H--HHH-HHHHHHccCCCChhHHHHHHHHHHhcCCHHHHHHHHHhcCC--CChhHHHHHHHHHHHcCChhHHHHHHHHHH
Q 037256          230 A--QAV-HGYAICNAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEK--RDLISWNSMLTGYIQNGQASEALLLFDEMQ  304 (680)
Q Consensus       230 a--~~~-~~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~f~~m~~--~~~~~~~~li~~~~~~g~~~~A~~~~~~m~  304 (680)
                      +  ..+ +..+...+......+++.++.+|.+.|++++|.++|+++.+  ++..+|+.++.+|.+.|++++|+++|+++.
T Consensus       253 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~  332 (597)
T 2xpi_A          253 DLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKIL  332 (597)
T ss_dssp             HHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred             HHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHH
Confidence            1  111 44455555556667788889999999999999999999988  799999999999999999999999999999


Q ss_pred             hCCCCCCHhhHHHHHHHHhhhcchHHHHHHHHHHHHcCCCCchHHHHHHHHHHHHcCCHHHHHHHHhhcCCCC-CCHhHH
Q 037256          305 NSDCKPNPVTALILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSE-RNVSSW  383 (680)
Q Consensus       305 ~~g~~p~~~t~~~ll~a~~~~g~~~~a~~i~~~~~~~~~~~~~~~~~~li~~y~k~g~~~~A~~~f~~~~~~~-~~~~~~  383 (680)
                      +.+ +.+..++..++.++...|+.++|..+++.+.+.. +.+..+++.++.+|.++|++++|.++|+++.... .+..+|
T Consensus       333 ~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~  410 (597)
T 2xpi_A          333 EID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAW  410 (597)
T ss_dssp             HHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHH
T ss_pred             HcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHH
Confidence            765 4477889999999999999999999999998765 6688999999999999999999999999985444 468899


Q ss_pred             HHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHhhhcCCCcChHHHHHHHHHHHhc
Q 037256          384 NVLIAGYGMHGHGRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRA  463 (680)
Q Consensus       384 ~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~  463 (680)
                      +.++.+|.+.|++++|+++|++|.+.+ +++..+|..++.+|.+.|++++|.++|+++.+.. +.+..+|+.++..|.+.
T Consensus       411 ~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~  488 (597)
T 2xpi_A          411 IGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYDPLLLNELGVVAFNK  488 (597)
T ss_dssp             HHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHh
Confidence            999999999999999999999999852 3467899999999999999999999999999864 45788999999999999


Q ss_pred             CCHHHHHHHHHhC-------CCCCC--HhHHHHHHHHHHHH-----HHHHHHHHHccCCCCCchHHHHHHHHHhcCChhH
Q 037256          464 GCLYEAFDMIKQM-------PLPPN--DSVWGALLLACRIH-----GEIAANYLFQLEPEHTGYFVLMSNIYAASNKWRE  529 (680)
Q Consensus       464 g~~~~A~~~~~~m-------~~~p~--~~~~~~ll~a~~~~-----~~~~~~~~~~l~p~~~~~~~~l~~~~~~~g~~~~  529 (680)
                      |++++|.++|+++       +..|+  ..+|..+..+|...     |...++++++++|+++.+|..++.+|.+.|++++
T Consensus       489 g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~  568 (597)
T 2xpi_A          489 SDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGL  568 (597)
T ss_dssp             TCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHH
T ss_pred             CCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHH
Confidence            9999999999988       45787  67999999999887     7788889999999999999999999999999999


Q ss_pred             HHHHHHHHHhC
Q 037256          530 VGKLREDMKNK  540 (680)
Q Consensus       530 A~~~~~~m~~~  540 (680)
                      |.+.++++.+.
T Consensus       569 A~~~~~~~l~~  579 (597)
T 2xpi_A          569 AITHLHESLAI  579 (597)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHhc
Confidence            99999999874



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query680
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.42
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.42
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.01
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.87
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.84
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.82
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.8
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.79
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.76
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.71
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.31
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.25
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.23
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.16
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.11
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.11
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.95
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.94
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.93
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.91
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.88
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.86
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.85
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.74
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.72
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.7
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.69
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.57
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.57
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.49
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.46
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.44
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.38
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.36
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.32
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.21
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.2
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.18
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.11
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.94
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.94
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.92
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.86
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.72
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.55
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.23
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.17
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.78
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.87
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.2
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.08
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 90.07
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 89.6
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 82.88
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 81.99
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=3.2e-19  Score=183.02  Aligned_cols=375  Identities=12%  Similarity=0.091  Sum_probs=201.2

Q ss_pred             HHHHhCCCchHHHHHHHHHHhCCCCCCcccHHHHHHHHhccCChHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCChH
Q 037256           83 RAYANNGHCVETLELYSTMRRSGISSNSYTFPFVLKACASNSLILEGKVVHGDIIRTGFLSDSYVQAALVDMYAKCGQTD  162 (680)
Q Consensus        83 ~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~Li~~~~~~g~~~  162 (680)
                      ..+.+.|++++|++.|+++.+..+ -+...+..+...+...|++++|...++.+++.. +.+..++..+...|.+.|+++
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~p-~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~   84 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQEP-DNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQ   84 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhcccc
Confidence            344555666666666666554321 133445555555555566666666665555543 223444555555555555555


Q ss_pred             HHHHHHhcCCC---CChhHHHHHHHHHHhCCCccHHHHHHHHHHHcCCCCCHhHHHHHHHHHhccCChHHHHHHHHHHHH
Q 037256          163 DGCKVFDEMSV---RDLVSWTVMITAYEQAEKPEEALILFQKTQQEGLLSDSVTIVSVASAVGQLGDVLKAQAVHGYAIC  239 (680)
Q Consensus       163 ~A~~~f~~~~~---~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~  239 (680)
                      +|...+.....   .+...+..........+....+...........                                 
T Consensus        85 ~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------------------------------  131 (388)
T d1w3ba_          85 EAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN---------------------------------  131 (388)
T ss_dssp             HHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC---------------------------------
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccc---------------------------------
Confidence            55555544331   122223333333333333333333333332221                                 


Q ss_pred             ccCCCChhHHHHHHHHHHhcCCHHHHHHHHHhcCC---CChhHHHHHHHHHHHcCChhHHHHHHHHHHhCCCCCCHhhHH
Q 037256          240 NAFLEDLCIQNSIVAMYARCGNVEKARLVFDMMEK---RDLISWNSMLTGYIQNGQASEALLLFDEMQNSDCKPNPVTAL  316 (680)
Q Consensus       240 ~g~~~~~~~~~~Li~~y~~~g~~~~A~~~f~~m~~---~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~  316 (680)
                         .................+....+...+.....   .+...+..+...+...|++++|...+++..+.. +-+...+.
T Consensus       132 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~  207 (388)
T d1w3ba_         132 ---PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYI  207 (388)
T ss_dssp             ---TTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHH
T ss_pred             ---cccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHH
Confidence               11222222233333333444444333333221   233444445555555555555555555554431 12233444


Q ss_pred             HHHHHHhhhcchHHHHHHHHHHHHcCCCCchHHHHHHHHHHHHcCCHHHHHHHHhhcCCCCC-CHhHHHHHHHHHHhcCC
Q 037256          317 ILVSACTYLGSRQLGRKFHGYIINSNMKIDATLRNAVMDMYAKCGDLDTAENMFNDIHPSER-NVSSWNVLIAGYGMHGH  395 (680)
Q Consensus       317 ~ll~a~~~~g~~~~a~~i~~~~~~~~~~~~~~~~~~li~~y~k~g~~~~A~~~f~~~~~~~~-~~~~~~~li~~~~~~g~  395 (680)
                      .+...+...|++++|...+....+.+ +.+...+..+...|.+.|++++|...|++.....| +..+|..+...|...|+
T Consensus       208 ~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~  286 (388)
T d1w3ba_         208 NLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGS  286 (388)
T ss_dssp             HHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSC
T ss_pred             HHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            44445555555555555555544443 33445555566666677777777777766543333 35566777777777777


Q ss_pred             hHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHhhhcCCCcChHHHHHHHHHHHhcCCHHHHHHHHHh
Q 037256          396 GRKALEFFSQMLEEGVKPDHITFTSILSACSHAGLIDEGRKCFADMTKLSVKPEVKHYACMVDMLGRAGCLYEAFDMIKQ  475 (680)
Q Consensus       396 ~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~  475 (680)
                      +++|++.++..... .+.+...+..+...+...|++++|.+.|++..+.. +-+...+..+...|.+.|++++|.+.++ 
T Consensus       287 ~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~-  363 (388)
T d1w3ba_         287 VAEAEDCYNTALRL-CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYK-  363 (388)
T ss_dssp             HHHHHHHHHHHHHH-CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHH-
T ss_pred             HHHHHHHHHhhhcc-CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHH-
Confidence            77777777776664 23344566666667777777777777777766542 2345566667777777777777766665 


Q ss_pred             CCCCCCHhHHHHHHHHHHHHHHHHHHHHHccCCCCCchHHHHHHHHHhcCC
Q 037256          476 MPLPPNDSVWGALLLACRIHGEIAANYLFQLEPEHTGYFVLMSNIYAASNK  526 (680)
Q Consensus       476 m~~~p~~~~~~~ll~a~~~~~~~~~~~~~~l~p~~~~~~~~l~~~~~~~g~  526 (680)
                                                ++++++|+++.+|..|+.+|.+.|+
T Consensus       364 --------------------------~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         364 --------------------------EAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             --------------------------HHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             --------------------------HHHHhCCCCHHHHHHHHHHHHHcCC
Confidence                                      4467788888888889888887774



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure