Citrus Sinensis ID: 037368

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820---
MYQWRKFDFFEEKYGGKSTIPEEVSGNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDKMEPEGTSSTSPDCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSDRLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHKPMETIDILLRLCTEDGESTKRGASSSTYMSMLPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGVDLRLRSGSGLPKAEYNGEVTADGKDTYKGKDVLERREKGLRLLKTAWPSELEHPLYDVDLAIILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTYIERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKLEQESKLIEGDRRAIENYQ
cccccEEccccccccccccccccccccEEEEEccccEEEEEEcccEEEEEcccccEEEEEEEEcccEEEEEEEccccEEEEEEccccccccccccEEEEEEcccccccccccccccEEEEEEEcccccccccccEEEEEEEcccccEEEEEEccEEEEEEEcccccccccEEEEEEcccccccEEEEEEccccEEEEEEcccEEEEEEEEccccccEEEcccccccccccccccccEEEEEccEEEEEEccccccccccccccEEEEEEccEEEEEEEcccccccEEEEEEccccEEEEEEEcccEEEEEEEcccEEEEEcccEEEEEEEccHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccEEEEEEEEEEEcccccccccccccEEEEEccccEEEEEEcccEEEEEccccEEEEEEEEcccEEEEEEEEccccEEEEEEccccccccccccEEEEEEccccccccccccccEEEEEEEEcccccccccEEEEEEEEcccccEEEEEEEcccEEEEEEccccccccccEEEEEEccccEEEEEEEEcccEEEEEEEEccEEEEEEEccccccccEEcccccccccEEEcccccEEEEcccEEEEEccccccccEEEccccEEEEEEccEEEEEEccccccccEEEEEEcccEEEEEEcccccHHHHHHccccEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHHHHHHccccHEEEEEHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccHHHHHccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHcccccccccHEEEEEccccccHHHHHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHccHHHHHHHHHHHHHcccccHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
myqwrkfdffeekyggkstipeevsgnitccssgrgkvvigcddGAVSLLDrglkfnfgfqahsSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKvfdldkmepegtsstspdciGILRVFtsqfpeakiTSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLqvdnqcsvmglgfrvdgqalqlfavtpnsVILFslqnqppkrqfldnigcstnsvAMSDRLELiigrpeavyfyevdgrgpcwafeGEKKLLGWFRGYLLCVIAdqrnsknifnvYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHekgfaskdhTTLLLNCYTKLKDVEKLNMfikgedgvgehkfDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISsldpsqagvtvKEYGKILIEHKPMETIDILLRLCtedgestkrgassstymsmlpspvdFLNIFVHHPESLMDFLEKYTnkvkdspaqVEIHNTLLELYLsydlnfpsisqlndgvdlrlrsgsglpkaeyngevtadgkdtykgkdVLERREKGLRLLKtawpselehplydVDLAIILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRlgdsgkggdpsLWVDLLKYFGELGEDCSKEVKEVLTYierddilppivvlqtlsrnpcltlSVIKDYIARKLEQESKLIEGDRRAIENYQ
myqwrkfdffeekyggkstipeevsgNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDKMepegtsstspdciGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSDRLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKgedgvgehkFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYIssldpsqagvTVKEYGKILIEHKPMETIDILLRLCTEDGESTKRGASSSTYMSMLPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGVDLRLRSGsglpkaeyngevtadgkdtykgkdvlerREKGLRLlktawpselehplYDVDLAIILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTYIERDDILPPIVVlqtlsrnpclTLSVIKDYIArkleqeskliegdrraienyq
MYQWRKFDFFEEKYGGKSTIPEEVSGNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDKMEPEGTSSTSPDCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSDRLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHKPMETIDILLRLCTEDGESTKRGASSSTYMSMLPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGVDLRLRSGSGLPKAEYNGEVTADGKDTYKGKDVlerrekglrllkTAWPSELEHPLYDVDLAIILCEMNAFkegllylyeklklykeVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTYIERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKLEQESKLIEGDRRAIENYQ
***WRKFDFFEEKYGGKSTIPEEVSGNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLD************DCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSDRLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHKPMETIDILLRLCT******************LPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGVDLRL***************************VLERREKGLRLLKTAWPSELEHPLYDVDLAIILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTYIERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKL******************
MYQWRKFDFFEEKYGGKSTIPEEVSGNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDKMEPEGTSSTSPDCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQ*********IGCSTNSVAMSDRLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHKPMETIDILLRLCTEDGE***************PSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLN****SQLNDGVDLRLRSGSGLPKAEYNGEVTADGKDTYK*****ERREKGLRLLKTAWPSELEHPLYDVDLAIILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTYIERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKL*************IE*Y*
MYQWRKFDFFEEKYGGKSTIPEEVSGNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDKM********SPDCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSDRLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHKPMETIDILLRLCTEDG*********STYMSMLPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGVDLRLRSGSGLPKAEYNGEVTADGKDTYKGKDVLERREKGLRLLKTAWPSELEHPLYDVDLAIILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTYIERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKLEQESKLIEGDRRAIENYQ
MYQWRKFDFFEEKYGGKSTIPEEVSGNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDKMEPEGTSSTSPDCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSDRLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHKPMETIDILLRLCTEDGEST**********SMLPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGVDLRLRSGSGLPKAEYNGEVTADGKDTYKGKDVLERREKGLRLLKTAWPSELEHPLYDVDLAIILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTYIERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKLEQESKLIEGDRRAIENYQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYQWRKFDFFEEKYGGKSTIPEEVSGNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDKMEPEGTSSTSPDCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSDRLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHKPMETIDILLRLCTEDGESTKRGASSSTYMSMLPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGVDLRLRSGSGLPKAEYNGEVTADGKDTYKGKDVLERREKGLRLLKTAWPSELEHPLYDVDLAIILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTYIERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKLEQESKLIEGDRRAIENYQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query823 2.2.26 [Sep-21-2011]
Q91W86 941 Vacuolar protein sorting- yes no 0.919 0.804 0.387 1e-152
Q9H270 941 Vacuolar protein sorting- yes no 0.919 0.804 0.383 1e-151
Q54YP4 952 Vacuolar protein sorting- yes no 0.908 0.785 0.359 1e-147
Q09600 980 Vacuolar protein sorting- yes no 0.643 0.540 0.247 4e-34
Q9P6N4906 Vacuolar membrane protein yes no 0.924 0.839 0.221 4e-30
P12868 1029 Vacuolar membrane protein yes no 0.481 0.384 0.256 2e-23
Q8I480 1272 RING finger protein PFE01 yes no 0.303 0.196 0.288 2e-21
P87295847 Pep5-like zinc finger pro no no 0.233 0.226 0.237 1e-05
>sp|Q91W86|VPS11_MOUSE Vacuolar protein sorting-associated protein 11 homolog OS=Mus musculus GN=Vps11 PE=1 SV=3 Back     alignment and function desciption
 Score =  538 bits (1385), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 332/856 (38%), Positives = 469/856 (54%), Gaps = 99/856 (11%)

Query: 3   QWRKFDFFE-----EKYGGKSTIP--EEVSGN-----------ITCCSSGRGKVVIGCDD 44
           QWR+F FFE     E  G     P    VSG+           IT C SGRG +V G  +
Sbjct: 6   QWRRFVFFEKELVKEPLGNDGAAPGAAPVSGSAASKFLCLPPGITVCDSGRGSLVFGDME 65

Query: 45  GAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDK 104
           G +  L R L+   GFQA+   V  L QLKQ N L +VGEDE+         +K+++L+K
Sbjct: 66  GQIWFLPRSLQLT-GFQAYKLRVTHLYQLKQHNILASVGEDEE----GINPLVKIWNLEK 120

Query: 105 MEPEGTSSTSPDCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDI 164
            +       +P C  I        P   + S L + E   +  +AIG  +G +   KGDI
Sbjct: 121 RD-----GGNPLCTRIFPAIPGTEP--TVVSCLTVHEN--LNFMAIGFTDGSVTLNKGDI 171

Query: 165 ARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGC 224
            R+R ++ ++       V GL FR  G+   LF VT  +V  + +  +   R  LD  GC
Sbjct: 172 TRDRHSKTQILHKGNYPVTGLAFRQAGKTTHLFVVTTENVQSYIVSGKDYPRVELDTHGC 231

Query: 225 STNSVAMSDR---LELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIAD-- 279
                A+SD    L+ I+   E VY Y+ D RGPC+AFEG K ++ WFRGYL+ V  D  
Sbjct: 232 GLRCSALSDPSQDLQFIVAGDECVYLYQPDERGPCFAFEGHKLIVHWFRGYLVIVSRDRK 291

Query: 280 ------------QRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLC 327
                       Q + K I N+YDL N+ IA+S   +++  +L EWG++ ++  D  V  
Sbjct: 292 VSPKSEFTSRDSQNSDKQILNIYDLCNKFIAYSAGFEDIVDVLAEWGSLYVLTRDGRVHA 351

Query: 328 IGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQY 387
           + EKD ++KL+MLFKKNL+ +AINL +SQ  D+   A++  +YGDHLYSK ++D A+ QY
Sbjct: 352 LQEKDTQTKLEMLFKKNLFEMAINLAKSQHLDSDGLAQIFMQYGDHLYSKGNHDGAVQQY 411

Query: 388 ILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLN 447
           I TIG LEPSYVI+KFLDAQRI+NLT YL+ LH +  A+ DHTTLLLNCYTKLKD  KL 
Sbjct: 412 IRTIGKLEPSYVIRKFLDAQRIHNLTAYLQTLHRQSLANADHTTLLLNCYTKLKDSSKLE 471

Query: 448 MFIKGEDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEAL 507
            FIK +     H FDVETAI+V R A Y+ HA+Y+A+    HE YLKI LED+  Y EAL
Sbjct: 472 EFIKTKSESEVH-FDVETAIKVLRQAGYYSHALYLAENHAHHEWYLKIQLEDIKNYQEAL 530

Query: 508 QYISSLDPSQAGVTVKEYGKILIEHKPMETIDILLRLCTEDGESTKRGASSSTYMSMLPS 567
           +YI  L   QA   +K YGK L+ H P +T  +L  LCT D   +  G      +S   S
Sbjct: 531 RYIGKLPFEQAESNMKRYGKTLMHHIPEQTTQLLKGLCT-DYRPSLEGRGDREALSCRAS 589

Query: 568 PVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGV 627
             +F+ IF ++P  L  FLE  +    DSP    I++TLLEL L                
Sbjct: 590 SEEFIPIFANNPRELKAFLEHMSEVQPDSPQG--IYDTLLELRL---------------- 631

Query: 628 DLRLRSGSGLPKAEYNGEVTADGKDTYKGKDVLERREKGLRLLKTAWPSELEHPLYDVDL 687
                            +  A  KD  + K+ L    + + LLK+    ++       D 
Sbjct: 632 -----------------QNWAHEKDP-QAKEKLH--AEAISLLKSGRFCDV------FDK 665

Query: 688 AIILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWV 747
           A++LC+M+ F++G+LYLYE+ KL+++++  + Q   +  +IA C+R G+     +PSLW 
Sbjct: 666 ALVLCQMHDFQDGVLYLYEQGKLFQQIMHYHMQHEQYRQVIAVCERHGEQ----EPSLWE 721

Query: 748 DLLKYFGELGEDCSKEVKEVLTYIERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKLEQ 807
             L YF    EDC + V  VL +IE   ++PP++V+QTL+ N   TLS+I+DY+ +KL++
Sbjct: 722 QALSYFARKEEDCKEYVAAVLRHIENKSLMPPLLVVQTLAHNSTATLSIIRDYLVQKLQK 781

Query: 808 ESKLIEGDRRAIENYQ 823
           +S+ I  D   +  Y+
Sbjct: 782 QSQQIAQDELRVRRYR 797
May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.
Mus musculus (taxid: 10090)
>sp|Q9H270|VPS11_HUMAN Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens GN=VPS11 PE=1 SV=1 Back     alignment and function description
>sp|Q54YP4|VPS11_DICDI Vacuolar protein sorting-associated protein 11 homolog OS=Dictyostelium discoideum GN=vps11 PE=3 SV=1 Back     alignment and function description
>sp|Q09600|VPS11_CAEEL Vacuolar protein sorting-associated protein 11 homolog OS=Caenorhabditis elegans GN=vps-11 PE=3 SV=2 Back     alignment and function description
>sp|Q9P6N4|PEP5_SCHPO Vacuolar membrane protein pep5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep5 PE=3 SV=1 Back     alignment and function description
>sp|P12868|PEP5_YEAST Vacuolar membrane protein PEP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP5 PE=1 SV=2 Back     alignment and function description
>sp|Q8I480|ZNRF2_PLAF7 RING finger protein PFE0100w OS=Plasmodium falciparum (isolate 3D7) GN=PFE0100w PE=4 SV=1 Back     alignment and function description
>sp|P87295|PEP5L_SCHPO Pep5-like zinc finger protein C16A10.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.03c PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query823
224131830 962 predicted protein [Populus trichocarpa] 1.0 0.855 0.867 0.0
255588437 962 expressed protein, putative [Ricinus com 1.0 0.855 0.858 0.0
225447592 960 PREDICTED: vacuolar protein sorting-asso 0.996 0.854 0.854 0.0
449444482 957 PREDICTED: vacuolar protein sorting-asso 1.0 0.859 0.839 0.0
449505126 957 PREDICTED: LOW QUALITY PROTEIN: vacuolar 1.0 0.859 0.838 0.0
296085000913 unnamed protein product [Vitis vinifera] 0.945 0.852 0.834 0.0
357437835 968 Vacuolar protein sorting-associated prot 0.996 0.847 0.792 0.0
356520730 966 PREDICTED: vacuolar protein sorting-asso 0.995 0.847 0.807 0.0
356504517 965 PREDICTED: vacuolar protein sorting-asso 0.995 0.848 0.802 0.0
297831600 932 ATVPS11 [Arabidopsis lyrata subsp. lyrat 0.989 0.873 0.792 0.0
>gi|224131830|ref|XP_002321189.1| predicted protein [Populus trichocarpa] gi|222861962|gb|EEE99504.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1499 bits (3882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 723/833 (86%), Positives = 774/833 (92%), Gaps = 10/833 (1%)

Query: 1   MYQWRKFDFFEEKYGGKSTIPEEVS-GNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFG 59
           MYQWRKF+FFEEKYGGKS+IPE+V+ G I CCSSGRGKVVIGCDDG VSLLDRGLKFNF 
Sbjct: 1   MYQWRKFEFFEEKYGGKSSIPEDVTAGKIECCSSGRGKVVIGCDDGTVSLLDRGLKFNFS 60

Query: 60  FQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDKMEPEGTSS-TSPDCI 118
           FQ+HSSSVLFLQ LKQRNFLVTVGEDEQ+S QQSA+CLKVFDLDKM+ EGTS+ T+PDCI
Sbjct: 61  FQSHSSSVLFLQHLKQRNFLVTVGEDEQISPQQSAMCLKVFDLDKMQSEGTSAATTPDCI 120

Query: 119 GILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDN 178
           GILR+FT+QFPEA ITSFLVLEEAPPILL+AIGLDNGCIYCIKGDIARERITRFKLQVDN
Sbjct: 121 GILRIFTNQFPEANITSFLVLEEAPPILLMAIGLDNGCIYCIKGDIARERITRFKLQVDN 180

Query: 179 -----QCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSD 233
                  S+ GLGFRVDGQALQLFAVTP+SV LFS+ NQPP+RQ LD IGC+ NSV MSD
Sbjct: 181 VSDKSHSSITGLGFRVDGQALQLFAVTPDSVSLFSMHNQPPRRQTLDQIGCNFNSVTMSD 240

Query: 234 RLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLK 293
           RLELIIGRPEAVYFYEVDGRGPCWAFEGEKK LGWFRGYLLCVIADQR  K+ FNVYDLK
Sbjct: 241 RLELIIGRPEAVYFYEVDGRGPCWAFEGEKKFLGWFRGYLLCVIADQRTGKDTFNVYDLK 300

Query: 294 NRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLV 353
           NRLIAHSLVVKEVSHMLCEWGNIIL+MTDKS LCIGEKDMESKLDMLFKKNLYTVAINLV
Sbjct: 301 NRLIAHSLVVKEVSHMLCEWGNIILIMTDKSTLCIGEKDMESKLDMLFKKNLYTVAINLV 360

Query: 354 QSQQADAAATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLT 413
           QSQQADAAATAEVLRKYGDHLYSKQDYDEAM+QYI TIGHLEPSYVIQKFLDAQRIYNLT
Sbjct: 361 QSQQADAAATAEVLRKYGDHLYSKQDYDEAMAQYISTIGHLEPSYVIQKFLDAQRIYNLT 420

Query: 414 NYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVETAIRVCRAA 473
           +YLEKLHEKG ASKDHTTLLLNCYTKLKDVEKLN+FIK EDG GEHKFDVETAIRVCRAA
Sbjct: 421 SYLEKLHEKGLASKDHTTLLLNCYTKLKDVEKLNVFIKSEDGAGEHKFDVETAIRVCRAA 480

Query: 474 NYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHK 533
           NYHEHAMYVAKKAG+HELYLKILLEDLGRY EALQYISSL+PSQAGVTVKEYGKILIEHK
Sbjct: 481 NYHEHAMYVAKKAGRHELYLKILLEDLGRYGEALQYISSLEPSQAGVTVKEYGKILIEHK 540

Query: 534 PMETIDILLRLCTEDGESTKRGASSSTYMSMLPSPVDFLNIFVHHPESLMDFLEKYTNKV 593
           P++TI+IL+RLCTEDGESTKR +SSSTY++MLPSPVDFLNIF+HHP SLMDFLEKYT+KV
Sbjct: 541 PVKTIEILMRLCTEDGESTKRESSSSTYLTMLPSPVDFLNIFIHHPPSLMDFLEKYTDKV 600

Query: 594 KDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGVDLRLRSGSG---LPKAEYNGEVTADG 650
           KDSPAQVEIHNTLLELYLS DLNFPSISQ ++GVD  L++ SG   +PKAE   + +AD 
Sbjct: 601 KDSPAQVEIHNTLLELYLSNDLNFPSISQASNGVDHTLKARSGSLVMPKAESKLKSSADR 660

Query: 651 KDTYKGKDVLERREKGLRLLKTAWPSELEHPLYDVDLAIILCEMNAFKEGLLYLYEKLKL 710
           KDT K +D +ER EKGLRLLK+AWPS+LE PLYDVDLAIILCEMNAFK+GLLYLYEK+KL
Sbjct: 661 KDTSKERDRMERCEKGLRLLKSAWPSDLEQPLYDVDLAIILCEMNAFKDGLLYLYEKMKL 720

Query: 711 YKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTY 770
           YKEVIACY Q+ DHEGLIACCK+LGDSGKGGDPSLW DLLKYFGELGEDCSKEVK+VLTY
Sbjct: 721 YKEVIACYMQSQDHEGLIACCKKLGDSGKGGDPSLWADLLKYFGELGEDCSKEVKDVLTY 780

Query: 771 IERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKLEQESKLIEGDRRAIENYQ 823
           IERDDILPPI+VLQTLSRNPCLTLSVIKDYIARKLEQESKLIE DRRAIE YQ
Sbjct: 781 IERDDILPPIIVLQTLSRNPCLTLSVIKDYIARKLEQESKLIEEDRRAIEKYQ 833

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255588437|ref|XP_002534605.1| expressed protein, putative [Ricinus communis] gi|223524934|gb|EEF27778.1| expressed protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225447592|ref|XP_002272218.1| PREDICTED: vacuolar protein sorting-associated protein 11 homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|449444482|ref|XP_004140003.1| PREDICTED: vacuolar protein sorting-associated protein 11 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|449505126|ref|XP_004162384.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar protein sorting-associated protein 11 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|296085000|emb|CBI28415.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357437835|ref|XP_003589193.1| Vacuolar protein sorting-associated protein-like protein [Medicago truncatula] gi|355478241|gb|AES59444.1| Vacuolar protein sorting-associated protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356520730|ref|XP_003529013.1| PREDICTED: vacuolar protein sorting-associated protein 11 homolog [Glycine max] Back     alignment and taxonomy information
>gi|356504517|ref|XP_003521042.1| PREDICTED: vacuolar protein sorting-associated protein 11 homolog [Glycine max] Back     alignment and taxonomy information
>gi|297831600|ref|XP_002883682.1| ATVPS11 [Arabidopsis lyrata subsp. lyrata] gi|297329522|gb|EFH59941.1| ATVPS11 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query823
TAIR|locus:2051254 932 VPS11 "AT2G05170" [Arabidopsis 0.989 0.873 0.760 0.0
ZFIN|ZDB-GENE-050731-5927 vps11 "vacuolar protein sortin 0.462 0.411 0.458 6.3e-146
RGD|1308038949 Vps11 "vacuolar protein sortin 0.399 0.346 0.495 6.3e-146
DICTYBASE|DDB_G0278141 952 vps11 "7-fold repeat in clathr 0.319 0.276 0.531 1.5e-144
UNIPROTKB|E1C7H8929 VPS11 "Uncharacterized protein 0.744 0.659 0.406 7.4e-137
UNIPROTKB|Q9H270941 VPS11 "Vacuolar protein sortin 0.685 0.599 0.432 1.7e-135
MGI|MGI:1918982941 Vps11 "vacuolar protein sortin 0.685 0.599 0.431 9.5e-135
UNIPROTKB|F1N5Q5941 VPS11 "Uncharacterized protein 0.685 0.599 0.431 1.2e-134
UNIPROTKB|E2RSE8941 VPS11 "Uncharacterized protein 0.685 0.599 0.431 1.6e-134
UNIPROTKB|F1SAH7942 VPS11 "Uncharacterized protein 0.685 0.598 0.427 3.7e-133
TAIR|locus:2051254 VPS11 "AT2G05170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3260 (1152.6 bits), Expect = 0., P = 0.
 Identities = 628/826 (76%), Positives = 700/826 (84%)

Query:     1 MYQWRKFDFFEEKYGGKSTIPEEVSGNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGF 60
             MYQ RKFDFFEEKYGGK  IPE+V+G+I CCSSGRGKVVIG +DG+VS LDRG+KF+ GF
Sbjct:     1 MYQLRKFDFFEEKYGGK--IPEDVTGDIQCCSSGRGKVVIGSNDGSVSFLDRGVKFDSGF 58

Query:    61 QAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCLKVFDLDKMEPEGTSSTSPDCIGI 120
             QAHSSSVLFLQ LKQRNFLVTVGEDEQ+S QQS +CLKVFDLDK++ EGTSS++P+CIGI
Sbjct:    59 QAHSSSVLFLQHLKQRNFLVTVGEDEQISPQQSGMCLKVFDLDKVQEEGTSSSAPECIGI 118

Query:   121 LRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQC 180
             LR+FT+QFPEAKITSFLVLEE PPILLIAIGLDNGCIYC+KGDIARERITRFKLQVD + 
Sbjct:   119 LRIFTNQFPEAKITSFLVLEEVPPILLIAIGLDNGCIYCVKGDIARERITRFKLQVDGRS 178

Query:   181 SVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSDRLELIIG 240
             ++ GLGFR+DGQAL LFAVTP SV LFS+Q QPPK Q LD+IG S N+V MSDR ELI+G
Sbjct:   179 AITGLGFRMDGQALLLFAVTPESVNLFSMQAQPPKLQTLDHIGGSVNTVTMSDRSELIVG 238

Query:   241 RPEAVYFYEVDGRGPCWAFEGEKKLLGWFRGYLLCVIADQRNSKNIFNVYDLKNRLIAHS 300
             RPEAVYFYEVDGRGPCWAFEGEKK +GWFRGYLLCVI D +    +FNVYDL+NRLIA+S
Sbjct:   239 RPEAVYFYEVDGRGPCWAFEGEKKFMGWFRGYLLCVIDDSKTGNTVFNVYDLRNRLIAYS 298

Query:   301 LVVKEVSHMLCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADA 360
             +VV +VS+MLCEWGNIIL+  DKS+LCI EKDMESKLDMLFKKNLYTVAINLVQSQ ADA
Sbjct:   299 IVVDKVSNMLCEWGNIILIKADKSLLCITEKDMESKLDMLFKKNLYTVAINLVQSQHADA 358

Query:   361 AATAEVLRKYGDHLYSKQDYDEAMSQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLH 420
             AATA V+RKYGDHLY KQD+DEAM QYI TIG+LEPS+VIQKFLDAQRIYNLTNYLEKLH
Sbjct:   359 AATANVMRKYGDHLYGKQDFDEAMLQYINTIGYLEPSFVIQKFLDAQRIYNLTNYLEKLH 418

Query:   421 EKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVETAIRVCRAANYHEHAM 480
             EKG ASKDHTTLLLNCYTKLKDVEKLN FI+ EDG+GE KFDVETAIRVCRAANYHEHAM
Sbjct:   419 EKGLASKDHTTLLLNCYTKLKDVEKLNTFIRKEDGIGELKFDVETAIRVCRAANYHEHAM 478

Query:   481 YVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHKPMETIDI 540
             YVAKKAGKHE YLKILLEDLG YDEALQY+SSL+PSQAGVT+++YGKILIEHKP ETIDI
Sbjct:   479 YVAKKAGKHEWYLKILLEDLGNYDEALQYVSSLEPSQAGVTIEQYGKILIEHKPKETIDI 538

Query:   541 LLRLCTEDGESTKRGASSSTYMSMLPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQV 600
             L+RLCTE      +G  +  ++SMLPSPVDF+ +FV HP SLM FLE+Y   V+DSPAQ 
Sbjct:   539 LMRLCTE------QGIPNGVFLSMLPSPVDFITVFVQHPHSLMHFLERYAEIVQDSPAQA 592

Query:   601 EIHNTLLELYLSYDLNFPSISQLNDGVDLRLRSGS---GLPKAEYNGEVTADGKDTYKGK 657
             EI+NTLLELYLS DLNFPSIS   +G+D  L   S    + KA+   +  AD KD  + K
Sbjct:   593 EINNTLLELYLSRDLNFPSISLSENGLDKDLIDHSVAAAVSKADPEKKTNADSKDAME-K 651

Query:   658 DVXXXXXXXXXXXXTAWPSELEHPLYDVDLAIILCEMNAFXXXXXXXXXXXXXXXXVIAC 717
             D              AWPS+LE PLYDVDLA+ILCEMN+F                VIAC
Sbjct:   652 DCTERQQKGLELLKMAWPSDLEQPLYDVDLAVILCEMNSFKDGLLYLYEKMKFYKEVIAC 711

Query:   718 YTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDCSKEVKEVLTYIERDDIL 777
             Y Q HDHEGLIACCKRLGDS KGGDPSLW DLLKYFGE+GEDC+KEVKEVLTYIERDDIL
Sbjct:   712 YMQNHDHEGLIACCKRLGDSSKGGDPSLWADLLKYFGEIGEDCTKEVKEVLTYIERDDIL 771

Query:   778 PPIVVLQTLSRNPCLTLSVIKDYIARKLEQESKLIEGDRRAIENYQ 823
             PPI+VLQTL++NPCLTLSVIKDYIARKLEQESK+IE DRRA+E YQ
Sbjct:   772 PPIIVLQTLAKNPCLTLSVIKDYIARKLEQESKIIEEDRRAVEKYQ 817
GO:0005215 "transporter activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0007033 "vacuole organization" evidence=TAS
GO:0009705 "plant-type vacuole membrane" evidence=IDA
GO:0006816 "calcium ion transport" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
ZFIN|ZDB-GENE-050731-5 vps11 "vacuolar protein sorting 11" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1308038 Vps11 "vacuolar protein sorting 11 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278141 vps11 "7-fold repeat in clathrin and VPS proteins repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7H8 VPS11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H270 VPS11 "Vacuolar protein sorting-associated protein 11 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1918982 Vps11 "vacuolar protein sorting 11 (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N5Q5 VPS11 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSE8 VPS11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAH7 VPS11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9H270VPS11_HUMANNo assigned EC number0.38310.91980.8044yesno
Q91W86VPS11_MOUSENo assigned EC number0.38780.91980.8044yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XIV.3743.1
hypothetical protein (948 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_LG_V001207
hypothetical protein (844 aa)
    • • 0.533
fgenesh4_pg.C_LG_II000545
hypothetical protein (844 aa)
    • • 0.526
estExt_Genewise1_v1.C_LG_XIII3472
hypothetical protein (737 aa)
    • • 0.472

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query823
pfam00637143 pfam00637, Clathrin, Region in Clathrin and VPS 1e-08
pfam00637143 pfam00637, Clathrin, Region in Clathrin and VPS 7e-04
>gnl|CDD|216037 pfam00637, Clathrin, Region in Clathrin and VPS Back     alignment and domain information 
 Score = 54.2 bits (131), Expect = 1e-08
 Identities = 34/144 (23%), Positives = 68/144 (47%), Gaps = 10/144 (6%)

Query: 394 LEPSYVIQKFLDAQRIYNLTNYLEKLHEKG-FASKDHTTLLLNCYTKLKDVEKLNMFIKG 452
           ++ S V++ F     +  L  YLE   ++    +    T LL  Y K +D EKL  F+K 
Sbjct: 8   IDISRVVKLFEKRGLLEELIPYLESALKENSRENPALQTALLELYAKYEDPEKLEEFLKK 67

Query: 453 EDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISS 512
            +      +D+E   ++C  A+ +E A+ + KK G ++  + +L + L  Y +A++Y   
Sbjct: 68  NN-----NYDLEKVAKLCEKADLYEEAVILYKKNGNYKEAISLLKK-LKLYKDAIEYAVK 121

Query: 513 LDPSQAGVTVKEYGKILIEHKPME 536
            +  +     ++    L+++   E
Sbjct: 122 SNDPE---LWEKLLNALLDNGRFE 142

Each region is about 140 amino acids long. The regions are composed of multiple alpha helical repeats. They occur in the arm region of the Clathrin heavy chain. Length = 143
>gnl|CDD|216037 pfam00637, Clathrin, Region in Clathrin and VPS Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 823
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 100.0
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 100.0
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 100.0
KOG2034 911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.94
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.92
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.91
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.91
KOG0315311 consensus G-protein beta subunit-like protein (con 99.91
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.9
KOG0315311 consensus G-protein beta subunit-like protein (con 99.89
KOG0263707 consensus Transcription initiation factor TFIID, s 99.87
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.87
KOG0295406 consensus WD40 repeat-containing protein [Function 99.87
KOG0286343 consensus G-protein beta subunit [General function 99.87
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.86
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.86
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.86
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.85
KOG0263707 consensus Transcription initiation factor TFIID, s 99.85
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.84
KOG0266456 consensus WD40 repeat-containing protein [General 99.83
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.83
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.82
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.81
KOG0293519 consensus WD40 repeat-containing protein [Function 99.81
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.81
KOG0266456 consensus WD40 repeat-containing protein [General 99.8
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.8
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.8
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.79
KOG0294362 consensus WD40 repeat-containing protein [Function 99.79
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.79
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.79
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.79
KOG0286343 consensus G-protein beta subunit [General function 99.79
PTZ00420568 coronin; Provisional 99.78
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.78
KOG0283712 consensus WD40 repeat-containing protein [Function 99.78
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.78
PLN00181793 protein SPA1-RELATED; Provisional 99.77
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.77
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.77
KOG0645312 consensus WD40 repeat protein [General function pr 99.77
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.76
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.76
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.76
PLN00181793 protein SPA1-RELATED; Provisional 99.76
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.76
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.75
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.75
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.75
PTZ00421493 coronin; Provisional 99.75
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.74
PTZ00421493 coronin; Provisional 99.72
KOG0772641 consensus Uncharacterized conserved protein, conta 99.72
KOG0295406 consensus WD40 repeat-containing protein [Function 99.72
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.72
KOG0645312 consensus WD40 repeat protein [General function pr 99.72
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.72
smart00299140 CLH Clathrin heavy chain repeat homology. 99.72
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.71
KOG0289506 consensus mRNA splicing factor [General function p 99.71
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.7
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.69
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.69
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.68
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.68
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.68
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.67
KOG0301745 consensus Phospholipase A2-activating protein (con 99.67
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.67
KOG0296399 consensus Angio-associated migratory cell protein 99.67
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.66
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.66
PTZ00420568 coronin; Provisional 99.66
KOG0294362 consensus WD40 repeat-containing protein [Function 99.66
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.65
KOG0296399 consensus Angio-associated migratory cell protein 99.65
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.65
KOG0289506 consensus mRNA splicing factor [General function p 99.64
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.64
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.63
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.62
KOG2096420 consensus WD40 repeat protein [General function pr 99.61
KOG0283712 consensus WD40 repeat-containing protein [Function 99.61
KOG0772641 consensus Uncharacterized conserved protein, conta 99.61
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.61
KOG0643327 consensus Translation initiation factor 3, subunit 99.6
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.6
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.59
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.59
KOG1273405 consensus WD40 repeat protein [General function pr 99.59
KOG1274 933 consensus WD40 repeat protein [General function pr 99.59
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.58
KOG0301745 consensus Phospholipase A2-activating protein (con 99.58
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.57
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.57
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.57
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.56
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.56
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.56
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.55
KOG1539910 consensus WD repeat protein [General function pred 99.55
KOG0270463 consensus WD40 repeat-containing protein [Function 99.55
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.53
KOG0293519 consensus WD40 repeat-containing protein [Function 99.53
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.53
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.53
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.53
KOG0300481 consensus WD40 repeat-containing protein [Function 99.52
KOG0269839 consensus WD40 repeat-containing protein [Function 99.51
KOG0269839 consensus WD40 repeat-containing protein [Function 99.5
KOG0646476 consensus WD40 repeat protein [General function pr 99.5
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.49
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.49
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.49
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.49
KOG1274933 consensus WD40 repeat protein [General function pr 99.48
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.47
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.47
KOG0646476 consensus WD40 repeat protein [General function pr 99.46
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 99.45
KOG0643327 consensus Translation initiation factor 3, subunit 99.44
KOG2096420 consensus WD40 repeat protein [General function pr 99.44
KOG2048691 consensus WD40 repeat protein [General function pr 99.43
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.42
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.42
KOG2055514 consensus WD40 repeat protein [General function pr 99.42
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.41
KOG1539910 consensus WD repeat protein [General function pred 99.41
KOG0302440 consensus Ribosome Assembly protein [General funct 99.41
KOG0302440 consensus Ribosome Assembly protein [General funct 99.41
KOG0641350 consensus WD40 repeat protein [General function pr 99.39
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.38
KOG0267825 consensus Microtubule severing protein katanin p80 99.36
KOG0270463 consensus WD40 repeat-containing protein [Function 99.36
KOG2055514 consensus WD40 repeat protein [General function pr 99.36
KOG4283397 consensus Transcription-coupled repair protein CSA 99.35
KOG0641350 consensus WD40 repeat protein [General function pr 99.35
KOG0267825 consensus Microtubule severing protein katanin p80 99.35
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.35
KOG2106626 consensus Uncharacterized conserved protein, conta 99.34
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.34
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.34
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.34
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.32
KOG0300481 consensus WD40 repeat-containing protein [Function 99.32
KOG4328498 consensus WD40 protein [Function unknown] 99.3
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.3
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 99.3
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.29
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.29
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.29
KOG2048691 consensus WD40 repeat protein [General function pr 99.28
KOG0639705 consensus Transducin-like enhancer of split protei 99.26
PRK01742429 tolB translocation protein TolB; Provisional 99.25
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.25
KOG0639705 consensus Transducin-like enhancer of split protei 99.24
KOG1188376 consensus WD40 repeat protein [General function pr 99.24
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.21
KOG0771398 consensus Prolactin regulatory element-binding pro 99.21
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.19
KOG4283397 consensus Transcription-coupled repair protein CSA 99.17
KOG0649325 consensus WD40 repeat protein [General function pr 99.17
KOG2106626 consensus Uncharacterized conserved protein, conta 99.17
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.16
smart00299140 CLH Clathrin heavy chain repeat homology. 99.16
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.15
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.14
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.14
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.12
KOG0303472 consensus Actin-binding protein Coronin, contains 99.1
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.08
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.08
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.08
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 99.07
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 99.06
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.03
KOG2110391 consensus Uncharacterized conserved protein, conta 99.02
KOG1273405 consensus WD40 repeat protein [General function pr 99.02
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.02
KOG0303472 consensus Actin-binding protein Coronin, contains 99.01
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.0
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.0
KOG20411189 consensus WD40 repeat protein [General function pr 98.98
PRK02889427 tolB translocation protein TolB; Provisional 98.97
KOG4328498 consensus WD40 protein [Function unknown] 98.97
KOG0649325 consensus WD40 repeat protein [General function pr 98.97
PRK11028330 6-phosphogluconolactonase; Provisional 98.96
PRK05137435 tolB translocation protein TolB; Provisional 98.96
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.95
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 98.94
KOG2139445 consensus WD40 repeat protein [General function pr 98.93
KOG3621726 consensus WD40 repeat-containing protein [General 98.93
PRK03629429 tolB translocation protein TolB; Provisional 98.93
KOG1963792 consensus WD40 repeat protein [General function pr 98.92
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 98.91
KOG1063764 consensus RNA polymerase II elongator complex, sub 98.91
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.91
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.9
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.89
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 98.89
PRK11028330 6-phosphogluconolactonase; Provisional 98.89
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.86
KOG2111346 consensus Uncharacterized conserved protein, conta 98.86
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.85
KOG2110391 consensus Uncharacterized conserved protein, conta 98.84
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 98.83
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 98.83
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.82
PRK04922433 tolB translocation protein TolB; Provisional 98.82
KOG1963792 consensus WD40 repeat protein [General function pr 98.81
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.79
KOG2321703 consensus WD40 repeat protein [General function pr 98.78
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 98.78
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.78
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.76
KOG1310758 consensus WD40 repeat protein [General function pr 98.76
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.71
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.7
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.7
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 98.69
COG2319466 FOG: WD40 repeat [General function prediction only 98.69
COG2319466 FOG: WD40 repeat [General function prediction only 98.68
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.68
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 98.67
KOG4227609 consensus WD40 repeat protein [General function pr 98.67
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.66
KOG2139445 consensus WD40 repeat protein [General function pr 98.63
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 98.6
PRK00178430 tolB translocation protein TolB; Provisional 98.6
KOG4227609 consensus WD40 repeat protein [General function pr 98.59
PRK04792448 tolB translocation protein TolB; Provisional 98.58
PRK01742429 tolB translocation protein TolB; Provisional 98.58
KOG2111346 consensus Uncharacterized conserved protein, conta 98.55
PRK05137435 tolB translocation protein TolB; Provisional 98.55
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.52
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.51
PRK04922433 tolB translocation protein TolB; Provisional 98.5
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.5
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.49
PRK03629429 tolB translocation protein TolB; Provisional 98.49
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.45
PRK02889427 tolB translocation protein TolB; Provisional 98.41
KOG1334559 consensus WD40 repeat protein [General function pr 98.38
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.37
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.35
KOG2315566 consensus Predicted translation initiation factor 98.35
KOG1310758 consensus WD40 repeat protein [General function pr 98.35
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.34
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.33
PF05131147 Pep3_Vps18: Pep3/Vps18/deep orange family; InterPr 98.32
PRK01029428 tolB translocation protein TolB; Provisional 98.31
KOG1188376 consensus WD40 repeat protein [General function pr 98.3
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.29
KOG2315566 consensus Predicted translation initiation factor 98.28
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.26
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.24
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.22
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.22
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.21
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.18
KOG4547541 consensus WD40 repeat-containing protein [General 98.18
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.13
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.12
PRK01029428 tolB translocation protein TolB; Provisional 98.11
KOG2321703 consensus WD40 repeat protein [General function pr 98.1
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.08
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.08
PRK00178430 tolB translocation protein TolB; Provisional 98.04
KOG4547541 consensus WD40 repeat-containing protein [General 98.04
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.03
KOG0771398 consensus Prolactin regulatory element-binding pro 98.01
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.01
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.98
PRK04792448 tolB translocation protein TolB; Provisional 97.96
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.95
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.9
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.89
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.89
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.82
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.8
PRK04043419 tolB translocation protein TolB; Provisional 97.79
PLN03077 857 Protein ECB2; Provisional 97.78
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.76
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.76
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.74
PLN03218 1060 maturation of RBCL 1; Provisional 97.74
KOG1409404 consensus Uncharacterized conserved protein, conta 97.69
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.67
COG4946668 Uncharacterized protein related to the periplasmic 97.67
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.66
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.66
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 97.66
PLN03218 1060 maturation of RBCL 1; Provisional 97.65
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.64
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.62
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.62
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.61
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.58
KOG2314698 consensus Translation initiation factor 3, subunit 97.55
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 97.54
KOG1409404 consensus Uncharacterized conserved protein, conta 97.53
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.52
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.51
PLN03077857 Protein ECB2; Provisional 97.47
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.46
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.44
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.43
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.4
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.39
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.39
KOG1334559 consensus WD40 repeat protein [General function pr 97.34
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.32
PRK04043419 tolB translocation protein TolB; Provisional 97.28
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.22
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.2
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.18
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.14
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.12
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.09
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.08
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 97.07
PF1383866 Clathrin_H_link: Clathrin-H-link; PDB: 2XZG_A 3GD1 97.07
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.97
COG4946668 Uncharacterized protein related to the periplasmic 96.85
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.84
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.83
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 96.81
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.79
KOG4714319 consensus Nucleoporin [Nuclear structure] 96.7
KOG4532344 consensus WD40-like repeat containing protein [Gen 96.68
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.67
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 96.65
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.65
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.58
KOG19121062 consensus WD40 repeat protein [General function pr 96.57
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.57
PRK10747398 putative protoheme IX biogenesis protein; Provisio 96.46
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.45
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 96.44
KOG2695425 consensus WD40 repeat protein [General function pr 96.44
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.36
KOG2695425 consensus WD40 repeat protein [General function pr 96.36
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 96.29
KOG1912 1062 consensus WD40 repeat protein [General function pr 96.2
KOG0280339 consensus Uncharacterized conserved protein [Amino 96.02
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 95.85
KOG2395644 consensus Protein involved in vacuole import and d 95.82
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 95.82
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 95.79
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 95.77
PRK11788389 tetratricopeptide repeat protein; Provisional 95.76
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.73
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 95.69
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 95.69
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.64
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.48
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 95.34
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.3
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.27
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.25
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 95.25
KOG3621726 consensus WD40 repeat-containing protein [General 95.13
KOG2314698 consensus Translation initiation factor 3, subunit 94.95
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 94.91
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.69
KOG2034 911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.66
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.61
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 94.49
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 94.42
PRK14720 906 transcript cleavage factor/unknown domain fusion p 94.39
KOG3785557 consensus Uncharacterized conserved protein [Funct 94.31
PRK11788389 tetratricopeptide repeat protein; Provisional 94.27
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.19
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 94.17
KOG2076 895 consensus RNA polymerase III transcription factor 94.14
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 93.82
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 93.82
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 93.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 93.68
COG3386307 Gluconolactonase [Carbohydrate transport and metab 93.64
COG3490366 Uncharacterized protein conserved in bacteria [Fun 93.6
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 93.42
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.38
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 93.38
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 93.02
PF15390671 DUF4613: Domain of unknown function (DUF4613) 92.85
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 92.63
KOG1008783 consensus Uncharacterized conserved protein, conta 92.51
COG0823425 TolB Periplasmic component of the Tol biopolymer t 92.45
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 92.41
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 92.37
KOG3616 1636 consensus Selective LIM binding factor [Transcript 92.27
smart0032040 WD40 WD40 repeats. Note that these repeats are per 92.02
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 91.49
KOG2395644 consensus Protein involved in vacuole import and d 91.36
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 91.34
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 91.26
KOG18971096 consensus Damage-specific DNA binding complex, sub 91.24
PF1234127 DUF3639: Protein of unknown function (DUF3639) ; I 91.13
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 90.79
KOG2076 895 consensus RNA polymerase III transcription factor 90.67
COG3386307 Gluconolactonase [Carbohydrate transport and metab 90.5
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 90.44
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 90.13
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 90.09
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 89.99
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 89.96
PRK13616591 lipoprotein LpqB; Provisional 89.75
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 89.48
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 89.37
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 89.27
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 87.92
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 87.83
PRK15174656 Vi polysaccharide export protein VexE; Provisional 87.78
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 86.97
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 86.97
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 86.8
PF15390671 DUF4613: Domain of unknown function (DUF4613) 86.7
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 86.21
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 86.1
PF14727418 PHTB1_N: PTHB1 N-terminus 85.98
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 85.83
COG54221175 ROM1 RhoGEF, Guanine nucleotide exchange factor fo 84.68
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 84.38
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 84.27
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 84.17
PRK13616591 lipoprotein LpqB; Provisional 83.98
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 83.53
COG5167776 VID27 Protein involved in vacuole import and degra 83.38
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 83.36
KOG2377657 consensus Uncharacterized conserved protein [Funct 83.35
PF1337173 TPR_9: Tetratricopeptide repeat 83.12
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 82.82
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 82.67
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 82.17
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 82.14
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 81.78
PLN00033398 photosystem II stability/assembly factor; Provisio 81.52
KOG2377657 consensus Uncharacterized conserved protein [Funct 81.07
KOG4340459 consensus Uncharacterized conserved protein [Funct 80.91
KOG2003840 consensus TPR repeat-containing protein [General f 80.76
PRK02888635 nitrous-oxide reductase; Validated 80.66
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 80.35
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 80.29
PRK13684334 Ycf48-like protein; Provisional 80.17
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=2.7e-117  Score=970.34  Aligned_cols=790  Identities=46%  Similarity=0.709  Sum_probs=669.3

Q ss_pred             CCCceeecccccccCCCCCCCCcCCCCeEEEeeCCCEEEEEecCCeEEEEcCCCeeeEeEeecccc-eeEEEEecCCCEE
Q 037368            1 MYQWRKFDFFEEKYGGKSTIPEEVSGNITCCSSGRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSS-VLFLQQLKQRNFL   79 (823)
Q Consensus         1 ~~~w~~f~ff~~~~~~~~~~~~~~~~~is~~~~~~~~l~~gs~dG~i~~~d~~~~~~~~~~~H~~~-V~~i~~~~~~~~l   79 (823)
                      |.+||||+|||+..+.++  +-+.++.|+|+.++.+.+|+||.+|.|.++++..+.++.|++|..+ |+.+....+.++|
T Consensus         3 l~qWrrF~lFq~~~i~~~--~~~~G~~isc~~s~~~~vvigt~~G~V~~Ln~s~~~~~~fqa~~~siv~~L~~~~~~~~L   80 (933)
T KOG2114|consen    3 LKQWRRFSLFQWKEIPSL--ENFVGNAISCCSSSTGSVVIGTADGRVVILNSSFQLIRGFQAYEQSIVQFLYILNKQNFL   80 (933)
T ss_pred             hhhcceeeeeeeeecCCc--ccCCCCceeEEcCCCceEEEeeccccEEEecccceeeehheecchhhhhHhhcccCceEE
Confidence            579999999999998753  2233458999999999999999999999999999998999999877 8888887777899


Q ss_pred             EEEecCCCCcccccceeEEEEeCCCCCCCCCCCCCCceEEEEEeccCCCC--CCceEEEEEecCCCCcceEEEEEeCCeE
Q 037368           80 VTVGEDEQVSAQQSAVCLKVFDLDKMEPEGTSSTSPDCIGILRVFTSQFP--EAKITSFLVLEEAPPILLIAIGLDNGCI  157 (823)
Q Consensus        80 ~s~s~D~~~~~~~~~~~vkvWdl~~~~~~~~~~~~~~~~~~~~~~~~~~p--~~~v~~va~~~d~~~~~~ia~G~~dG~V  157 (823)
                      +|+|+|++|.|++    ||||++++.++    +.+|+|+++.+++...+|  ...++++++|.+.+.   +|+|+.||.|
T Consensus        81 ~sv~Ed~~~np~l----lkiw~lek~~~----n~sP~c~~~~ri~~~~np~~~~p~s~l~Vs~~l~~---Iv~Gf~nG~V  149 (933)
T KOG2114|consen   81 FSVGEDEQGNPVL----LKIWDLEKVDK----NNSPQCLYEHRIFTIKNPTNPSPASSLAVSEDLKT---IVCGFTNGLV  149 (933)
T ss_pred             EEEeecCCCCceE----EEEecccccCC----CCCcceeeeeeeeccCCCCCCCcceEEEEEccccE---EEEEecCcEE
Confidence            9999999873336    99999998652    334999977777643333  133999999999777   9999999999


Q ss_pred             EEEEcccccccccceeEEecCCCCcceEEEeecCCeEEEEEEcCCeEEEEEecCCCCcceEEccCCCccceecccC-CCe
Q 037368          158 YCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSD-RLE  236 (823)
Q Consensus       158 ~l~~~~~~~~~~~k~~~~~~~~~~It~l~fs~dg~~~~l~~~t~~~V~~~d~~~~~~~~~~l~~~~~~~~~~~~s~-~~~  236 (823)
                      .+++||++|+|+.|.+..+.+++|||||+|..+++ ..+|++|..+|.+|.+.+++....+++++|..++|+++++ .++
T Consensus       150 ~~~~GDi~RDrgsr~~~~~~~~~pITgL~~~~d~~-s~lFv~Tt~~V~~y~l~gr~p~~~~ld~~G~~lnCss~~~~t~q  228 (933)
T KOG2114|consen  150 ICYKGDILRDRGSRQDYSHRGKEPITGLALRSDGK-SVLFVATTEQVMLYSLSGRTPSLKVLDNNGISLNCSSFSDGTYQ  228 (933)
T ss_pred             EEEcCcchhccccceeeeccCCCCceeeEEecCCc-eeEEEEecceeEEEEecCCCcceeeeccCCccceeeecCCCCcc
Confidence            99999999999999888888899999999999996 3599999999999999987744556899999999999997 456


Q ss_pred             EEEeeCCeEEEEecCCCCcccccc-CCeEEEEeeC-cEEEEEEecCC---------CCccEEEEEeCCCCEEEEeccccc
Q 037368          237 LIIGRPEAVYFYEVDGRGPCWAFE-GEKKLLGWFR-GYLLCVIADQR---------NSKNIFNVYDLKNRLIAHSLVVKE  305 (823)
Q Consensus       237 liv~~~~~I~i~~~~g~~~~~~~~-g~~~~i~~~~-~ylv~~s~d~~---------~~~~~I~I~D~~~~~i~~~~~i~~  305 (823)
                      |++++++.+++|+++|+++|++|+ |++..+.|++ .|+++++++..         +....+.++|+.++.++++..+.+
T Consensus       229 fIca~~e~l~fY~sd~~~~cfaf~~g~kk~~~~~~~g~~L~v~~~~~~~~~s~s~ss~~~i~~~~d~~n~~v~ys~vl~~  308 (933)
T KOG2114|consen  229 FICAGSEFLYFYDSDGRGPCFAFEVGEKKEMLVFSFGLLLCVTTDKGTENTSLSNSSSNRIFKAYDLRNRYVLYSSVLED  308 (933)
T ss_pred             EEEecCceEEEEcCCCcceeeeecCCCeEEEEEEecCEEEEEEccCCCCCcccCccchhheeehhhhcCcccchHHhHHH
Confidence            999999999999999999999999 9988888877 88888876532         124567888999999999988888


Q ss_pred             eeEEEeecC-cEEEEEcCCeEEEEeecChHHHHHHHHHhccHHHHHHHHHhcCCCHHHHHHHHHHHhhhhccCCCHHHHH
Q 037368          306 VSHMLCEWG-NIILVMTDKSVLCIGEKDMESKLDMLFKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAM  384 (823)
Q Consensus       306 v~~v~~~~~-~~~vvs~~~~v~~l~~~~~~~~i~~L~~~~~f~~Al~la~~~~~~~~~~~~I~~~y~d~L~~k~~y~~A~  384 (823)
                      +..++..|+ .+|+++++|.+.+|.|++++.++++|++|++|+.|+.||+..+++++.+.+|+++||||||.||+|++|+
T Consensus       309 l~d~l~~w~~~~~vltsdg~~~~L~ek~le~kL~iL~kK~ly~~Ai~LAk~~~~d~d~~~~i~~kYgd~Ly~Kgdf~~A~  388 (933)
T KOG2114|consen  309 LSDNLIEWSFDCLVLTSDGVVHELIEKDLETKLDILFKKNLYKVAINLAKSQHLDEDTLAEIHRKYGDYLYGKGDFDEAT  388 (933)
T ss_pred             HHHHHHhcCCcEEEEecCCceeeeeeccHHHHHHHHHHhhhHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHhcCCHHHHH
Confidence            777788899 8999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhCCcChHHHHHHhhchhhHHHHHHHHHHHHHcCCCChhHHHHHHHHHHhcCChhhHHHhhcCCCCCCcccCCHH
Q 037368          385 SQYILTIGHLEPSYVIQKFLDAQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFIKGEDGVGEHKFDVE  464 (823)
Q Consensus       385 ~~y~~ti~~~eps~vI~kFl~~~~~~~L~~YL~~l~~~~~~~~~~~~lLl~~y~kl~~~~~l~~fi~~~~~~~~~~~d~~  464 (823)
                      ++||+|||.+|||+||.||+|+++|++|+.||++||++++|+++|+++||+||+|++|.++|.+||+..+ .|++.||++
T Consensus       389 ~qYI~tI~~le~s~Vi~kfLdaq~IknLt~YLe~L~~~gla~~dhttlLLncYiKlkd~~kL~efI~~~~-~g~~~fd~e  467 (933)
T KOG2114|consen  389 DQYIETIGFLEPSEVIKKFLDAQRIKNLTSYLEALHKKGLANSDHTTLLLNCYIKLKDVEKLTEFISKCD-KGEWFFDVE  467 (933)
T ss_pred             HHHHHHcccCChHHHHHHhcCHHHHHHHHHHHHHHHHcccccchhHHHHHHHHHHhcchHHHHHHHhcCC-CcceeeeHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999876 577789999


Q ss_pred             HHHHHHHhcCCHHHHHHHHHHhCChHHHHHHHHHhhcCHHHHHHHHhcCChHHHHHHHHHHHHHHHhcCCHHHHHHHHHH
Q 037368          465 TAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILIEHKPMETIDILLRL  544 (823)
Q Consensus       465 ~ai~vl~~~g~~~~a~~la~~~~~~~~~l~il~~~~~~~~~al~yl~~l~~~~~~~~i~k~~~~Ll~~~p~~~~~ll~~~  544 (823)
                      +|+++||+++++++|.+||.+++.|++|+++++++.++|++|++|+++++++++.+.+.+||++||.+.|++|+++|++.
T Consensus       468 ~al~Ilr~snyl~~a~~LA~k~~~he~vl~ille~~~ny~eAl~yi~slp~~e~l~~l~kyGk~Ll~h~P~~t~~ili~~  547 (933)
T KOG2114|consen  468 TALEILRKSNYLDEAELLATKFKKHEWVLDILLEDLHNYEEALRYISSLPISELLRTLNKYGKILLEHDPEETMKILIEL  547 (933)
T ss_pred             HHHHHHHHhChHHHHHHHHHHhccCHHHHHHHHHHhcCHHHHHHHHhcCCHHHHHHHHHHHHHHHHhhChHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCcccCCCCCcccCCCCCHHHHHhhhccCcHHHHHHHHHHHhhcCCCCchhhHHHHHHHHhccccccCCcccccC
Q 037368          545 CTEDGESTKRGASSSTYMSMLPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLN  624 (823)
Q Consensus       545 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~yLe~~i~~~~~~~~~~~~~n~llelyl~~~~~~~~~~~~~  624 (823)
                      |++..++...     ......+++.+++.+|..+|+.+..||+++.+..+++++...+..++.++++.... ....+   
T Consensus       548 ~t~~~~~~~~-----~~~s~~~~~~~~i~if~~~~~~~~~Fl~~~~E~s~~s~e~~~i~~t~~~~~l~~~s-f~~~~---  618 (933)
T KOG2114|consen  548 ITELNSQGKG-----KSLSNIPDSIEFIGIFSQNYQILLNFLESMSEISPDSEEVLEIIYTLLELSLMQKS-FVTKP---  618 (933)
T ss_pred             HhhcCCCCCC-----chhhcCccchhheeeeccCHHHHHHHHHHHHhcCCCchhhhccccchhhhhhhhcc-ccccc---
Confidence            9986543221     11234557889999999999999999999888877766556788889999886510 11000   


Q ss_pred             cccccccccCCCCCC-cccCCccccCCCCC--CC-----CcchHHHHHHHHHHHhhcCCCCCCCCCCChhhHHHHHHhcC
Q 037368          625 DGVDLRLRSGSGLPK-AEYNGEVTADGKDT--YK-----GKDVLERREKGLRLLKTAWPSELEHPLYDVDLAIILCEMNA  696 (823)
Q Consensus       625 ~~~~~~~~~~~~~~~-~~~~g~~~~~~~~~--~~-----~~~~~~~~~kll~~L~~~~~~~~~~~~Yd~~~aL~lc~~~~  696 (823)
                        -+.+. . ++... .++.| -.+|+..+  ..     +-..++..++-.-+++.++..+.....||.+.||.+|++.+
T Consensus       619 --~~~n~-~-~~l~h~~~~~~-~~sdpq~kt~~~~~l~~~~~~~~~~~~~~~l~ksn~l~d~~~~nvd~d~al~l~qm~d  693 (933)
T KOG2114|consen  619 --FEFNL-E-AELAHYQQYEG-FDSDPQVKTTTLYDLYLELDAEDVPERTIILRKSNKLLDYAASNVDEDAALLLSQMSD  693 (933)
T ss_pred             --hhhcc-H-HHHHHHHhhcc-cccChhhhhccchhhHHHHHhhhcccccchhhhhcchhhhhhccccchHHHHHHHHhC
Confidence              00000 0 00000 00000 00110000  00     00000111111222222212222345699999999999999


Q ss_pred             CchhHHHHHHHhccHHHHHHHHHhcCChhHHHHHHHHhCCCCCCCCcchHHHHHHHhccCC--CCCHHHHHHHHHHHHhC
Q 037368          697 FKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELG--EDCSKEVKEVLTYIERD  774 (823)
Q Consensus       697 ~~~~~v~L~~k~g~~~~al~~~~~~~d~~~~i~~~~~~~~~~~~~~~~Lw~~ll~~~~~~~--~~~~~~i~~~L~~i~~~  774 (823)
                      |.+|..|+|++++.+.+.+.+++...|+++++..|+.+|..    +|+||..+|+||++..  +++.+.+.+||+.|+..
T Consensus       694 f~dg~ly~~~k~k~~~dl~~~~~q~~d~E~~it~~~~~g~~----~p~l~~~~L~yF~~~~~i~~~~~~v~~vl~~I~~~  769 (933)
T KOG2114|consen  694 FTDGLLYSYEKLKEGQDLMLYFQQISDPETVITLCERLGKE----DPSLWLHALKYFVSEESIEDCYEIVYKVLEAIEMQ  769 (933)
T ss_pred             CCchHHHHHhhccchHHHHHHHHHhhChHHHHHHHHHhCcc----ChHHHHHHHHHHhhhcchhhHHHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999987    9999999999999988  55667889999999999


Q ss_pred             CCCChHHHHHHhcCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHhhhC
Q 037368          775 DILPPIVVLQTLSRNPCLTLSVIKDYIARKLEQESKLIEGDRRAIENYQ  823 (823)
Q Consensus       775 ~~l~p~~vl~~l~~~~~~~~~~vk~~l~~~l~~~~~~i~~~~~~i~~~~  823 (823)
                      ++|||+.||++|+||.+++++.|||||+++|++++++|++++++|+.|+
T Consensus       770 ~~ippl~VL~~Lakn~~ltls~IkD~ii~~l~~~~~~I~qd~~~Ie~yk  818 (933)
T KOG2114|consen  770 ERIPPLHVLQILAKNGTLTLSVIKDYIIKWLNKYSTIIEQDEDAIEVYK  818 (933)
T ss_pred             ccCCHHHHHHHHhcCCceEEehhHHHHHHHHHhhhHHHHhhHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999984

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF05131 Pep3_Vps18: Pep3/Vps18/deep orange family; InterPro: IPR007810 This region is found in a number of proteins identified as being involved in Golgi function and vacuolar sorting Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13838 Clathrin_H_link: Clathrin-H-link; PDB: 2XZG_A 3GD1_I 1BPO_C 1C9I_B 1C9L_A Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG5422 ROM1 RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query823
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 1e-16
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 7e-09
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 5e-04
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 4e-10
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 3e-05
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 4e-10
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 86.1 bits (212), Expect = 2e-17
 Identities = 75/606 (12%), Positives = 163/606 (26%), Gaps = 215/606 (35%)

Query: 34  GRGKVVIGCDDGAVSLLDRGLKFNFGFQAHSSSVLFLQQLKQRNFLVTVG---EDEQVSA 90
           G GK  +         L   ++    F+                F + +      E V  
Sbjct: 160 GSGKTWVA----LDVCLSYKVQCKMDFKI---------------FWLNLKNCNSPETVLE 200

Query: 91  QQSAVCLKVFDLDKMEPEGTSSTSPDCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAI 150
               +  +      ++P  TS +       LR+      +A++   L  +     LL+  
Sbjct: 201 MLQKLLYQ------IDPNWTSRSDHSSNIKLRI---HSIQAELRRLLKSKPYENCLLV-- 249

Query: 151 GLDNGCIYCIKGDIARERITR-FKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSL 209
            L          ++   +    F    +  C ++               +T         
Sbjct: 250 -LL---------NVQNAKAWNAF----NLSCKIL---------------LT--------- 271

Query: 210 QNQPPKRQFLDNIGCSTNSVAMSDRLELIIGRPEAVYFYEVDGRGPCWAFEGEKKLLGWF 269
                           T    ++D L        A     +             ++    
Sbjct: 272 ----------------TRFKQVTDFLS-------AATTTHISLDHHSMTLT-PDEVKSLL 307

Query: 270 RGYLLCVIADQRNSKNIFNVYDLKNRLIAHSLVVKEVSHMLCEWGNIILVMTDKSVLCIG 329
             YL C   D            L       S++ + +   L  W N   V  DK      
Sbjct: 308 LKYLDCRPQDLPREV-------LTTNPRRLSIIAESIRDGLATWDNWKHVNCDKL----- 355

Query: 330 EKDMESKLDML----FKKNLYTVAINLVQSQQADAAATAEVLRKYGDHLYSKQDYDEAMS 385
              +ES L++L    ++K    +++         A     +L      ++      + M 
Sbjct: 356 TTIIESSLNVLEPAEYRKMFDRLSV-----FPPSAHIPTILLSL----IWFDVIKSDVMV 406

Query: 386 ------QYILTIGHLEPSYVIQKFLDAQRIYNLTNYLE-KLHEKGFASKDHTTLLLNCYT 438
                 +Y L     + S +         I ++  YLE K+  +   +  H + +++ Y 
Sbjct: 407 VVNKLHKYSLVEKQPKESTI--------SIPSI--YLELKVKLENEYAL-HRS-IVDHYN 454

Query: 439 KLKDVEKLNMFIKGEDG-----VGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYL 493
             K  +  ++     D      +G                 +H   +   +   +  L+ 
Sbjct: 455 IPKTFDSDDLIPPYLDQYFYSHIG-----------------HH---LKNIEHPERMTLFR 494

Query: 494 KILLEDLGRYDEALQYISSLDPSQAGVT-----VKEYGKILIEHKPMETIDILLRLCTED 548
            + L D    ++ +++ S+   +   +      +K Y   + ++ P              
Sbjct: 495 MVFL-DFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDP-------------- 539

Query: 549 GESTKRGASSSTYMSMLPSPVDFLNIFVHHPESLMDFLEKYTNKVKDSPAQVEIHNTLLE 608
                       Y  ++               +++DFL K    +  S      +  LL 
Sbjct: 540 -----------KYERLV--------------NAILDFLPKIEENLICSK-----YTDLLR 569

Query: 609 LYLSYD 614
           + L  +
Sbjct: 570 IALMAE 575
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Length = 449 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query823
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.96
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.94
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.94
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.93
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.92
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.92
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.92
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.91
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.91
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.91
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.9
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.9
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.9
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.9
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.9
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.9
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.9
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.9
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.89
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.89
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.89
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.89
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.89
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.89
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.89
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.89
2pm7_B297 Protein transport protein SEC13, protein transport 99.89
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.89
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.89
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.89
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.88
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.88
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.88
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.88
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.88
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.88
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.88
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.88
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.88
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.87
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.87
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.87
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.87
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.87
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.87
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.86
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.86
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.86
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.86
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.85
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.85
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.85
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.85
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.85
2pm7_B297 Protein transport protein SEC13, protein transport 99.85
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.85
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.85
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.85
3jrp_A379 Fusion protein of protein transport protein SEC13 99.85
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.85
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.84
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.84
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.84
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.84
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.84
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.84
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.84
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.84
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.83
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.83
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.83
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.83
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.83
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.83
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.82
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.82
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.82
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.82
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.82
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.82
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.82
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.82
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.82
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.82
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.82
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.82
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.82
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.82
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.81
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.81
3jro_A753 Fusion protein of protein transport protein SEC13 99.81
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.81
3jrp_A379 Fusion protein of protein transport protein SEC13 99.81
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.8
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.8
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.8
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.8
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.79
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.79
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.79
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.79
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.78
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 99.78
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.78
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.77
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.76
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.76
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.76
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.76
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.75
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.75
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.74
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.74
3jro_A753 Fusion protein of protein transport protein SEC13 99.74
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.74
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.73
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.72
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.72
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.72
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.72
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.71
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.69
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.68
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.67
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.66
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.64
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.64
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.62
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.6
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.58
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.58
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.56
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.55
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.54
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.52
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.47
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.46
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.45
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.44
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.44
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.44
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.42
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.4
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.39
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.39
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.36
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.36
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.32
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.32
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.32
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.31
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.3
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.25
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.21
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.2
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.19
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.19
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.16
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.15
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.15
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.11
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.1
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.09
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 99.07
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.06
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.06
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.05
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.05
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.04
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.02
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.97
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.96
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.94
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.92
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.9
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.85
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 98.83
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.83
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.81
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.8
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.8
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.8
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.79
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.74
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.72
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.7
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.68
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.67
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.65
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.64
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.62
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.62
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.6
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 98.6
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.58
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.57
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.57
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.56
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.56
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.56
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.51
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.51
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.49
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.46
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.45
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.41
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.38
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.38
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.36
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.29
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.23
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.19
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.19
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.15
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.1
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.08
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.05
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.01
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.99
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.94
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.94
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.87
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.8
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.78
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.78
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.77
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.76
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.73
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.69
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.66
2ece_A462 462AA long hypothetical selenium-binding protein; 97.62
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.59
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.59
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.58
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.5
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.41
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.35
2qe8_A343 Uncharacterized protein; structural genomics, join 97.34
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 97.3
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.3
2qe8_A343 Uncharacterized protein; structural genomics, join 97.28
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.28
3v65_B386 Low-density lipoprotein receptor-related protein; 97.21
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.15
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.04
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.99
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 96.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.92
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.91
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.88
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.7
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 96.69
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.67
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.66
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.66
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.6
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.55
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.52
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.45
2ece_A462 462AA long hypothetical selenium-binding protein; 96.39
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 96.29
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.16
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.13
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.03
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.02
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.01
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 95.94
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.93
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.88
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 95.82
3qil_A125 Clathrin heavy chain 1; clathrin trimerization dom 95.79
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.78
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.76
3v65_B386 Low-density lipoprotein receptor-related protein; 95.67
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.66
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.64
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 95.64
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 95.57
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.56
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 95.42
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 95.4
2gw1_A514 Mitochondrial precursor proteins import receptor; 95.39
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.31
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 95.3
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.26
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 95.22
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 95.2
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 95.2
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.13
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 95.01
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 94.91
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 94.91
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.83
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 94.72
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 94.71
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 94.68
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 94.67
3ott_A758 Two-component system sensor histidine kinase; beta 94.65
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 94.64
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 94.44
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 94.43
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 94.34
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.32
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.3
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 94.07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 93.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 93.9
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 93.74
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 93.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 93.63
4eqf_A365 PEX5-related protein; accessory protein, tetratric 93.62
3ott_A758 Two-component system sensor histidine kinase; beta 93.56
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 93.49
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 93.48
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 93.22
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 93.2
3p5b_L400 Low density lipoprotein receptor variant; B-propel 92.81
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 92.74
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 92.71
4eqf_A365 PEX5-related protein; accessory protein, tetratric 92.65
2p4o_A306 Hypothetical protein; putative lactonase, structur 92.64
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 92.43
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 92.38
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.38
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 91.98
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 91.89
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 91.77
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 91.63
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 91.5
3q15_A378 PSP28, response regulator aspartate phosphatase H; 91.48
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 90.94
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 90.8
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 90.42
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 90.3
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 90.23
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 90.14
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 89.94
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 89.86
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 89.63
3q15_A378 PSP28, response regulator aspartate phosphatase H; 89.14
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 89.02
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 88.93
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 88.7
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 88.64
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 88.51
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 88.07
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 87.5
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 87.43
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 87.29
3u4t_A272 TPR repeat-containing protein; structural genomics 87.13
3kya_A496 Putative phosphatase; structural genomics, joint c 87.09
3u3w_A293 Transcriptional activator PLCR protein; ternary co 86.92
3kya_A496 Putative phosphatase; structural genomics, joint c 86.29
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 85.77
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 85.67
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 85.56
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 85.54
2gw1_A514 Mitochondrial precursor proteins import receptor; 85.31
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 85.12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 84.69
3u4t_A272 TPR repeat-containing protein; structural genomics 84.33
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 84.32
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 83.9
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 83.67
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 83.23
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 82.51
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 81.82
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 81.46
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 80.75
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 80.61
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 80.55
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 80.53
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 80.2
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 80.08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 80.03
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
Probab=99.96  E-value=1.8e-26  Score=276.94  Aligned_cols=537  Identities=16%  Similarity=0.202  Sum_probs=392.7

Q ss_pred             EEEEEecCCCCcceEEEEEeCCeEEEEEcccccccccceeEEecCCCCcceEEEeecCCeEEEEEEcCCeEEEEEecCCC
Q 037368          134 TSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVDNQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQP  213 (823)
Q Consensus       134 ~~va~~~d~~~~~~ia~G~~dG~V~l~~~~~~~~~~~k~~~~~~~~~~It~l~fs~dg~~~~l~~~t~~~V~~~d~~~~~  213 (823)
                      -+.-.+|....   ||.-. +.++.+++.+.    ..|.+. +.-+++|.-  |.|-.. ..|..+|++.|+.|++.+..
T Consensus        69 dsAIMnP~~~i---iALra-g~~lQiFnl~~----k~klks-~~~~e~Vvf--WkWis~-~~l~lVT~~aVyHW~~~~~s  136 (1630)
T 1xi4_A           69 DSAIMNPASKV---IALKA-GKTLQIFNIEM----KSKMKA-HTMTDDVTF--WKWISL-NTVALVTDNAVYHWSMEGES  136 (1630)
T ss_pred             hhhccCCCcce---EEEec-CCeEEEeehHH----hhhhcc-cccCCCceE--EEecCC-CeeEEEcCCeEEEeccCCCC
Confidence            33445787666   77664 67888998642    112221 222567775  444432 47888999999999998766


Q ss_pred             CcceEEccCCCccceec----ccCCCe-EE-Eee-------CCeEEEEecCCCCccccccCC--------------eEEE
Q 037368          214 PKRQFLDNIGCSTNSVA----MSDRLE-LI-IGR-------PEAVYFYEVDGRGPCWAFEGE--------------KKLL  266 (823)
Q Consensus       214 ~~~~~l~~~~~~~~~~~----~s~~~~-li-v~~-------~~~I~i~~~~g~~~~~~~~g~--------------~~~i  266 (823)
                      .|.++++.|+.-.+|-.    .+++.+ ++ +|-       .|.+.+|+++ ++.+..++||              +..+
T Consensus       137 ~P~k~fdR~~~L~~~QIinY~~d~~~kW~~l~gi~~~~~~v~G~mQLyS~e-r~~sQ~iegha~~F~~~~~~~~~~~~~l  215 (1630)
T 1xi4_A          137 QPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVD-RKVSQPIEGHAASFAQFKMEGNAEESTL  215 (1630)
T ss_pred             ccHHHHhcchhcccCeeEEeeeCCCCCeEEEEeeccCCCcccceeeeeecc-cccchhhhHhHhhhheeccCCCCCCceE
Confidence            78888887754433322    235554 32 331       2678899877 3322222222              1111


Q ss_pred             ---Eee---Cc--EEEEEEec--CC------------------------------------CCccEEEEEeCCCCEEEEe
Q 037368          267 ---GWF---RG--YLLCVIAD--QR------------------------------------NSKNIFNVYDLKNRLIAHS  300 (823)
Q Consensus       267 ---~~~---~~--ylv~~s~d--~~------------------------------------~~~~~I~I~D~~~~~i~~~  300 (823)
                         +.-   |.  +++-+..+  +.                                    +..|.|.++|+.++...|.
T Consensus       216 ~~f~~~~~~g~kLhi~Ei~~~~~~~~~f~kk~~~~~~~~~~~~Dfpv~~~vs~k~g~iy~itk~G~~~~~d~~t~~~i~~  295 (1630)
T 1xi4_A          216 FCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYM  295 (1630)
T ss_pred             EEEEEecCCCceEEEEecCCCccCCCCCccccccccCCcccccCcceEEEeccccCEEEEEecCceEEEEecccchhhhh
Confidence               111   11  33333221  10                                    1468899999999998888


Q ss_pred             ccccc-eeEE---EeecCcEEEEEcCCeEEEEeecChHHHHHHHHHh-ccHHHHHHHHHhcCCCHHHHHHHHHHHhhhhc
Q 037368          301 LVVKE-VSHM---LCEWGNIILVMTDKSVLCIGEKDMESKLDMLFKK-NLYTVAINLVQSQQADAAATAEVLRKYGDHLY  375 (823)
Q Consensus       301 ~~i~~-v~~v---~~~~~~~~vvs~~~~v~~l~~~~~~~~i~~L~~~-~~f~~Al~la~~~~~~~~~~~~I~~~y~d~L~  375 (823)
                      .+++. ..|+   ....++++.|.+.|+|+.+. .+....+..+..+ ++-+.|+++|.+.++|.  .++++.+..+.||
T Consensus       296 ~ris~~~iF~~~~~~~~~g~~~vnr~G~vl~v~-v~~~~iv~yi~~~l~~~~la~~~a~r~~lpG--ad~l~~~~F~~l~  372 (1630)
T 1xi4_A          296 NRISGETIFVTAPHEATAGIIGVNRKGQVLSVC-VEEENIIPYITNVLQNPDLALRMAVRNNLAG--AEELFARKFNALF  372 (1630)
T ss_pred             ccccCCceEEeccCCCCCceEEEcCCceEEEEE-EccchhhhhHhhccCCHHHHHHHHHhcCCCC--chhHHHHHHHHHH
Confidence            88776 4443   23567899999999998886 6666777777654 78899999999999987  5688888899999


Q ss_pred             cCCCHHHHHHHHHHH-hCCcChHHHHHHhhc----hhhHHHHHHHHHHHHHcCCCChhHHHHHHHHHHhcCChhhHHHhh
Q 037368          376 SKQDYDEAMSQYILT-IGHLEPSYVIQKFLD----AQRIYNLTNYLEKLHEKGFASKDHTTLLLNCYTKLKDVEKLNMFI  450 (823)
Q Consensus       376 ~k~~y~~A~~~y~~t-i~~~eps~vI~kFl~----~~~~~~L~~YL~~l~~~~~~~~~~~~lLl~~y~kl~~~~~l~~fi  450 (823)
                      .+|+|.+||+..+.+ -|.++..++|.||..    +++..+|..|+..|.++|..|+..+..|.+|....++.+.|++|+
T Consensus       373 ~~g~y~~AA~~aa~sp~giLRt~~ti~rfk~~~~~pgq~~pll~YF~~ll~~g~Ln~~eSlEl~r~vl~q~r~~lle~Wl  452 (1630)
T 1xi4_A          373 AQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWL  452 (1630)
T ss_pred             HcCCHHHHHHHHHhCccccccCHHHHHHHHcCCCCCCCCCHHHHHHHHHHhcCCCcHHHHHHHHHHHHHhchHHHHHHHH
Confidence            999999999999988 667898999999976    456789999999999999999999999999999999999999999


Q ss_pred             cCCCCCCcccCCHHHHHHHHHhcCCHHHHHHHHHHhCChHHHHHHHHHhhcCHHHHHHHHhcCChHHHHHHHHHHHHHHH
Q 037368          451 KGEDGVGEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPSQAGVTVKEYGKILI  530 (823)
Q Consensus       451 ~~~~~~~~~~~d~~~ai~vl~~~g~~~~a~~la~~~~~~~~~l~il~~~~~~~~~al~yl~~l~~~~~~~~i~k~~~~Ll  530 (823)
                      +..+    +.|.-+. =++++.+ ....|+..+.+-+-|.+++..+++. |+|+++++|.++.+....+..|.+.   ++
T Consensus       453 ~e~K----L~~SEeL-GDlv~~~-d~~lAl~iY~~a~~~~Kvi~~l~~~-gq~~ki~~Y~~~~~~~pDy~~ll~~---~~  522 (1630)
T 1xi4_A          453 KEDK----LECSEEL-GDLVKSV-DPTLALSVYLRANVPNKVIQCFAET-GQVQKIVLYAKKVGYTPDWIFLLRN---VM  522 (1630)
T ss_pred             HhCC----ccccHHH-HHHHHhc-ChHHHHHHHHhcCCcHHHHHHHHHh-CCHHHHHHHHhccCCCccHHHHHHH---Hh
Confidence            9987    2232221 1333333 4556777777778999999999998 9999999999998766666666664   77


Q ss_pred             hcCCHHHHHHHHHHhhcCCCCcccCCCCCcccCCCCCHHHHHhhhcc--CcHHHHHHHHHHHhhcCCCCchhhHHHHHHH
Q 037368          531 EHKPMETIDILLRLCTEDGESTKRGASSSTYMSMLPSPVDFLNIFVH--HPESLMDFLEKYTNKVKDSPAQVEIHNTLLE  608 (823)
Q Consensus       531 ~~~p~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~--~~~~~~~yLe~~i~~~~~~~~~~~~~n~lle  608 (823)
                      +.+|+.++++...+..+.. |             .+++..++.+|++  +-++.+.||..+++.+.  |+...++++|||
T Consensus       523 ~~~P~~~~~fa~~L~~~~~-p-------------~~d~~~ivd~f~~~~~iq~~t~fLld~lk~n~--~e~~~LQTrlle  586 (1630)
T 1xi4_A          523 RISPDQGQQFAQMLVQDEE-P-------------LADITQIVDVFMEYNLIQQCTAFLLDALKNNR--PSEGPLQTRLLE  586 (1630)
T ss_pred             hcChHHHHHHHHHHhcCCC-C-------------ccCHHHHHHHHHhcCcHHHHHHHHHHHHhCCC--hhhhhHhHHHHH
Confidence            8899999999888766532 2             5788999999985  56789999999998764  446799999999


Q ss_pred             HhccccccCCcccccCcccccccccCCCCCCcccCCccccCCCCCCCCcchHHHHHHHHHHHhhcCCCCCCCCCCChhhH
Q 037368          609 LYLSYDLNFPSISQLNDGVDLRLRSGSGLPKAEYNGEVTADGKDTYKGKDVLERREKGLRLLKTAWPSELEHPLYDVDLA  688 (823)
Q Consensus       609 lyl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~kll~~L~~~~~~~~~~~~Yd~~~a  688 (823)
                      +.|..   .|                                             +-+..+|.+..     -++||.   
T Consensus       587 ~Nl~~---~p---------------------------------------------qvadail~~~~-----fthyd~---  610 (1630)
T 1xi4_A          587 MNLMH---AP---------------------------------------------QVADAILGNQM-----FTHYDR---  610 (1630)
T ss_pred             Hhhcc---ch---------------------------------------------hHHHHHHhcCc-----cccccH---
Confidence            99996   21                                             67777887722     578997   


Q ss_pred             HHHHHhcCCchhHHHHHHHhccHHHHHHHHHhcCChhHHHHHHHHhCCCCCCCCcchHHHHHHHhccCCCCC-HHHHHHH
Q 037368          689 IILCEMNAFKEGLLYLYEKLKLYKEVIACYTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKYFGELGEDC-SKEVKEV  767 (823)
Q Consensus       689 L~lc~~~~~~~~~v~L~~k~g~~~~al~~~~~~~d~~~~i~~~~~~~~~~~~~~~~Lw~~ll~~~~~~~~~~-~~~i~~~  767 (823)
                                ..++.||++.|++++||++|.+..|+++++-..    ..    -+.-|  +..||.+.+.+. .++++++
T Consensus       611 ----------~~IA~LCE~aGl~qrale~y~d~~dikR~~~~~----~~----~~~~~--l~~~fg~l~~~~s~~~l~~~  670 (1630)
T 1xi4_A          611 ----------AHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHT----HL----LNPEW--LVNYFGSLSVEDSLECLRAM  670 (1630)
T ss_pred             ----------HHHHHHHHHcCcHHHHHHhcCCHHHHHHHhhcc----Cc----CCHHH--HHHHHhcCCHHHHHHHHHHH
Confidence                      788999999999999999999999999887532    11    34578  689999876543 4677777


Q ss_pred             HHH-HH------------hCCCCChHHHHHHhcC
Q 037368          768 LTY-IE------------RDDILPPIVVLQTLSR  788 (823)
Q Consensus       768 L~~-i~------------~~~~l~p~~vl~~l~~  788 (823)
                      |.. +.            =++.|.|..+++++-+
T Consensus       671 l~~n~~qnlq~vvqva~ky~~~lg~~~li~~fe~  704 (1630)
T 1xi4_A          671 LSANIRQNLQICVQVASKYHEQLSTQSLIELFES  704 (1630)
T ss_pred             HHHhHhhhhhhhhhHHHHHHhhcCHHHHHHHHHH
Confidence            752 11            1456777777777743
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3qil_A Clathrin heavy chain 1; clathrin trimerization domain, endocytosis, structural prote; 3.92A {Bos taurus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 823
d1b89a_336 a.118.1.3 (A:) Clathrin heavy chain proximal leg s 2e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Clathrin heavy chain proximal leg segment
domain: Clathrin heavy chain proximal leg segment
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 48.7 bits (116), Expect = 2e-06
 Identities = 42/360 (11%), Positives = 87/360 (24%), Gaps = 92/360 (25%)

Query: 457 GEHKFDVETAIRVCRAANYHEHAMYVAKKAGKHELYLKILLEDLGRYDEALQYISSLDPS 516
           G +   ++     C     ++ A  +             L+  LG Y  A+      + +
Sbjct: 11  GPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVH-LGEYQAAVDGARKANST 69

Query: 517 QAGVTVKEYGKILIEHKPMETIDILLRLCTEDGESTKRGASSSTYMSMLPSPVDFLNIFV 576
           +   T KE     ++ K      +         +                  +       
Sbjct: 70  R---TWKEVCFACVDGKEFRLAQMCGLHIVVHADEL--------------EELINYYQDR 112

Query: 577 HHPESLMDFLEKYTNKVKDSPAQVEIHNTLLELYLSYDLNFPSISQLNDGVDLRLRSGSG 636
            + E L+  LE          A + +   L  LY  +                       
Sbjct: 113 GYFEELITMLEAALGL---ERAHMGMFTELAILYSKFK---------------------- 147

Query: 637 LPKAEYNGEVTADGKDTYKGKDVLERREKGLRLLKTAWPSELEHPLYDVDLAIILCEMNA 696
                                      +K    L+  W         ++   +   E   
Sbjct: 148 --------------------------PQKMREHLELFWSR------VNIPKVLRAAEQAH 175

Query: 697 FKEGLLYLYEKLKLYKEVIAC----YTQAHDHEGLIACCKRLGDSGKGGDPSLWVDLLKY 752
               L++LY+K + Y   I       T A                 K  +  L+   +++
Sbjct: 176 LWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIIT------KVANVELYYRAIQF 229

Query: 753 FGELGEDCSKEVKEVLTYIERDDILPPIVVLQTLSRNPCLTLSVIKDYIARKLEQESKLI 812
           + E       ++  VL+      +     V           L ++K Y+       +K +
Sbjct: 230 YLEFKPLLLNDLLMVLSP----RLDHTRAVNYFSKVKQ---LPLVKPYLRSVQNHNNKSV 282
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query823
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.89
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.88
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.88
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.88
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.85
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.85
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.84
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.84
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 99.84
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.84
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.82
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.82
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.8
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.79
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.79
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.78
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.77
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.77
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.76
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.73
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.72
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.67
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.65
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.64
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.64
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.64
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.63
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.6
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.51
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.5
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.49
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.49
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.48
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.48
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.41
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 99.38
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.35
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.29
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.23
d1bpoa1157 Clathrin heavy-chain linker domain {Rat (Rattus no 99.08
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.07
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.89
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.88
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.83
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.81
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.78
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.75
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.56
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.41
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.27
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.22
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.1
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.98
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.81
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.75
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.67
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.66
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.51
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.48
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.48
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.46
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.44
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.25
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.24
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.16
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.16
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.82
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.81
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.34
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.26
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.26
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.06
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 95.63
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.39
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 93.61
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 92.64
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 92.03
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 92.02
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 90.59
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 87.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 87.18
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 84.61
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 80.72
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.89  E-value=7.8e-21  Score=203.71  Aligned_cols=265  Identities=13%  Similarity=0.071  Sum_probs=183.2

Q ss_pred             CCeEEEeeCC--CEEEEEecCCeEEEEc-CCC---eeeE--eEeecccceeEEEEecCCCEEEEEecCCCCcccccceeE
Q 037368           26 GNITCCSSGR--GKVVIGCDDGAVSLLD-RGL---KFNF--GFQAHSSSVLFLQQLKQRNFLVTVGEDEQVSAQQSAVCL   97 (823)
Q Consensus        26 ~~is~~~~~~--~~l~~gs~dG~i~~~d-~~~---~~~~--~~~~H~~~V~~i~~~~~~~~l~s~s~D~~~~~~~~~~~v   97 (823)
                      ..|+|+++++  .+|++|+ ||.|++|| .++   ..+.  ...+|++.|.+++|+|+|++|+|++.|++         |
T Consensus        52 ~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~---------i  121 (337)
T d1gxra_          52 EVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEAST---------L  121 (337)
T ss_dssp             SCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSE---------E
T ss_pred             CcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeecccc---------c
Confidence            4588888754  4788987 89999999 332   2222  33479999999999999999999999998         9


Q ss_pred             EEEeCCCCCCCCCCCCCCceEEEEEeccCCCCCCceEEEEEecCCCCcceEEEEEeCCeEEEEEcccccccccceeEEec
Q 037368           98 KVFDLDKMEPEGTSSTSPDCIGILRVFTSQFPEAKITSFLVLEEAPPILLIAIGLDNGCIYCIKGDIARERITRFKLQVD  177 (823)
Q Consensus        98 kvWdl~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~v~~va~~~d~~~~~~ia~G~~dG~V~l~~~~~~~~~~~k~~~~~~  177 (823)
                      ++||+...        ++.+...+..+  ..+   +.+++|+|++..   +++|+.++.|.+|+..    .+........
T Consensus       122 ~iwd~~~~--------~~~~~~~~~~~--~~~---v~~~~~~~~~~~---l~s~~~d~~i~~~~~~----~~~~~~~~~~  181 (337)
T d1gxra_         122 SIWDLAAP--------TPRIKAELTSS--APA---CYALAISPDSKV---CFSCCSDGNIAVWDLH----NQTLVRQFQG  181 (337)
T ss_dssp             EEEECCCC----------EEEEEEECS--SSC---EEEEEECTTSSE---EEEEETTSCEEEEETT----TTEEEEEECC
T ss_pred             cccccccc--------ccccccccccc--ccc---cccccccccccc---cccccccccccccccc----cccccccccc
Confidence            99999743        33444444422  333   999999999999   9999999999999863    1112222334


Q ss_pred             CCCCcceEEEeecCCeEEEEEEcCCeEEEEEecCCCCcceEEccCCCccceecccCCCeEE-Eee-CCeEEEEecCCCCc
Q 037368          178 NQCSVMGLGFRVDGQALQLFAVTPNSVILFSLQNQPPKRQFLDNIGCSTNSVAMSDRLELI-IGR-PEAVYFYEVDGRGP  255 (823)
Q Consensus       178 ~~~~It~l~fs~dg~~~~l~~~t~~~V~~~d~~~~~~~~~~l~~~~~~~~~~~~s~~~~li-v~~-~~~I~i~~~~g~~~  255 (823)
                      +.++|++++|++++. .++..+.++.|++||+.... ....+. +...+.+++|+|++.++ ++. ++.|++|+.+... 
T Consensus       182 ~~~~v~~l~~s~~~~-~~~~~~~d~~v~i~d~~~~~-~~~~~~-~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~-  257 (337)
T d1gxra_         182 HTDGASCIDISNDGT-KLWTGGLDNTVRSWDLREGR-QLQQHD-FTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPD-  257 (337)
T ss_dssp             CSSCEEEEEECTTSS-EEEEEETTSEEEEEETTTTE-EEEEEE-CSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSC-
T ss_pred             ccccccccccccccc-ccccccccccccccccccce-eecccc-cccceEEEEEcccccccceeccccccccccccccc-
Confidence            578999999999984 34444456779999987532 334443 56678899999988754 444 4689999987432 


Q ss_pred             ccccc---CCeEEEEe--eCcEEEEEEecCCCCccEEEEEeCCCCEEEEe-ccccceeEE-EeecCcEEEEEcCCeEEEE
Q 037368          256 CWAFE---GEKKLLGW--FRGYLLCVIADQRNSKNIFNVYDLKNRLIAHS-LVVKEVSHM-LCEWGNIILVMTDKSVLCI  328 (823)
Q Consensus       256 ~~~~~---g~~~~i~~--~~~ylv~~s~d~~~~~~~I~I~D~~~~~i~~~-~~i~~v~~v-~~~~~~~~vvs~~~~v~~l  328 (823)
                      .....   +....+.|  .+.++++++     .+++|++||..++..... .+-..+..+ +++++..++.++.+..+++
T Consensus       258 ~~~~~~~~~~i~~v~~s~~g~~l~s~s-----~Dg~i~iwd~~~~~~~~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~v  332 (337)
T d1gxra_         258 KYQLHLHESCVLSLKFAYCGKWFVSTG-----KDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATV  332 (337)
T ss_dssp             EEEECCCSSCEEEEEECTTSSEEEEEE-----TTSEEEEEETTTCCEEEEEECSSCEEEEEECTTSCEEEEEETTSCEEE
T ss_pred             cccccccccccceEEECCCCCEEEEEe-----CCCeEEEEECCCCCEEEEccCCCCEEEEEEeCCCCEEEEEeCCCeEEE
Confidence            23222   23445555  567888887     458999999987544332 233335555 6777777766655445555


Q ss_pred             e
Q 037368          329 G  329 (823)
Q Consensus       329 ~  329 (823)
                      +
T Consensus       333 W  333 (337)
T d1gxra_         333 Y  333 (337)
T ss_dssp             E
T ss_pred             E
Confidence            5
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure