Citrus Sinensis ID: 037717

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--
MNPFDAWEKQQREKCTFEIEDKIVDFFSESVFDGDNFDEFESELPNKSVVKSTLEMLQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYEPRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNYHRIWMTILCQKYNELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFELLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTSIYSNL
cccHHHHHHHHHHHHcccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccEEEccHHHHHHHHccccccccccEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHcccccEEEEccccccccEEEccccHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHccccccccccEEEEEEcccccccccccEEEEEcccccccccccccccccEEEEccccHHHHHccccccccccccEEEEcccHHHHccccccHHccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccHHHHHHHccccccHHHHHHHHHHccccccEEEccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccc
cccccccccccccccHHHccHHHHHHHHHHccccccHHHHHHHcccccHHHHccccHHHHHcccccHHHHHHHHHHHHcccEEEEEEcccccccccccHHHccHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccEEEEEcccHHHHHHHHccccHHccEEEEEEcHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccEEEcccccccEEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEccccccccccEEEEcEccHHHHHHHcccccccccccEEEEEEHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEcccc
MNPFDAWEKQQREKCTFEIEDKIVDFfsesvfdgdnfdefeselpnksVVKSTLEMLQEErktlpiypFWEELLQAVSGYPVLAIVgetgsgkttqipqylyeprWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREiviepslesysVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSAtldaekfsdyfgsapifkipgrrypvelfytkapevdYIEAAIVTALQIhvneptgdILVFLTGQDEIERAEEILKQRTRGLGTKIAELIicpiyanlptelqakifeptpeRARKVVLATNiaetsltidgikyvihpgfakvksynpktgmesllvnpiskasanqrtglsertgpgkcfrlytlhnYHRIWMTILCQKYNELIWKMLSLFSNVLvnfdfidpPLEEALLKAFELLYALGALnkagqltrvgrqmaefpidpklsktivsldkykcsdEIITIAAMLFVGnsifyrpkdkqiyadnarmnfhlgdvgDRIALLRVYNCwrecnystewcRENYIQVSSMKRARDIRDQLEGLFARVEIDTSIYSNL
mnpfdawekqqreKCTFEIEDKIVDFFSESVFDGDNFdefeselpnksvVKSTLEMLQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYEPRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLAtniaetsltidgikyviHPGFAKVKSYNPKTGMESLLVNPISKASanqrtglsertgpgkcFRLYTLHNYHRIWMTILCQKYNELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFELLYALGALNKAGQLTRVGRQMaefpidpklsktIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGlfarveidtsiysnl
MNPFDAWEKQQREKCTFEIEDKIVDFFSESVFDGDNFDEFESELPNKSVVKSTLEMLQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYEPRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNYHRIWMTILCQKYNELIWKMLSLFSNVLVNFDFIDPPleeallkafellyalGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTSIYSNL
*************KCTFEIEDKIVDFFSESVFDGDNFDE****************MLQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYEPRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKVKSYNP*****************************GKCFRLYTLHNYHRIWMTILCQKYNELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFELLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTSI****
*NP*DAW******************************************************KTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYEPRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQR*******IAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNYHRIWMTILCQKYNELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFELLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIF******************LGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTS*Y***
***********REKCTFEIEDKIVDFFSESVFDGDNFDEFESELPNKSVVKSTLEMLQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYEPRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNYHRIWMTILCQKYNELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFELLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTSIYSNL
***********REKCTFEIEDKIVDFFSESVFDGDN*DEFE******SVV**TLEMLQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYEPRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKAS***********GPGKCFRLYTLHNYHRIWMTILCQKYNELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFELLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTSIY***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPFDAWEKQQREKCTFEIEDKIVDFFSESVFDGDNFDEFESELPNKSVVKSTLEMLQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYEPRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNYHRIWMTILCQKYNELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFELLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTSIYSNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query582 2.2.26 [Sep-21-2011]
O60231 1041 Putative pre-mRNA-splicin yes no 0.950 0.531 0.587 0.0
Q7YR39 1044 Putative pre-mRNA-splicin yes no 0.950 0.529 0.585 0.0
Q767K6 1045 Putative pre-mRNA-splicin yes no 0.950 0.529 0.587 0.0
Q54MH3 1106 Putative pre-mRNA-splicin yes no 0.886 0.466 0.633 0.0
O45244 1008 Probable pre-mRNA-splicin yes no 0.960 0.554 0.577 0.0
Q10752 1055 Pre-mRNA-splicing factor yes no 0.945 0.521 0.553 1e-180
Q54F05 1160 ATP-dependent RNA helicas no no 0.898 0.450 0.530 1e-168
Q14562 1220 ATP-dependent RNA helicas no no 0.896 0.427 0.545 1e-166
A2A4P0 1244 ATP-dependent RNA helicas no no 0.896 0.419 0.545 1e-166
Q38953 1168 Probable pre-mRNA-splicin no no 0.888 0.442 0.541 1e-165
>sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 Back     alignment and function desciption
 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/577 (58%), Positives = 428/577 (74%), Gaps = 24/577 (4%)

Query: 20  EDKIVDFFSESVFDGDNFDEFESELPNKSVVKSTLEMLQEERKTLPIYPFWEELLQAVSG 79
           E++ ++F   +   GD     E   P  S      E +Q  R++LP++PF EELL A++ 
Sbjct: 359 EEETIEFVRATQLQGDE----EPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIAN 414

Query: 80  YPVLAIVGETGSGKTTQIPQYLYE--------------PRWVAAMSVAARVSQEMGVKLG 125
           + VL I GETGSGKTTQIPQYL+E              PR VAAMSVAARV++EMGVKLG
Sbjct: 415 HQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLG 474

Query: 126 HEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFG 185
           +EVGYSIRFEDCTS++TVL+YMTD MLLRE + EP L SYSV++VDEA ERTL TD LFG
Sbjct: 475 NEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFG 534

Query: 186 LLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEA 245
           L+KD+  +RP+LK+L++SAT+D  +FS +F  AP+F+IPGRR+PV++FYTKAPE DY+EA
Sbjct: 535 LIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEA 594

Query: 246 AIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANLPTE 305
            +V+ LQIHV +P GDILVFLTGQ+EIE A E+L+ R R LG+KI EL++ PIYANLP++
Sbjct: 595 CVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSD 654

Query: 306 LQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKVKSYNPKTGMESLLVNPI 365
           +QA+IF+PTP  ARKVV+ATNIAETSLTI+GI YV+ PGF K KSYNP+TGMESL V P 
Sbjct: 655 MQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPC 714

Query: 366 SKASANQRTGLSERTGPGKCFRLYTLHNY-HRIWMTILCQ----KYNELIWKMLSLFSNV 420
           SKASANQR G + R   GKCFRLYT   Y H +  T + +        ++  + SL  + 
Sbjct: 715 SKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHD 774

Query: 421 LVNFDFIDPPLEEALLKAFELLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKY 480
           L++FDF+DPP  E LL A E LYALGALN  G+LT  GR+MAE P+DP LSK I++ +KY
Sbjct: 775 LMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKY 834

Query: 481 KCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNY 540
            CS+EI+T+AAML V NSIFYRPKDK ++ADNAR+NF L   GD + LL VY  W E  Y
Sbjct: 835 SCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG-GDHLVLLNVYTQWAESGY 893

Query: 541 STEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTS 577
           S++WC EN++Q  SM+RARD+R+QLEGL  RVE+  S
Sbjct: 894 SSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLS 930
Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 Back     alignment and function description
>sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 Back     alignment and function description
>sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
218200972 1046 hypothetical protein OsI_28838 [Oryza sa 0.991 0.551 0.681 0.0
225457283 1056 PREDICTED: putative pre-mRNA-splicing fa 0.989 0.545 0.699 0.0
356516851 1035 PREDICTED: putative pre-mRNA-splicing fa 0.989 0.556 0.693 0.0
356516849 1044 PREDICTED: putative pre-mRNA-splicing fa 0.989 0.551 0.693 0.0
357112047 1051 PREDICTED: putative pre-mRNA-splicing fa 0.982 0.544 0.681 0.0
242056951 1046 hypothetical protein SORBIDRAFT_03g01054 0.982 0.546 0.681 0.0
38424010 1066 RNA helicase-like [Oryza sativa Japonica 0.991 0.541 0.659 0.0
334182986 1034 pre-mRNA-splicing factor ATP-dependent R 0.994 0.559 0.670 0.0
22329903 1044 pre-mRNA-splicing factor ATP-dependent R 0.994 0.554 0.670 0.0
326489737 1046 predicted protein [Hordeum vulgare subsp 0.982 0.546 0.675 0.0
>gi|218200972|gb|EEC83399.1| hypothetical protein OsI_28838 [Oryza sativa Indica Group] gi|222640378|gb|EEE68510.1| hypothetical protein OsJ_26936 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/618 (68%), Positives = 487/618 (78%), Gaps = 41/618 (6%)

Query: 1   MNPF---DAWEKQQ--REKCTFEIEDKI-------------VDFFSESVFDGDNFDEF-- 40
           MNPF   +AWE+ Q  + K  F  +D+              +DF   SV +G   +E   
Sbjct: 331 MNPFAEQEAWEEHQIGKSKLQFGSKDRKRSSDDYQYVFEDGIDFVKSSVIEGTQHEEDSD 390

Query: 41  ESELPNKSVVKSTLEML---QEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQI 97
           + ++  K ++K  L+ +   Q+ERKTLPIY F +ELL+AV  Y V+ IVGETGSGKTTQI
Sbjct: 391 QEDIDEKDMLKRELQHVSLNQDERKTLPIYKFRDELLKAVEEYQVIVIVGETGSGKTTQI 450

Query: 98  PQYLYE-------------PRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVL 144
           PQYL+E             PR VAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTS+KT++
Sbjct: 451 PQYLHEAGYTAKGKVACTQPRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSEKTLI 510

Query: 145 KYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSA 204
           KYMTD MLLRE + EP L SYSV++VDEA ERTLSTD LFGL+KD+  +RPDLKLLISSA
Sbjct: 511 KYMTDGMLLREFLGEPDLASYSVVMVDEAHERTLSTDILFGLVKDISRFRPDLKLLISSA 570

Query: 205 TLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILV 264
           TLDAEKFSDYF SAPIFKIPGRRYPVE+ YTKAPE DYI+AAIVT LQIHV +P GDILV
Sbjct: 571 TLDAEKFSDYFDSAPIFKIPGRRYPVEVHYTKAPEADYIDAAIVTVLQIHVTQPPGDILV 630

Query: 265 FLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLA 324
           FLTGQ+EIE  +EILK RTRGLGTKIAEL+ICPIYANLPTELQAKIFEPTPE ARKVVLA
Sbjct: 631 FLTGQEEIETIDEILKHRTRGLGTKIAELLICPIYANLPTELQAKIFEPTPEGARKVVLA 690

Query: 325 TNIAETSLTIDGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGK 384
           TNIAETSLTIDGIKYV+ PGF K+KSYNP+TGMESLL+NPISKASANQR G S RTGPGK
Sbjct: 691 TNIAETSLTIDGIKYVVDPGFCKIKSYNPRTGMESLLINPISKASANQRAGRSGRTGPGK 750

Query: 385 CFRLYTLHNY-HRIWMTIL--CQKYN--ELIWKMLSLFSNVLVNFDFIDPPLEEALLKAF 439
           CFRLYT +NY H +    +   Q+ N   ++  + SL  + LVNFDF+DPP  EALLKA 
Sbjct: 751 CFRLYTSYNYMHDLEDNTVPEIQRTNLANVVLTLKSLGIHDLVNFDFMDPPPSEALLKAL 810

Query: 440 ELLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSI 499
           E L+AL ALN  G+LT+ GR+MAEFP+DP LSK IV+ +KYKCSDE+I+IA+ML VGNSI
Sbjct: 811 EQLFALSALNSRGELTKTGRRMAEFPLDPMLSKMIVASEKYKCSDEVISIASMLSVGNSI 870

Query: 500 FYRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRAR 559
           FYRPKDKQ++ADNAR+NFH G+VGD IALL VYN W+E +YST+WC ENYIQV SMKRAR
Sbjct: 871 FYRPKDKQVHADNARLNFHTGNVGDHIALLNVYNSWKETDYSTQWCYENYIQVRSMKRAR 930

Query: 560 DIRDQLEGLFARVEIDTS 577
           DIRDQLEGL  RVEI+ S
Sbjct: 931 DIRDQLEGLLERVEIEIS 948

Source: Oryza sativa Indica Group

Species: Oryza sativa

Genus: Oryza

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225457283|ref|XP_002284415.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356516851|ref|XP_003527106.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356516849|ref|XP_003527105.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|357112047|ref|XP_003557821.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242056951|ref|XP_002457621.1| hypothetical protein SORBIDRAFT_03g010540 [Sorghum bicolor] gi|241929596|gb|EES02741.1| hypothetical protein SORBIDRAFT_03g010540 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|38424010|dbj|BAD01767.1| RNA helicase-like [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|334182986|ref|NP_001185127.1| pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Arabidopsis thaliana] gi|332193372|gb|AEE31493.1| pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22329903|ref|NP_174527.2| pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Arabidopsis thaliana] gi|18377729|gb|AAL67014.1| putative RNA helicase [Arabidopsis thaliana] gi|22136924|gb|AAM91806.1| putative RNA helicase [Arabidopsis thaliana] gi|332193371|gb|AEE31492.1| pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|326489737|dbj|BAK01849.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
TAIR|locus:2033723 1044 ESP3 "ENHANCED SILENCING PHENO 0.989 0.551 0.671 3.1e-202
TAIR|locus:2062492 1044 MEE29 "maternal effect embryo 0.991 0.552 0.654 4.2e-198
ZFIN|ZDB-GENE-030131-8589 1054 dhx16 "DEAH (Asp-Glu-Ala-His) 0.970 0.536 0.577 3.6e-176
UNIPROTKB|O60231 1041 DHX16 "Putative pre-mRNA-splic 0.974 0.544 0.562 9.6e-174
RGD|1302963 1044 Dhx16 "DEAH (Asp-Glu-Ala-His) 0.970 0.541 0.568 9.6e-174
UNIPROTKB|E1BF68 1045 DHX16 "Uncharacterized protein 0.974 0.542 0.564 1.6e-173
UNIPROTKB|F1RU83 1045 DHX16 "Putative pre-mRNA-splic 0.974 0.542 0.562 2.5e-173
UNIPROTKB|Q767K6 1045 DHX16 "Putative pre-mRNA-splic 0.974 0.542 0.562 2.5e-173
FB|FBgn0086444 894 l(2)37Cb "lethal (2) 37Cb" [Dr 0.975 0.635 0.581 2.6e-173
UNIPROTKB|F1PGL2 1042 DHX16 "Uncharacterized protein 0.974 0.544 0.562 1.4e-172
TAIR|locus:2033723 ESP3 "ENHANCED SILENCING PHENOTYPE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1957 (694.0 bits), Expect = 3.1e-202, P = 3.1e-202
 Identities = 402/599 (67%), Positives = 467/599 (77%)

Query:     4 FDAWEKQQREKCTFEIEDKIVDFFSESVFDGDNF-DEFESELPNKSVVKST-LEMLQEER 61
             F A  KQ  +   F  ED+I +F  ESV  G+N+ D  +++  ++ + + T LE LQE R
Sbjct:   343 FGAKNKQASDDYQFVFEDQI-NFIKESVMAGENYEDAMDAKQKSQDLAEKTALEELQEVR 401

Query:    62 KTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYE-------------PRWVA 108
             ++LPIY + ++LL+AV  + VL IVG+TGSGKTTQIPQYL+E             PR VA
Sbjct:   402 RSLPIYTYRDQLLKAVEEHQVLVIVGDTGSGKTTQIPQYLHEAGYTKRGKVGCTQPRRVA 461

Query:   109 AMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVL 168
             AMSVAARV+QEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTD MLLRE++ EP L SYSV+
Sbjct:   462 AMSVAARVAQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLRELLGEPDLASYSVV 521

Query:   169 IVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRY 228
             IVDEA ERTLSTD LFGL+KD+  +RPDLKLLISSAT+DAEKFSDYF +APIF  PGRRY
Sbjct:   522 IVDEAHERTLSTDILFGLVKDIARFRPDLKLLISSATMDAEKFSDYFDTAPIFSFPGRRY 581

Query:   229 PVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGT 288
             PVE+ YT APE DY++AAIVT L IHV EP GDILVF TGQ+EIE AEEILK R RGLGT
Sbjct:   582 PVEINYTSAPEADYMDAAIVTILTIHVREPLGDILVFFTGQEEIETAEEILKHRIRGLGT 641

Query:   289 KIAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKV 348
             KI ELIICPIYANLP+ELQAKIFEPTPE ARKVVLATNIAETSLTIDGIKYV+ PGF+K+
Sbjct:   642 KIRELIICPIYANLPSELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVVDPGFSKM 701

Query:   349 KSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNYHRIWM--TIL-CQK 405
             KSYNP+TGMESLL+ PISKASA QR G + RT PGKC+RLYT  NY+      T+   Q+
Sbjct:   702 KSYNPRTGMESLLITPISKASATQRAGRAGRTSPGKCYRLYTAFNYNNDLEENTVPEVQR 761

Query:   406 YN--ELIWKMLSLFSNVLVNFDFIDPPXXXXXXXXXXXXXXXGALNKAGQLTRVGRQMAE 463
              N   ++  + SL  + L+NFDF+DPP               GALNK G+LT+ GR+MAE
Sbjct:   762 TNLASVVLALKSLGIHDLINFDFMDPPPAEALVKSLELLFALGALNKLGELTKAGRRMAE 821

Query:   464 FPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVG 523
             FP+DP LSK IV  DKYKCSDEII+IAAML +G SIFYRPKDKQ++ADNARMNFH G+VG
Sbjct:   822 FPLDPMLSKMIVVSDKYKCSDEIISIAAMLSIGGSIFYRPKDKQVHADNARMNFHTGNVG 881

Query:   524 DRIALLRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTSIYSNL 582
             D IALL+VY+ W+E N+ST+WC ENYIQV SMKRARDIRDQLEGL  RVEID S  SNL
Sbjct:   882 DHIALLKVYSSWKETNFSTQWCYENYIQVRSMKRARDIRDQLEGLLERVEIDIS--SNL 938
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0008380 "RNA splicing" evidence=NAS
GO:0035194 "posttranscriptional gene silencing by RNA" evidence=IMP
GO:0016020 "membrane" evidence=IDA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0007267 "cell-cell signaling" evidence=RCA
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
TAIR|locus:2062492 MEE29 "maternal effect embryo arrest 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8589 dhx16 "DEAH (Asp-Glu-Ala-His) box polypeptide 16" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O60231 DHX16 "Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1302963 Dhx16 "DEAH (Asp-Glu-Ala-His) box polypeptide 16" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF68 DHX16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU83 DHX16 "Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q767K6 DHX16 "Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0086444 l(2)37Cb "lethal (2) 37Cb" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGL2 DHX16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
OsI_28838
Os08g0335000 (1046 aa)
(Oryza sativa Indica)
Predicted Functional Partners:
OsI_11920
Putative uncharacterized protein (464 aa)
   •• • 0.428

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 0.0
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-115
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-104
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 3e-91
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 7e-83
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 1e-30
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 6e-22
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-19
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-17
smart0049082 smart00490, HELICc, helicase superfamily c-termina 8e-10
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 7e-09
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 5e-07
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 2e-05
pfam13401124 pfam13401, AAA_22, AAA domain 0.001
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  595 bits (1536), Expect = 0.0
 Identities = 244/555 (43%), Positives = 326/555 (58%), Gaps = 39/555 (7%)

Query: 51  KSTLEMLQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYE------- 103
            + +  + E R  LP+    +E+L+A+    V+ IVGETGSGKTTQ+PQ+L E       
Sbjct: 36  SANVPDILEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEGLGIAG 95

Query: 104 ------PRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIV 157
                 PR +AA SVA RV++E+G KLG  VGYSIRFE   S +T +K MTD +LLREI 
Sbjct: 96  KIGCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIKVMTDGILLREIQ 155

Query: 158 IEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLI-NYRPDLKLLISSATLDAEKFSDYFG 216
            +P L  YSV+I+DEA ER+L+TD L GLLKDL+   R DLKL+I SATLDAE+FS YFG
Sbjct: 156 NDPLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRRDDLKLIIMSATLDAERFSAYFG 215

Query: 217 SAPIFKIPGRRYPVELFYTKAPEVDYI-EAAIVTALQIHVNEPTGDILVFLTGQDEIERA 275
           +AP+ +I GR YPVE+ Y    E DYI   AIV A+ IH+ E +G ILVFL GQ EIER 
Sbjct: 216 NAPVIEIEGRTYPVEIRYLPEAEADYILLDAIVAAVDIHLREGSGSILVFLPGQREIERT 275

Query: 276 EEILKQRTRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTID 335
            E L++   G      +L I P+Y  L  E Q ++FEP P   RKVVLATNIAETSLTI 
Sbjct: 276 AEWLEKAELG-----DDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLATNIAETSLTIP 330

Query: 336 GIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNY- 394
           GI+YVI  G AK K Y+P+TG+  L   PISKASA+QR G + RTGPG C+RLY+  ++ 
Sbjct: 331 GIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRTGPGICYRLYSEEDFL 390

Query: 395 HRIWMT---ILCQKYNELIWKMLSLFSNV-LVNFDFIDPPLEEALLKAFELLYALGALNK 450
                T   IL    + L+ ++ SL     +  F F+DPP E A+  A  LL  LGAL+ 
Sbjct: 391 AFPEFTLPEILRTDLSGLVLQLKSLGIGQDIAPFPFLDPPPEAAIQAALTLLQELGALDD 450

Query: 451 AGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGN--SIFYRP-KDKQ 507
           +G+LT +G+QM+  P+DP+L++ +++  +  C  E  TIA+ML   +  S F R  K ++
Sbjct: 451 SGKLTPLGKQMSLLPLDPRLARMLLTAPEGGCLGEAATIASMLSEQDRESDFSRDVKLRK 510

Query: 508 IYADNARMNF----HLGD-VGDRIALLRVYNCWRECNYST------EWCRENYIQVSSMK 556
                  +      +  D  GD + LL  +        +         CR       ++ 
Sbjct: 511 QRTAQDLLKRLKRRNAADPRGDHLLLLEAFPDRIARKRAKGEYLRANGCRAMLFPTKALS 570

Query: 557 RARDIRDQLEGLFAR 571
           RA  I   L    + 
Sbjct: 571 RAPWIIAALLVQTSA 585

Length = 845
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 582
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
PTZ00110545 helicase; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PTZ00424401 helicase 45; Provisional 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.98
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 99.97
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.97
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.97
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.97
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.97
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.97
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.97
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.97
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.97
PRK106891147 transcription-repair coupling factor; Provisional 99.97
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.96
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.96
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.96
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.96
KOG0347731 consensus RNA helicase [RNA processing and modific 99.96
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.96
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.96
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.96
COG1205 851 Distinct helicase family with a unique C-terminal 99.95
KOG0354746 consensus DEAD-box like helicase [General function 99.95
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.95
KOG0334997 consensus RNA helicase [RNA processing and modific 99.95
PHA02558501 uvsW UvsW helicase; Provisional 99.94
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.94
PRK13766 773 Hef nuclease; Provisional 99.93
KOG0346569 consensus RNA helicase [RNA processing and modific 99.93
KOG4284 980 consensus DEAD box protein [Transcription] 99.93
PRK09401 1176 reverse gyrase; Reviewed 99.92
KOG0327397 consensus Translation initiation factor 4F, helica 99.92
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.92
PRK09694878 helicase Cas3; Provisional 99.91
PRK14701 1638 reverse gyrase; Provisional 99.91
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.9
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.9
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.89
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.89
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.89
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.89
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.89
PRK05580679 primosome assembly protein PriA; Validated 99.88
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.88
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.88
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.87
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.87
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.87
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.87
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.87
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.84
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.83
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.82
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.82
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.78
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.75
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.75
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.75
PRK04914 956 ATP-dependent helicase HepA; Validated 99.75
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.74
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.73
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.71
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.67
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.64
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.62
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.61
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.59
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.59
COG4096 875 HsdR Type I site-specific restriction-modification 99.57
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.56
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.54
PRK05298652 excinuclease ABC subunit B; Provisional 99.52
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.51
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.47
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.45
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.41
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.4
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.39
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.39
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.38
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.37
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.36
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.36
smart00487201 DEXDc DEAD-like helicases superfamily. 99.36
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.3
smart0049082 HELICc helicase superfamily c-terminal domain. 99.3
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.25
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.22
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.16
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.16
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.14
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.04
KOG1123776 consensus RNA polymerase II transcription initiati 99.03
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.01
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.9
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 98.9
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.86
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.81
KOG0387923 consensus Transcription-coupled repair protein CSB 98.74
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.62
PRK14873665 primosome assembly protein PriA; Provisional 98.54
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.44
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.34
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.32
COG4889 1518 Predicted helicase [General function prediction on 98.12
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.05
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 97.96
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.89
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.88
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.88
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 97.79
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.78
PRK06526254 transposase; Provisional 97.77
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.71
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.66
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.63
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.63
PRK14974336 cell division protein FtsY; Provisional 97.53
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.53
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.52
PRK08181269 transposase; Validated 97.47
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.46
PF05729166 NACHT: NACHT domain 97.41
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.41
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.38
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.35
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.26
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.25
PRK06835329 DNA replication protein DnaC; Validated 97.24
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.24
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.19
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.17
PF13173128 AAA_14: AAA domain 97.14
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.14
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.13
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.12
PRK10536262 hypothetical protein; Provisional 97.08
PRK07952244 DNA replication protein DnaC; Validated 97.04
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.03
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 97.03
PRK08116268 hypothetical protein; Validated 96.98
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.97
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.96
PRK06893229 DNA replication initiation factor; Validated 96.95
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.95
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 96.94
PRK08727233 hypothetical protein; Validated 96.92
PRK09183259 transposase/IS protein; Provisional 96.89
PRK10416318 signal recognition particle-docking protein FtsY; 96.88
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 96.86
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.86
smart00382148 AAA ATPases associated with a variety of cellular 96.85
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.85
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.84
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 96.84
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 96.84
PRK06921266 hypothetical protein; Provisional 96.83
PF1324576 AAA_19: Part of AAA domain 96.81
PF00004132 AAA: ATPase family associated with various cellula 96.79
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.77
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 96.77
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.75
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 96.73
PRK05642234 DNA replication initiation factor; Validated 96.72
COG0610 962 Type I site-specific restriction-modification syst 96.72
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 96.66
PHA02244383 ATPase-like protein 96.66
PRK04296190 thymidine kinase; Provisional 96.65
PRK08084235 DNA replication initiation factor; Provisional 96.65
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.64
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.63
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.61
PRK12402337 replication factor C small subunit 2; Reviewed 96.58
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 96.57
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.52
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.51
PRK12377248 putative replication protein; Provisional 96.51
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.5
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.46
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 96.44
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.42
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.42
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 96.42
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.41
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 96.4
PRK00149450 dnaA chromosomal replication initiation protein; R 96.4
KOG1803649 consensus DNA helicase [Replication, recombination 96.39
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 96.35
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.34
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.34
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.3
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 96.29
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.29
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.28
PRK08939306 primosomal protein DnaI; Reviewed 96.28
PRK09087226 hypothetical protein; Validated 96.28
PRK12422445 chromosomal replication initiation protein; Provis 96.27
TIGR00064272 ftsY signal recognition particle-docking protein F 96.26
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.24
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.24
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.23
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 96.2
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 96.17
PRK14088440 dnaA chromosomal replication initiation protein; P 96.12
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.11
PHA02544316 44 clamp loader, small subunit; Provisional 96.1
CHL00181287 cbbX CbbX; Provisional 96.07
PHA00729226 NTP-binding motif containing protein 96.06
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.02
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.0
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.99
PRK06620214 hypothetical protein; Validated 95.98
PRK14087450 dnaA chromosomal replication initiation protein; P 95.93
PRK00771437 signal recognition particle protein Srp54; Provisi 95.91
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.91
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 95.91
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 95.82
PRK09112351 DNA polymerase III subunit delta'; Validated 95.82
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 95.78
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.78
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 95.72
PRK04195482 replication factor C large subunit; Provisional 95.68
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 95.67
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 95.66
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 95.66
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 95.61
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.61
TIGR00959428 ffh signal recognition particle protein. This mode 95.59
PRK10867433 signal recognition particle protein; Provisional 95.58
COG2255332 RuvB Holliday junction resolvasome, helicase subun 95.57
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 95.57
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 95.57
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 95.57
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 95.56
PRK00440319 rfc replication factor C small subunit; Reviewed 95.55
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 95.54
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 95.53
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 95.47
PRK10436462 hypothetical protein; Provisional 95.44
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 95.42
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.4
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 95.36
PRK14086617 dnaA chromosomal replication initiation protein; P 95.35
PLN03025319 replication factor C subunit; Provisional 95.29
PRK07471365 DNA polymerase III subunit delta'; Validated 95.29
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 95.28
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 95.27
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.23
TIGR02688449 conserved hypothetical protein TIGR02688. Members 95.22
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 95.2
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.18
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.18
PRK03992389 proteasome-activating nucleotidase; Provisional 95.17
TIGR02533486 type_II_gspE general secretory pathway protein E. 95.12
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 95.1
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.08
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.06
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 95.05
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.05
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 95.01
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.99
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.99
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 94.99
KOG1969877 consensus DNA replication checkpoint protein CHL12 94.98
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.96
PF1355562 AAA_29: P-loop containing region of AAA domain 94.94
COG0593408 DnaA ATPase involved in DNA replication initiation 94.94
PRK13342413 recombination factor protein RarA; Reviewed 94.93
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.9
PRK13833323 conjugal transfer protein TrbB; Provisional 94.9
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.9
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.89
COG0470325 HolB ATPase involved in DNA replication [DNA repli 94.82
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 94.78
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.78
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 94.78
PRK13851344 type IV secretion system protein VirB11; Provision 94.76
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 94.75
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 94.75
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 94.72
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 94.67
PRK05707328 DNA polymerase III subunit delta'; Validated 94.55
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.54
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.52
cd03115173 SRP The signal recognition particle (SRP) mediates 94.5
smart00489289 DEXDc3 DEAD-like helicases superfamily. 94.5
smart00488289 DEXDc2 DEAD-like helicases superfamily. 94.5
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.49
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 94.48
PRK07940394 DNA polymerase III subunit delta'; Validated 94.47
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.45
CHL00176638 ftsH cell division protein; Validated 94.45
cd03246173 ABCC_Protease_Secretion This family represents the 94.33
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 94.32
KOG0745564 consensus Putative ATP-dependent Clp-type protease 94.3
TIGR00763775 lon ATP-dependent protease La. This protein is ind 94.27
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.24
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 94.19
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 94.17
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 94.14
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 94.08
COG1618179 Predicted nucleotide kinase [Nucleotide transport 94.08
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.07
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 94.06
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 94.05
TIGR00376637 DNA helicase, putative. The gene product may repre 94.03
COG1126240 GlnQ ABC-type polar amino acid transport system, A 93.94
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 93.93
PRK13341 725 recombination factor protein RarA/unknown domain f 93.9
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 93.88
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 93.85
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 93.83
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 93.8
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 93.77
cd03239178 ABC_SMC_head The structural maintenance of chromos 93.75
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.74
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 93.73
PTZ001121164 origin recognition complex 1 protein; Provisional 93.73
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.69
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 93.68
TIGR02928365 orc1/cdc6 family replication initiation protein. M 93.64
COG1136226 SalX ABC-type antimicrobial peptide transport syst 93.64
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 93.61
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 93.59
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 93.56
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 93.53
PRK07399314 DNA polymerase III subunit delta'; Validated 93.49
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 93.48
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 93.43
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 93.36
CHL00195489 ycf46 Ycf46; Provisional 93.36
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.34
KOG2228408 consensus Origin recognition complex, subunit 4 [R 93.3
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.29
PRK15483 986 type III restriction-modification system StyLTI en 93.24
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 93.23
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.18
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 93.13
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 93.1
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 93.03
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 93.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 92.99
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 92.95
PRK11054684 helD DNA helicase IV; Provisional 92.95
PRK13531498 regulatory ATPase RavA; Provisional 92.94
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 92.88
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 92.87
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 92.86
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 92.85
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 92.8
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.8
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 92.79
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 92.78
KOG1002791 consensus Nucleotide excision repair protein RAD16 92.75
KOG2340698 consensus Uncharacterized conserved protein [Funct 92.71
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 92.71
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 92.64
PRK04841 903 transcriptional regulator MalT; Provisional 92.58
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 92.55
COG1119257 ModF ABC-type molybdenum transport system, ATPase 92.55
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 92.47
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 92.46
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 92.42
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 92.42
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 92.4
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 92.36
PRK06067234 flagellar accessory protein FlaH; Validated 92.3
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 92.28
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 92.28
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 92.26
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 92.18
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.13
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 92.08
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 92.07
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 92.06
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 92.05
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 92.01
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 92.01
CHL00095 821 clpC Clp protease ATP binding subunit 91.97
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 91.96
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 91.95
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 91.94
PRK10865 857 protein disaggregation chaperone; Provisional 91.93
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 91.88
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 91.88
PRK06871325 DNA polymerase III subunit delta'; Validated 91.83
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 91.83
PRK00300205 gmk guanylate kinase; Provisional 91.68
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 91.62
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 91.57
PRK05564313 DNA polymerase III subunit delta'; Validated 91.56
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 91.56
COG0552340 FtsY Signal recognition particle GTPase [Intracell 91.54
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 91.51
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 91.5
PF13871278 Helicase_C_4: Helicase_C-like 91.48
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 91.44
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 91.38
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 91.36
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 91.31
PRK05580 679 primosome assembly protein PriA; Validated 91.3
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 91.3
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 91.29
PTZ00293211 thymidine kinase; Provisional 91.29
PRK08769319 DNA polymerase III subunit delta'; Validated 91.26
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 91.23
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 91.18
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 91.16
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 91.15
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 91.06
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 91.04
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 91.03
PRK10789569 putative multidrug transporter membrane\ATP-bindin 90.97
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 90.94
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 90.92
KOG0347 731 consensus RNA helicase [RNA processing and modific 90.91
PRK10865857 protein disaggregation chaperone; Provisional 90.88
PRK11823446 DNA repair protein RadA; Provisional 90.86
KOG2543438 consensus Origin recognition complex, subunit 5 [R 90.83
PRK08699325 DNA polymerase III subunit delta'; Validated 90.8
PF00005137 ABC_tran: ABC transporter This structure is on hol 90.79
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 90.78
PRK13695174 putative NTPase; Provisional 90.77
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 90.71
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 90.71
PHA03333752 putative ATPase subunit of terminase; Provisional 90.71
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 90.69
PRK06964342 DNA polymerase III subunit delta'; Validated 90.69
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 90.65
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 90.64
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 90.62
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 90.47
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 90.45
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 90.42
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 90.38
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 90.36
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.34
PRK08233182 hypothetical protein; Provisional 90.34
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 90.32
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 90.3
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 90.27
PLN02165334 adenylate isopentenyltransferase 90.19
PRK08058329 DNA polymerase III subunit delta'; Validated 90.18
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 90.16
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 90.16
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 90.1
PRK13764602 ATPase; Provisional 90.09
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 90.06
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 90.03
COG1117253 PstB ABC-type phosphate transport system, ATPase c 90.02
COG4525259 TauB ABC-type taurine transport system, ATPase com 89.99
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 89.88
PF12846304 AAA_10: AAA-like domain 89.88
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-147  Score=1143.93  Aligned_cols=572  Identities=67%  Similarity=1.036  Sum_probs=545.0

Q ss_pred             hHHHHHHHhhccccccc-------cccccccccc----------cCCCCCCccccccCCcccccchHHHHHHHhcCCCCh
Q 037717            5 DAWEKQQREKCTFEIED-------KIVDFFSESV----------FDGDNFDEFESELPNKSVVKSTLEMLQEERKTLPIY   67 (582)
Q Consensus         5 ~~w~~~~~~~~~~~~~~-------~~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~lPi~   67 (582)
                      +.||++|+.++.++|++       +.|||+.++.          ..|.+.+...    .......+...+.+.|++||||
T Consensus       192 ~~WEd~ql~~a~~~~ga~~~~~~~~~ye~vfdd~~~idF~~e~~~~~~~e~~~~----~~~~~~~~~~~iee~RksLPVy  267 (902)
T KOG0923|consen  192 RAWEDHQLGNAMLKFGAKDAKEGSDGYEFVFDDQIVIDFIQESKLAGSNEEDAK----DAPTAYERRESIEEVRKSLPVY  267 (902)
T ss_pred             HHHHHHHhhhhHhhcCCCcCcccccCceeeccchhhhhHHHhhhccccCccccc----hhhHHHHHHHHHHHHHhcCCch
Confidence            56999999999988866       4566666553          3443322111    1111113678899999999999


Q ss_pred             HHHHHHHHHHhCCCeEEEECCCCCchhchHhhhhcc--------------chHHHHHHHHHHHHHHhCCccCcEEeEEEe
Q 037717           68 PFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYE--------------PRWVAAMSVAARVSQEMGVKLGHEVGYSIR  133 (582)
Q Consensus        68 ~~~~~il~~i~~~~~viv~a~TGSGKTt~ip~~ll~--------------P~r~~a~~~a~~va~~~~~~~g~~vgy~v~  133 (582)
                      .|+++++.++++|||+||+|+||||||||+||||++              |||++|+++|.|||+|||+.+|++|||++|
T Consensus       268 ~ykdell~av~e~QVLiI~GeTGSGKTTQiPQyL~EaGytk~gk~IgcTQPRRVAAmSVAaRVA~EMgvkLG~eVGYsIR  347 (902)
T KOG0923|consen  268 PYKDELLKAVKEHQVLIIVGETGSGKTTQIPQYLYEAGYTKGGKKIGCTQPRRVAAMSVAARVAEEMGVKLGHEVGYSIR  347 (902)
T ss_pred             hhHHHHHHHHHhCcEEEEEcCCCCCccccccHHHHhcccccCCceEeecCcchHHHHHHHHHHHHHhCcccccccceEEE
Confidence            999999999999999999999999999999999998              999999999999999999999999999999


Q ss_pred             ecccCCCCccEEEEChHHHHHHHHcCCCCCCCCceEeecccCCCcchhHHHHHHHHHHhhCCCceEEEecccCChHHHHh
Q 037717          134 FEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSD  213 (582)
Q Consensus       134 ~~~~~~~~t~I~~~T~g~Ll~~l~~~~~l~~~~~vViDE~HeR~~~~d~ll~~lk~~~~~~~~~kii~~SAT~~~~~~~~  213 (582)
                      |++|++++|.|.|||+|||+++++.+|.|.+||+|||||||||++++|+|++++|++.+.||++|++++|||+|+++|+.
T Consensus       348 FEdcTSekTvlKYMTDGmLlREfL~epdLasYSViiiDEAHERTL~TDILfgLvKDIar~RpdLKllIsSAT~DAekFS~  427 (902)
T KOG0923|consen  348 FEDCTSEKTVLKYMTDGMLLREFLSEPDLASYSVIIVDEAHERTLHTDILFGLVKDIARFRPDLKLLISSATMDAEKFSA  427 (902)
T ss_pred             eccccCcceeeeeecchhHHHHHhccccccceeEEEeehhhhhhhhhhHHHHHHHHHHhhCCcceEEeeccccCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhCCCCEEeeCCceeceeEEEecCCchhHHHHHHHHHHHHHhcCCCCCEEEEcCCHHHHHHHHHHHHHhhhccCCCCCCe
Q 037717          214 YFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAEL  293 (582)
Q Consensus       214 ~f~~~~v~~i~gr~~~v~~~~~~~~~~~~~~~~~~~~~~i~~~~~~g~iLVFl~~~~~i~~~~~~L~~~~~~~~~~~~~~  293 (582)
                      ||+++|||.+|||.|||+++|...|+.||+++++.++++||.+++.|+||||++|+++|+.+.+.|.++++.+|.+..++
T Consensus       428 fFDdapIF~iPGRRyPVdi~Yt~~PEAdYldAai~tVlqIH~tqp~GDILVFltGQeEIEt~~e~l~~~~~~LGski~el  507 (902)
T KOG0923|consen  428 FFDDAPIFRIPGRRYPVDIFYTKAPEADYLDAAIVTVLQIHLTQPLGDILVFLTGQEEIETVKENLKERCRRLGSKIREL  507 (902)
T ss_pred             hccCCcEEeccCcccceeeecccCCchhHHHHHHhhheeeEeccCCccEEEEeccHHHHHHHHHHHHHHHHHhccccceE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEecCCCCHHHHHHhcCCCCCCCcEEEEeCCCCccccccCCeeEEEeCCcccceeecCCCCcccccccccCHHhHHHH
Q 037717          294 IICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQR  373 (582)
Q Consensus       294 ~v~~lh~~l~~~~r~~v~~~~~~g~~kVivaT~iae~gidIp~v~~VID~g~~k~~~yd~~~~~~~l~~~~~S~~~~~QR  373 (582)
                      .++|+|++||.+.|.+||++.|+|.||||+||||||||||||||.||||+|++|++.|||++||+++...||||+++.||
T Consensus       508 iv~PiYaNLPselQakIFePtP~gaRKVVLATNIAETSlTIdgI~yViDpGf~K~nsynprtGmesL~v~piSKAsA~QR  587 (902)
T KOG0923|consen  508 IVLPIYANLPSELQAKIFEPTPPGARKVVLATNIAETSLTIDGIKYVIDPGFVKQNSYNPRTGMESLLVTPISKASANQR  587 (902)
T ss_pred             EEeeccccCChHHHHhhcCCCCCCceeEEEeecchhhceeecCeEEEecCccccccCcCCCcCceeEEEeeechhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCCCCCCeEEEeeChhhhhhhhh--h-hhHhhhh--HHHHHHHHhcCCccccccCCCCchHHHHHHHHHHHHHcCCC
Q 037717          374 TGLSERTGPGKCFRLYTLHNYHRIWM--T-ILCQKYN--ELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFELLYALGAL  448 (582)
Q Consensus       374 ~GRaGR~~~G~~~~L~~~~~~~~~~~--~-pei~r~~--~~~L~l~~l~~~~~~~f~~~~~p~~~~i~~al~~L~~lgal  448 (582)
                      +|||||+|||+||||||.+.|.+.++  + |||+|.|  ++||.||+|||.|+.+|+|+|||+.+++..|+++|+.+|||
T Consensus       588 aGRAGRtgPGKCfRLYt~~aY~~eLE~~t~PEIqRtnL~nvVL~LkSLGI~Dl~~FdFmDpPp~etL~~aLE~LyaLGAL  667 (902)
T KOG0923|consen  588 AGRAGRTGPGKCFRLYTAWAYEHELEEMTVPEIQRTNLGNVVLLLKSLGIHDLIHFDFLDPPPTETLLKALEQLYALGAL  667 (902)
T ss_pred             ccccCCCCCCceEEeechhhhhhhhccCCCcceeeccchhHHHHHHhcCcchhcccccCCCCChHHHHHHHHHHHHhhcc
Confidence            99999999999999999999999988  4 9999999  99999999999999999999999999999999999999999


Q ss_pred             cCCCccchhchhhhcCCCChHHHHHHHhcccccChHHHHHHHHhhccCCCccccChhhHHHHHHHhhhccCCCCCcHHHH
Q 037717          449 NKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNARMNFHLGDVGDRIAL  528 (582)
Q Consensus       449 ~~~~~lT~lG~~~a~lpl~p~~~k~l~~~~~~~c~~~~l~i~a~l~~~~~~f~~~~~~~~~~~~~~~~f~~~~~sD~~~~  528 (582)
                      +..|+||.+|+.|++||+||+++|||+.+..+.|.+|+++|+||||++.++|++|+++...++++++.|..+ .|||+++
T Consensus       668 n~~GeLTk~GrrMaEfP~dPmlsKmi~as~ky~cs~EiitiaamlS~~~svfyrpk~~~v~ad~a~~~f~~~-~gDhi~~  746 (902)
T KOG0923|consen  668 NHLGELTKLGRRMAEFPVDPMLSKMIVASEKYKCSEEIITIAAMLSVGASVFYRPKDKQVHADNARKNFEEP-VGDHIVL  746 (902)
T ss_pred             ccccchhhhhhhhhhcCCCHHHHhHHhhhccccchHHHHHHHHHHhcCchheecchhhhhhhhhhhhccCCC-Ccchhhh
Confidence            999999999999999999999999999999999999999999999999999999999999999999999876 5999999


Q ss_pred             HHHHHHHHHcCCcHHHHHHcCCCHHHHHHHHHHHHHHHHHHHhcCCccccCCC
Q 037717          529 LRVYNCWRECNYSTEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTSIYSN  581 (582)
Q Consensus       529 l~~~~~~~~~~~~~~~c~~~~l~~~~l~~~~~~~~ql~~~l~~~~~~~~~~~~  581 (582)
                      |++|++|.+++++.+||.+||+++++|++|+++|+||..+|+++++...++.|
T Consensus       747 L~vyn~w~es~~s~~wC~e~~iq~~sm~rardir~qL~gll~~v~~~~~s~~~  799 (902)
T KOG0923|consen  747 LNVYNQWKESKYSTQWCYENFIQYRSMKRARDIRDQLEGLLERVEIDLSSNQN  799 (902)
T ss_pred             hHHHHHHhhcchhhHHHHHhhhhHHHHHHHHHHHHHHHHHhhhccccccCChH
Confidence            99999999999999999999999999999999999999999999999887753

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 1e-133
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 1e-133
3i4u_A 270 Crystal Structure Analysis Of A Helicase Associated 2e-31
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 2e-26
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  471 bits (1211), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 266/561 (47%), Positives = 351/561 (62%), Gaps = 49/561 (8%)
Query: 61  RKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLY---------------EPR 105
           R+ LP++   +E L+      ++  VGETGSGKTTQIPQ++                +PR
Sbjct: 90  RRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPR 149
Query: 106 WVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESY 165
            VAAMSVA RV++EM VKLG EVGYSIRFE+ TS+KT+LKYMTD MLLRE + +  L  Y
Sbjct: 150 RVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRY 209
Query: 166 SVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFKIPG 225
           S +I+DEA ERTL+TD L GLLK ++  RPDLK++I SATLDAEKF  YF  AP+  +PG
Sbjct: 210 SCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPG 269
Query: 226 RRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQ---- 281
           R YPVEL+YT   + DY+++AI T LQIH  E  GDIL+FLTG+DEIE A   +      
Sbjct: 270 RTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQ 329
Query: 282 --RTRGLGTKIAELIICPIYANLPTELQAKIFEPTPER-----ARKVVLATNIAETSLTI 334
             R  G G     L + P+Y +LP   Q +IFEP PE       RKVV++TNIAETSLTI
Sbjct: 330 LVREEGCGP----LSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTI 385
Query: 335 DGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNY 394
           DGI YV+ PGF+K K YNP+  +ESLLV+PISKASA QR G + RT PGKCFRLYT   +
Sbjct: 386 DGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAF 445
Query: 395 HRIWMTILCQKYNELIWKMLS--------LFSNVLVNFDFIDPPXXXXXXXXXXXXXXXG 446
            +    ++ Q Y E++   LS        L  + LV+FDF+DPP                
Sbjct: 446 QK---ELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLA 502
Query: 447 ALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDK 506
            L+  G LT +GR  ++FP+DP L+  ++   +++CS EI+TI AML V N +F RP   
Sbjct: 503 CLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPN-VFIRPTKD 561
Query: 507 QIYADNARMNFHLGDVGDRIALLRVYNCWRE---CNYST-EWCRENYIQVSSMKRARDIR 562
           +  AD+A+  F   D GD I LL VY+ ++      Y   +WCR++Y+   S+  A +IR
Sbjct: 562 KKRADDAKNIFAHPD-GDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIR 620
Query: 563 DQLEGLFAR--VEIDTSIYSN 581
            QLE L  R  +E++T+ Y +
Sbjct: 621 SQLERLMNRYNLELNTTDYES 641
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 0.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-96
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 4e-94
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 2e-92
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 3e-89
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 2e-82
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 1e-78
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-78
1yks_A440 Genome polyprotein [contains: flavivirin protease 3e-72
3i4u_A 270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 4e-69
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  814 bits (2104), Expect = 0.0
 Identities = 262/559 (46%), Positives = 349/559 (62%), Gaps = 51/559 (9%)

Query: 57  LQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYE------------- 103
           + + R+ LP++   +E L+      ++  VGETGSGKTTQIPQ++               
Sbjct: 86  ILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVAC 145

Query: 104 --PRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPS 161
             PR VAAMSVA RV++EM VKLG EVGYSIRFE+ TS+KT+LKYMTD MLLRE + +  
Sbjct: 146 TQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHD 205

Query: 162 LESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIF 221
           L  YS +I+DEA ERTL+TD L GLLK ++  RPDLK++I SATLDAEKF  YF  AP+ 
Sbjct: 206 LSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLL 265

Query: 222 KIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQ 281
            +PGR YPVEL+YT   + DY+++AI T LQIH  E  GDIL+FLTG+DEIE A   +  
Sbjct: 266 AVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISL 325

Query: 282 RTRGLGTK--IAELIICPIYANLPTELQAKIFEPTPE-----RARKVVLATNIAETSLTI 334
               L  +     L + P+Y +LP   Q +IFEP PE       RKVV++TNIAETSLTI
Sbjct: 326 EGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTI 385

Query: 335 DGIKYVIHPGFAKVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNY 394
           DGI YV+ PGF+K K YNP+  +ESLLV+PISKASA QR G + RT PGKCFRLYT   +
Sbjct: 386 DGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAF 445

Query: 395 HR--------------IWMTILCQKYNELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFE 440
            +              +  T+L         ++  L  + LV+FDF+DPP  E +++A E
Sbjct: 446 QKELIEQSYPEILRSNLSSTVL---------ELKKLGIDDLVHFDFMDPPAPETMMRALE 496

Query: 441 LLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIF 500
            L  L  L+  G LT +GR  ++FP+DP L+  ++   +++CS EI+TI AML V N +F
Sbjct: 497 ELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPN-VF 555

Query: 501 YRPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECNYST----EWCRENYIQVSSMK 556
            RP   +  AD+A+  F   D GD I LL VY+ ++          +WCR++Y+   S+ 
Sbjct: 556 IRPTKDKKRADDAKNIFAHPD-GDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLS 614

Query: 557 RARDIRDQLEGLFARVEID 575
            A +IR QLE L  R  ++
Sbjct: 615 AADNIRSQLERLMNRYNLE 633
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3i4u_A 270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.98
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.97
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.97
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.96
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.96
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.96
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.96
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.95
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.94
3h1t_A590 Type I site-specific restriction-modification syst 99.94
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.92
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.92
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.91
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.91
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.89
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.86
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.85
3jux_A822 Protein translocase subunit SECA; protein transloc 99.85
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.81
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.8
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.79
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.79
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.79
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.79
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.78
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.77
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.76
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.75
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.74
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.73
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.57
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.72
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.72
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.71
3bor_A237 Human initiation factor 4A-II; translation initiat 99.71
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.7
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.7
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.7
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.69
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.68
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.68
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.67
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.67
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.62
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.56
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.54
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.48
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.39
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.33
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.31
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.18
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.7
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.45
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.19
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.09
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.01
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.81
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.79
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.77
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.76
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.68
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.64
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.61
2qgz_A308 Helicase loader, putative primosome component; str 96.59
3bos_A242 Putative DNA replication factor; P-loop containing 96.58
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.58
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 96.51
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.45
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.42
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.41
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.4
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.26
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.12
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.08
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.08
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.07
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.98
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.94
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 95.9
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.84
3co5_A143 Putative two-component system transcriptional RES 95.83
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.81
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.79
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.78
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.76
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.75
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.68
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.64
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.56
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.54
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.54
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.53
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.52
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.51
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.45
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.39
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.34
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.29
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.28
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.27
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.27
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.21
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.18
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.14
3pvs_A447 Replication-associated recombination protein A; ma 95.06
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 95.04
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.0
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 94.91
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.88
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.86
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.85
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 94.83
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 94.73
2chq_A319 Replication factor C small subunit; DNA-binding pr 94.65
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 94.49
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.45
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.44
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.37
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.31
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.3
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 94.16
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 94.13
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.13
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.11
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 94.07
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 93.92
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 93.87
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.7
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 93.69
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 93.47
2fna_A357 Conserved hypothetical protein; structural genomic 93.34
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 93.29
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.28
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 93.22
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.21
1ojl_A304 Transcriptional regulatory protein ZRAR; response 93.19
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.04
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 93.01
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 92.96
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 92.88
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 92.81
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 92.81
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.77
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 92.74
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.68
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.66
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.57
2oap_1511 GSPE-2, type II secretion system protein; hexameri 92.5
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 92.4
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.34
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.28
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 92.2
3im1_A 328 Protein SNU246, PRE-mRNA-splicing helicase BRR2; A 92.07
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.05
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 91.99
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.89
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 91.84
1p9r_A418 General secretion pathway protein E; bacterial typ 91.83
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 91.68
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.6
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 91.45
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.38
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 91.3
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.24
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 91.2
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.04
3vaa_A199 Shikimate kinase, SK; structural genomics, center 90.84
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 90.79
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 90.77
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 90.73
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 90.72
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 90.65
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.48
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 90.38
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 90.34
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 90.26
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 90.18
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 90.15
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 90.14
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 90.09
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 90.05
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.88
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 89.88
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 89.86
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 89.7
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 89.66
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 89.57
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 89.53
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 89.47
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 89.46
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 89.38
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 89.36
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 89.32
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 89.24
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 89.24
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 89.14
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 89.11
1sgw_A214 Putative ABC transporter; structural genomics, P p 89.08
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 88.98
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 88.97
4a74_A231 DNA repair and recombination protein RADA; hydrola 88.93
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 88.91
1b0u_A262 Histidine permease; ABC transporter, transport pro 88.89
1g6h_A257 High-affinity branched-chain amino acid transport 88.85
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 88.84
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 88.83
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 88.83
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 88.8
2ghi_A260 Transport protein; multidrug resistance protein, M 88.7
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 88.7
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 88.61
1ji0_A240 ABC transporter; ATP binding protein, structural g 88.6
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 88.53
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 88.44
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 88.4
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 88.29
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 88.25
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 88.24
2cvh_A220 DNA repair and recombination protein RADB; filamen 88.21
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.18
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 88.18
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 88.1
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 88.05
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 87.98
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 87.96
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 87.91
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 87.89
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 87.88
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 87.88
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 87.85
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 87.84
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 87.73
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 87.71
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 87.71
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 87.64
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 87.53
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 87.3
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 87.3
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 87.15
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 87.15
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 87.06
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 87.04
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 86.95
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 86.76
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.71
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 86.7
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 86.68
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 86.63
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 86.53
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 86.47
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 86.46
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 86.46
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 86.43
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 86.42
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 86.39
3kta_A182 Chromosome segregation protein SMC; structural mai 86.28
1xjc_A169 MOBB protein homolog; structural genomics, midwest 86.28
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 86.25
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 86.23
3tlx_A243 Adenylate kinase 2; structural genomics, structura 86.21
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 86.21
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 86.18
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 86.18
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 86.11
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 86.08
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 86.05
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 86.02
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 85.98
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 85.95
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 85.95
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 85.89
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 85.86
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 85.78
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 85.78
2vli_A183 Antibiotic resistance protein; transferase, tunica 85.71
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 85.64
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 85.59
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 85.56
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 85.55
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 85.53
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 85.44
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 85.43
2xxa_A433 Signal recognition particle protein; protein trans 85.41
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 85.28
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 85.21
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 85.16
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 85.16
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 85.15
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 85.03
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 84.99
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 84.98
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 84.98
2r44_A331 Uncharacterized protein; putative ATPase, structur 84.96
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 84.96
2og2_A359 Putative signal recognition particle receptor; nuc 84.94
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 84.86
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 84.83
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 84.65
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 84.6
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 84.56
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 84.49
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 84.34
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 84.3
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 84.21
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 84.2
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 84.16
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 84.12
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 84.08
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 84.06
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 84.04
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 83.99
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 83.94
1via_A175 Shikimate kinase; structural genomics, transferase 83.89
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 83.75
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 83.69
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 83.69
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 83.64
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 83.62
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 83.59
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 83.47
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 83.47
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 83.45
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 83.39
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 83.27
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 83.26
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 83.01
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 82.59
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 82.36
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 82.31
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 82.26
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 82.18
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 82.01
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 81.93
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 81.71
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 81.5
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 81.4
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 81.4
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 81.34
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 81.3
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 81.26
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 81.13
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 81.12
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 81.02
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 80.86
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 80.82
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 80.8
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 80.69
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 80.48
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 80.45
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 80.44
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 80.39
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 80.39
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 80.32
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=4.1e-93  Score=812.12  Aligned_cols=528  Identities=49%  Similarity=0.802  Sum_probs=493.2

Q ss_pred             cccchHHHHHHHhcCCCChHHHHHHHHHHhCCCeEEEECCCCCchhchHhhhhcc---------------chHHHHHHHH
Q 037717           49 VVKSTLEMLQEERKTLPIYPFWEELLQAVSGYPVLAIVGETGSGKTTQIPQYLYE---------------PRWVAAMSVA  113 (582)
Q Consensus        49 ~~~~~~~~~~~~r~~lPi~~~~~~il~~i~~~~~viv~a~TGSGKTt~ip~~ll~---------------P~r~~a~~~a  113 (582)
                      .....+.++.+.|..+|++.++++|+.++.++++++++|||||||||++|+++++               |+|++|.+++
T Consensus        78 ~l~~~~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~La~q~~  157 (773)
T 2xau_A           78 EFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVA  157 (773)
T ss_dssp             BCCHHHHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHHHHHHH
T ss_pred             CCCHHHHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHHHHHHH
Confidence            3346788888889999999999999999999999999999999999999988653               9999999999


Q ss_pred             HHHHHHhCCccCcEEeEEEeecccCCCCccEEEEChHHHHHHHHcCCCCCCCCceEeecccCCCcchhHHHHHHHHHHhh
Q 037717          114 ARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINY  193 (582)
Q Consensus       114 ~~va~~~~~~~g~~vgy~v~~~~~~~~~t~I~~~T~g~Ll~~l~~~~~l~~~~~vViDE~HeR~~~~d~ll~~lk~~~~~  193 (582)
                      .+++++++..+|..+||.++++.....+++|+++|+|++++.+..++.+.++++|||||+|+|+++.|.++.+++.+...
T Consensus       158 ~~l~~~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~  237 (773)
T 2xau_A          158 QRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKR  237 (773)
T ss_dssp             HHHHHHTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHHHHHHh
Confidence            99999999999999999999988888899999999999999999988899999999999999999999999999999988


Q ss_pred             CCCceEEEecccCChHHHHhhhCCCCEEeeCCceeceeEEEecCCchhHHHHHHHHHHHHHhcCCCCCEEEEcCCHHHHH
Q 037717          194 RPDLKLLISSATLDAEKFSDYFGSAPIFKIPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIE  273 (582)
Q Consensus       194 ~~~~kii~~SAT~~~~~~~~~f~~~~v~~i~gr~~~v~~~~~~~~~~~~~~~~~~~~~~i~~~~~~g~iLVFl~~~~~i~  273 (582)
                      +++.++|+||||++.+.+++||++++++.++|+.+|++++|...+..++....+..+++++...++|++||||+|+++++
T Consensus       238 ~~~~~iIl~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~~i~  317 (773)
T 2xau_A          238 RPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIE  317 (773)
T ss_dssp             CTTCEEEEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHHHHHHHHHHHHHSCSCEEEEECSCHHHHH
T ss_pred             CCCceEEEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHHHHHHHHHHHHhcCCCCEEEECCCHHHHH
Confidence            89999999999999999999999999999999999999999998888999888888888888777899999999999999


Q ss_pred             HHHHHHHHhhhcc--CCCCCCeEEEEecCCCCHHHHHHhcCCCC-----CCCcEEEEeCCCCccccccCCeeEEEeCCcc
Q 037717          274 RAEEILKQRTRGL--GTKIAELIICPIYANLPTELQAKIFEPTP-----ERARKVVLATNIAETSLTIDGIKYVIHPGFA  346 (582)
Q Consensus       274 ~~~~~L~~~~~~~--~~~~~~~~v~~lh~~l~~~~r~~v~~~~~-----~g~~kVivaT~iae~gidIp~v~~VID~g~~  346 (582)
                      .+++.|.+....+  .....++.+.++||+|++++|+++++.|+     +|.++||||||++|+|||||+|++|||+|++
T Consensus       318 ~l~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~  397 (773)
T 2xau_A          318 DAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFS  397 (773)
T ss_dssp             HHHHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEE
T ss_pred             HHHHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCc
Confidence            9999998644322  11225788999999999999999999999     9999999999999999999999999999999


Q ss_pred             cceeecCCCCcccccccccCHHhHHHHhcCCCCCCCCeEEEeeChhhhhh-hhh--hhhHhhhh--HHHHHHHHhcCCcc
Q 037717          347 KVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNYHR-IWM--TILCQKYN--ELIWKMLSLFSNVL  421 (582)
Q Consensus       347 k~~~yd~~~~~~~l~~~~~S~~~~~QR~GRaGR~~~G~~~~L~~~~~~~~-~~~--~pei~r~~--~~~L~l~~l~~~~~  421 (582)
                      |.+.||+..|++.+...|+|+++|.||+|||||.++|.||+||++.++.. +.+  .|||++.+  +++|+++.+|++++
T Consensus       398 k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~~L~~~~L~l~~~gi~~~  477 (773)
T 2xau_A          398 KQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDL  477 (773)
T ss_dssp             EEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCSSCCCGGGGSCCHHHHHHHHHTTCCCG
T ss_pred             cceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccccCCCccccCcHHHHHHHHHHcCCCCh
Confidence            99999999999999999999999999999999999999999999999954 444  59999999  99999999999999


Q ss_pred             ccccCCCCchHHHHHHHHHHHHHcCCCcCCCccchhchhhhcCCCChHHHHHHHhcccccChHHHHHHHHhhccCCCccc
Q 037717          422 VNFDFIDPPLEEALLKAFELLYALGALNKAGQLTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFY  501 (582)
Q Consensus       422 ~~f~~~~~p~~~~i~~al~~L~~lgal~~~~~lT~lG~~~a~lpl~p~~~k~l~~~~~~~c~~~~l~i~a~l~~~~~~f~  501 (582)
                      ..|+|++||+.+.+..|++.|..+||||++|+||++|+.|++||++|++||||+.|..++|++++++|+|||++ .++|+
T Consensus       478 ~~f~~~~~p~~~~i~~a~~~L~~lgald~~~~lT~lG~~~a~~pl~p~~~~~l~~~~~~~c~~~~l~i~a~ls~-~~~f~  556 (773)
T 2xau_A          478 VHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSV-PNVFI  556 (773)
T ss_dssp             GGCCCSSCCCHHHHHHHHHHHHHTTSBCTTSCBCHHHHHHTTSSSCHHHHHHHHHGGGGTCHHHHHHHHHHHTS-CCCBC
T ss_pred             hhccccCCCcHHHHHHHHHHHHHcCCcccCCCcChhhhhhccccCCHHHHHHHHhhcccCchhHHHHHHHhccc-CCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998 78999


Q ss_pred             cChhhHHHHHHHhhhccCCCCCcHHHHHHHHHHHHHcC---Cc-HHHHHHcCCCHHHHHHHHHHHHHHHHHHHhcCCccc
Q 037717          502 RPKDKQIYADNARMNFHLGDVGDRIALLRVYNCWRECN---YS-TEWCRENYIQVSSMKRARDIRDQLEGLFARVEIDTS  577 (582)
Q Consensus       502 ~~~~~~~~~~~~~~~f~~~~~sD~~~~l~~~~~~~~~~---~~-~~~c~~~~l~~~~l~~~~~~~~ql~~~l~~~~~~~~  577 (582)
                      +|.+.+.+++.++.+|.... |||++++|+|++|.+.+   .+ .+||++||||+++|++|.++|.||.++|.+++++..
T Consensus       557 ~~~~~~~~~~~~~~~f~~~~-~D~~~~l~~~~~~~~~~~~~~~~~~~c~~~~l~~~~l~~~~~~~~ql~~~~~~~~~~~~  635 (773)
T 2xau_A          557 RPTKDKKRADDAKNIFAHPD-GDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELN  635 (773)
T ss_dssp             CCTTCHHHHHHHHHTTCCTT-BHHHHHHHHHHHHTSHHHHHHCHHHHHHHTTBCHHHHHHHHHHHHHHHHHHHHTTCCCC
T ss_pred             CChHHHHHHHHHHHhccCCC-CcHHHHHHHHHHHHHhccccchHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHhcCCCcC
Confidence            99999999999999998754 99999999999997654   44 789999999999999999999999999999998865


Q ss_pred             c
Q 037717          578 I  578 (582)
Q Consensus       578 ~  578 (582)
                      +
T Consensus       636 ~  636 (773)
T 2xau_A          636 T  636 (773)
T ss_dssp             C
T ss_pred             C
Confidence            4
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3im1_A Protein SNU246, PRE-mRNA-splicing helicase BRR2; ATPase, RNA helicase, rnpase, RNA unwindase, molecular model mRNA splicing; 1.65A {Saccharomyces cerevisiae} PDB: 3im2_A* 3hib_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 582
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 2e-50
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 5e-34
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 4e-23
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 4e-12
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  174 bits (441), Expect = 2e-50
 Identities = 52/344 (15%), Positives = 91/344 (26%), Gaps = 59/344 (17%)

Query: 223 IPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQR 282
            P     +E   T  P   +            +         FL            L   
Sbjct: 6   FPHSNGEIEDVQTDIPSEPWNTGHDW------ILADKRPTAWFLPSIRAANVMAASL--- 56

Query: 283 TRGLGTKIAELIICPIYANLPTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIH 342
            R  G  +       +           I +  P      +LAT+IAE    +  ++ V+ 
Sbjct: 57  -RKAGKSV-----VVLNRKTFEREYPTIKQKKP----DFILATDIAEMGANLC-VERVLD 105

Query: 343 PGFA-KVKSYNPKTGMESLLVNPISKASANQRTGLSERTGPGKCFRLYTLHNY------- 394
              A K    +    +       IS +SA QR G   R  P +    Y            
Sbjct: 106 CRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRN-PNRDGDSYYYSEPTSENNAH 164

Query: 395 HRIWMTILCQKYN-ELIWKMLSLFSNVLVNFDFIDPPLEEALLKAFELLYALGALNKAGQ 453
           H  W+       N E+   M++      V          E  L+  +       +     
Sbjct: 165 HVCWLEASMLLDNMEVRGGMVAPLY--GVEGTKTPVSPGEMRLRDDQRKVFRELVRNCDL 222

Query: 454 LTRVGRQMAEFPIDPKLSKTIVSLDKYKCSDEIITIAAMLFVGNSIFYRPKDKQIYADNA 513
              +  Q+A+  +           D+  C                 F  P++ +I  D+ 
Sbjct: 223 PVWLSWQVAKAGLKT--------NDRKWC-----------------FEGPEEHEILNDSG 257

Query: 514 RMNFHLGDVGDRIALLRVYNCWRECNYSTEWCRENYIQVSSMKR 557
                    G +  L   +    E   S +     +I+ +  +R
Sbjct: 258 ETVKCRAPGGAKKPLRPRW--CDERVSSDQSALSEFIKFAEGRR 299
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.97
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.83
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.82
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.82
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.81
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.81
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.81
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.8
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.8
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.8
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.78
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.76
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.75
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.72
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.71
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.71
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.71
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.71
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.68
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.66
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.65
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.64
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.61
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.6
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.58
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.58
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.57
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.57
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.56
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.56
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.53
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.41
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.32
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.29
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.1
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.09
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.02
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.76
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.68
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.57
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.82
d1okkd2207 GTPase domain of the signal recognition particle r 97.68
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.54
d1vmaa2213 GTPase domain of the signal recognition particle r 97.53
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.53
d2qy9a2211 GTPase domain of the signal recognition particle r 97.51
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.44
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.17
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.1
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.98
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.82
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 96.71
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.68
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.58
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.57
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.53
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.29
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.95
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.89
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.86
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.78
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.78
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.76
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.72
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.71
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 95.42
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.39
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.21
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 95.14
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.11
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.05
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.87
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.82
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.81
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.7
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.67
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.59
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.53
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.44
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.42
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.42
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.2
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.02
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.93
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.77
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.68
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.65
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 93.64
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.59
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.33
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.25
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.13
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.08
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.06
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.81
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.71
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.66
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.64
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 92.57
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 92.54
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.43
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.43
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.38
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.3
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.29
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.19
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.15
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.99
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.91
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 91.88
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.86
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.79
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.54
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.53
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.35
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 90.97
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 90.87
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.85
d2p6ra185 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 90.76
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.75
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.71
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.66
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.65
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 90.63
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 90.53
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.51
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 90.49
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 90.47
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 90.46
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.43
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 90.39
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.3
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.13
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.1
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 89.97
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 89.91
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.72
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 89.67
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 89.65
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 89.31
d1g2912240 Maltose transport protein MalK, N-terminal domain 89.24
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 89.12
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 88.97
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 88.88
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 88.56
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 88.49
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.23
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 87.95
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 87.48
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.44
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 86.86
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 86.4
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 86.38
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 86.23
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.09
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 86.08
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 85.86
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 85.77
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 85.06
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.94
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 84.58
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 84.51
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 84.17
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 83.35
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 83.26
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 82.71
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 82.54
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.47
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 82.36
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 82.09
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 81.72
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 81.2
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 80.78
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 80.77
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.22
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=100.00  E-value=1e-34  Score=294.19  Aligned_cols=283  Identities=15%  Similarity=0.125  Sum_probs=201.6

Q ss_pred             HHhCCCeEEEECCCCCchhchHh-hhhcc------------chHHHHHHHHHHHHHHhCCccCcEEeEEEeecccCCCCc
Q 037717           76 AVSGYPVLAIVGETGSGKTTQIP-QYLYE------------PRWVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKT  142 (582)
Q Consensus        76 ~i~~~~~viv~a~TGSGKTt~ip-~~ll~------------P~r~~a~~~a~~va~~~~~~~g~~vgy~v~~~~~~~~~t  142 (582)
                      .++++++++|.||||||||+.+. .++..            |+|++|.++++++....    +...++  ..+...+..+
T Consensus         5 ~~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~~~~~~lvi~Ptr~La~q~~~~l~~~~----~~~~~~--~~~~~~~~~~   78 (305)
T d2bmfa2           5 IFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLP----IRYQTP--AIRAEHTGRE   78 (305)
T ss_dssp             SSSTTCEEEECCCTTSSTTTTHHHHHHHHHHHHTCCEEEEESSHHHHHHHHHHTTTSC----CBCCC----------CCC
T ss_pred             HhhcCCcEEEEECCCCCHHHHHHHHHHHHHHhcCCEEEEEccHHHHHHHHHHHHhcCC----cceeee--EEeecccCcc
Confidence            35689999999999999997543 33322            99999999887764321    111121  2234456778


Q ss_pred             cEEEEChHHHHHHHHcCCCCCCCCceEeecccCCCcchhHHHHHHHHHHhhCCCceEEEecccCChHHHHhhhCCCCEEe
Q 037717          143 VLKYMTDCMLLREIVIEPSLESYSVLIVDEAQERTLSTDNLFGLLKDLINYRPDLKLLISSATLDAEKFSDYFGSAPIFK  222 (582)
Q Consensus       143 ~I~~~T~g~Ll~~l~~~~~l~~~~~vViDE~HeR~~~~d~ll~~lk~~~~~~~~~kii~~SAT~~~~~~~~~f~~~~v~~  222 (582)
                      .++++|+++|...+..+..+.++++||+||+|....+.....++++... .+++.+++++|||++......         
T Consensus        79 ~i~~~t~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~-~~~~~~~v~~SAT~~~~~~~~---------  148 (305)
T d2bmfa2          79 IVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRV-EMGEAAGIFMTATPPGSRDPF---------  148 (305)
T ss_dssp             SEEEEEHHHHHHHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHH-HHTSCEEEEECSSCTTCCCSS---------
T ss_pred             ccccCCcHHHHHHHhcCccccceeEEEeeeeeecchhhHHHHHHHHHhh-ccccceEEEeecCCCcceeee---------
Confidence            9999999999998887777999999999999977666666667666644 357899999999994321111         


Q ss_pred             eCCceeceeEEEecCCchhHHHHHHHHHHHHHhcCCCCCEEEEcCCHHHHHHHHHHHHHhhhccCCCCCCeEEEEecCCC
Q 037717          223 IPGRRYPVELFYTKAPEVDYIEAAIVTALQIHVNEPTGDILVFLTGQDEIERAEEILKQRTRGLGTKIAELIICPIYANL  302 (582)
Q Consensus       223 i~gr~~~v~~~~~~~~~~~~~~~~~~~~~~i~~~~~~g~iLVFl~~~~~i~~~~~~L~~~~~~~~~~~~~~~v~~lh~~l  302 (582)
                       .....|+.......+......     ... .....++++||||+++++++.+++.|.+.         +..+..+||++
T Consensus       149 -~~~~~~~~~~~~~~~~~~~~~-----~~~-~~~~~~~~~lvf~~~~~~~~~l~~~L~~~---------~~~~~~l~~~~  212 (305)
T d2bmfa2         149 -PQSNAPIMDEEREIPERSWNS-----GHE-WVTDFKGKTVWFVPSIKAGNDIAACLRKN---------GKKVIQLSRKT  212 (305)
T ss_dssp             -CCCSSCEEEEECCCCCSCCSS-----CCH-HHHSSCSCEEEECSCHHHHHHHHHHHHHH---------TCCCEECCTTC
T ss_pred             -cccCCcceEEEEeccHHHHHH-----HHH-HHHhhCCCEEEEeccHHHHHHHHHHHHhC---------CCCEEEeCCcC
Confidence             111122222211111110000     000 11234689999999999999999999873         55688999999


Q ss_pred             CHHHHHHhcCCCCCCCcEEEEeCCCCccccccCCeeEEEeCCccc--ceeecCCCCcccccccccCHHhHHHHhcCCCCC
Q 037717          303 PTELQAKIFEPTPERARKVVLATNIAETSLTIDGIKYVIHPGFAK--VKSYNPKTGMESLLVNPISKASANQRTGLSERT  380 (582)
Q Consensus       303 ~~~~r~~v~~~~~~g~~kVivaT~iae~gidIp~v~~VID~g~~k--~~~yd~~~~~~~l~~~~~S~~~~~QR~GRaGR~  380 (582)
                      +++.+.    .+++|.++++|||+++++|+|++ ++.|||+|...  ...||+..++..+...|+|+++|.||+|||||.
T Consensus       213 ~~~~~~----~~~~~~~~~lvaT~~~~~G~~~~-~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~  287 (305)
T d2bmfa2         213 FDSEYI----KTRTNDWDFVVTTDISEMGANFK-AERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRN  287 (305)
T ss_dssp             HHHHGG----GGGTSCCSEEEECGGGGTTCCCC-CSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCS
T ss_pred             hHHHHh----hhhccchhhhhhhHHHHhcCCCC-ccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhhhhcCcCcC
Confidence            765544    45788999999999999999995 89999999865  446888888888889999999999999999999


Q ss_pred             CCCe-EEEeeChhhhh
Q 037717          381 GPGK-CFRLYTLHNYH  395 (582)
Q Consensus       381 ~~G~-~~~L~~~~~~~  395 (582)
                      +.|. ...+|..+..+
T Consensus       288 ~~~~~~~~~~~~~~~~  303 (305)
T d2bmfa2         288 PKNENDQYIYMGEPLE  303 (305)
T ss_dssp             SSCCCEEEEECSCCCC
T ss_pred             CCCceEEEEECCCCCC
Confidence            9855 55677766544
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure